SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q15637

- SF01_HUMAN

UniProt

Q15637 - SF01_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Splicing factor 1
Gene
SF1, ZFM1, ZNF162
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Necessary for the ATP-dependent first step of spliceosome assembly. Binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. May act as transcription repressor.3 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri277 – 29620CCHC-type
Add
BLAST

GO - Molecular functioni

  1. RNA binding Source: UniProtKB
  2. poly(A) RNA binding Source: UniProtKB
  3. transcription corepressor activity Source: ProtInc
  4. zinc ion binding Source: InterPro

GO - Biological processi

  1. Leydig cell differentiation Source: Ensembl
  2. mRNA 3'-splice site recognition Source: HGNC
  3. mRNA splicing, via spliceosome Source: HGNC
  4. male sex determination Source: Ensembl
  5. negative regulation of smooth muscle cell proliferation Source: Ensembl
  6. regulation of steroid biosynthetic process Source: Ensembl
  7. regulation of transcription, DNA-templated Source: UniProtKB-KW
  8. spliceosomal complex assembly Source: UniProtKB
  9. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

mRNA processing, mRNA splicing, Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, RNA-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Splicing factor 1
Alternative name(s):
Mammalian branch point-binding protein
Short name:
BBP
Short name:
mBBP
Transcription factor ZFM1
Zinc finger gene in MEN1 locus
Zinc finger protein 162
Gene namesi
Name:SF1
Synonyms:ZFM1, ZNF162
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:12950. SF1.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: UniProtKB
  2. ribosome Source: UniProtKB
  3. spliceosomal complex Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi15 – 173KKR → EED: Abolishes interaction with U2AF2.
Mutagenesisi16 – 183KRK → EDE: Abolishes interaction with U2AF2. 1 Publication
Mutagenesisi20 – 201S → A: Strongly decreases interaction with U2AF2 and spliceosome assembly. 1 Publication
Mutagenesisi20 – 201S → T: Decreases interaction with U2AF2. 1 Publication
Mutagenesisi21 – 211R → A: Decreases interaction with U2AF2 and spliceosome assembly. 1 Publication
Mutagenesisi21 – 211R → K: No effect. 1 Publication
Mutagenesisi22 – 221W → A: Abolishes interaction with U2AF2. 1 Publication
Mutagenesisi22 – 221W → F: No effect. 1 Publication
Mutagenesisi151 – 1511N → A: Decreases RNA-binding. 1 Publication
Mutagenesisi160 – 1601R → A: Strongly reduces RNA-binding. 1 Publication
Mutagenesisi184 – 1841K → A: Abolishes RNA-binding. 1 Publication
Mutagenesisi244 – 2441L → A: Decreases RNA-binding. 1 Publication
Mutagenesisi247 – 2471L → A: Decreases RNA-binding. 1 Publication
Mutagenesisi254 – 2541L → A: Slightly decreases RNA-binding. 1 Publication
Mutagenesisi255 – 2551R → A: Slightly decreases RNA-binding. 1 Publication

Organism-specific databases

PharmGKBiPA37533.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 639638Splicing factor 1
PRO_0000050129Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine4 Publications
Modified residuei20 – 201Phosphoserine; by PKG1 Publication
Modified residuei80 – 801Phosphoserine4 Publications
Modified residuei82 – 821Phosphoserine4 Publications
Modified residuei87 – 871Phosphotyrosine By similarity

Post-translational modificationi

Phosphorylation on Ser-20 interferes with U2AF2 binding and spliceosome assembly. Isoform 6 is phosphorylated on Ser-463.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ15637.
PaxDbiQ15637.
PRIDEiQ15637.

Expressioni

Tissue specificityi

Detected in lung, ovary, adrenal gland, colon, kidney, muscle, pancreas, thyroid, placenta, brain, liver and heart.1 Publication

Gene expression databases

ArrayExpressiQ15637.
BgeeiQ15637.
CleanExiHS_SF1.
GenevestigatoriQ15637.

Organism-specific databases

HPAiHPA018883.

Interactioni

Subunit structurei

Binds U2AF2. Interacts with U1 snRNA. Binds EWSR1, FUS and TAF15. Interacts with RBM17.4 Publications

Protein-protein interaction databases

BioGridi113368. 93 interactions.
DIPiDIP-29410N.
IntActiQ15637. 31 interactions.
MINTiMINT-1582417.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi15 – 173
Helixi46 – 6722
Helixi76 – 794
Beta strandi93 – 953
Helixi97 – 11519
Helixi116 – 1183
Beta strandi136 – 1416
Turni144 – 1463
Helixi150 – 1578
Beta strandi159 – 1613
Helixi162 – 1709
Beta strandi174 – 19017
Beta strandi203 – 2119
Helixi212 – 22615
Turni227 – 2304
Helixi238 – 2447
Helixi245 – 2484
Turni249 – 2524

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1K1GNMR-A133-260[»]
1O0PNMR-B13-25[»]
1OPINMR-B13-25[»]
2M09NMR-A27-145[»]
2M0GNMR-A1-145[»]
4FXWX-ray2.29B/D14-132[»]
4FXXX-ray2.48A/B/C/D26-132[»]
ProteinModelPortaliQ15637.
SMRiQ15637. Positions 1-255.

Miscellaneous databases

EvolutionaryTraceiQ15637.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini141 – 22282KH
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi15 – 195Nuclear localization signal Reviewed prediction

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi324 – 637314Pro-rich
Add
BLAST

Sequence similaritiesi

Belongs to the BBP/SF1 family.
Contains 1 KH domain.

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiCOG5176.
HOVERGENiHBG063318.
KOiK13095.
OrthoDBiEOG7K0ZC4.
PhylomeDBiQ15637.
TreeFamiTF319159.

Family and domain databases

Gene3Di3.30.1370.10. 1 hit.
InterProiIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00013. KH_1. 1 hit.
PF00098. zf-CCHC. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 1 hit.
SM00343. ZnF_C2HC. 1 hit.
[Graphical view]
SUPFAMiSSF54791. SSF54791. 1 hit.
PROSITEiPS50084. KH_TYPE_1. 1 hit.
PS50158. ZF_CCHC. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q15637-1) [UniParc]FASTAAdd to Basket

Also known as: SF1-HL1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MATGANATPL DFPSKKRKRS RWNQDTMEQK TVIPGMPTVI PPGLTREQER    50
AYIVQLQIED LTRKLRTGDL GIPPNPEDRS PSPEPIYNSE GKRLNTREFR 100
TRKKLEEERH NLITEMVALN PDFKPPADYK PPATRVSDKV MIPQDEYPEI 150
NFVGLLIGPR GNTLKNIEKE CNAKIMIRGK GSVKEGKVGR KDGQMLPGED 200
EPLHALVTAN TMENVKKAVE QIRNILKQGI ETPEDQNDLR KMQLRELARL 250
NGTLREDDNR ILRPWQSSET RSITNTTVCT KCGGAGHIAS DCKFQRPGDP 300
QSAQDKARMD KEYLSLMAEL GEAPVPASVG STSGPATTPL ASAPRPAAPA 350
NNPPPPSLMS TTQSRPPWMN SGPSESRPYH GMHGGGPGGP GGGPHSFPHP 400
LPSLTGGHGG HPMQHNPNGP PPPWMQPPPP PMNQGPHPPG HHGPPPMDQY 450
LGSTPVGSGV YRLHQGKGMM PPPPMGMMPP PPPPPSGQPP PPPSGPLPPW 500
QQQQQQPPPP PPPSSSMASS TPLPWQQNTT TTTTSAGTGS IPPWQQQQAA 550
AAASPGAPQM QGNPTMVPLP PGVQPPLPPG APPPPPPPPP GSAGMMYAPP 600
PPPPPPMDPS NFVTMMGMGV AGMPPFGMPP APPPPPPQN 639
Length:639
Mass (Da):68,330
Last modified:January 23, 2007 - v4
Checksum:iEEBC6A02B29DAE4D
GO
Isoform 2 (identifier: Q15637-2) [UniParc]FASTAAdd to Basket

Also known as: SF1-Bo, Bone

The sequence of this isoform differs from the canonical sequence as follows:
     597-639: YAPPPPPPPP...PAPPPPPPQN → IPPRGGDGPS...WWTGWFGKAA

Show »
Length:638
Mass (Da):68,633
Checksum:i06044F670EDC10C9
GO
Isoform 3 (identifier: Q15637-3) [UniParc]FASTAAdd to Basket

Also known as: ZFM1-A, ZFM1-ABCDEF

The sequence of this isoform differs from the canonical sequence as follows:
     587-639: PPPPGSAGMM...PAPPPPPPQN → RSIECLLCLL...PSPRRRWPEP

Show »
Length:623
Mass (Da):67,277
Checksum:iC07C74BBDC4093B7
GO
Isoform 4 (identifier: Q15637-4) [UniParc]FASTAAdd to Basket

Also known as: ZFM1-B, ZFM1-ABCDF

The sequence of this isoform differs from the canonical sequence as follows:
     528-548: NTTTTTTSAGTGSIPPWQQQQ → RSLPAAAMARAMRVRTFRAHW
     549-639: Missing.

Show »
Length:548
Mass (Da):59,712
Checksum:iDDB42B66ABA2AD18
GO
Isoform 5 (identifier: Q15637-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-10: L → LGKLGPPGLP...QQPGPAGGGG
     528-548: NTTTTTTSAGTGSIPPWQQQQ → RSLPAAAMARAMRVRTFRAHW
     549-639: Missing.

Note: No experimental confirmation available.

Show »
Length:673
Mass (Da):71,752
Checksum:i8F39B77A4DAE9FBD
GO
Isoform 6 (identifier: Q15637-6) [UniParc]FASTAAdd to Basket

Also known as: ZFM1-D, B6

The sequence of this isoform differs from the canonical sequence as follows:
     448-548: DQYLGSTPVG...GSIPPWQQQQ → GKSVPGKYACGLWGLSPASRKRYDAATTYGHDA
     555-639: PGAPQMQGNP...PAPPPPPPQN → QWAAPTPSLW...WWTGWFGKAA

Note: Contains a phosphoserine at position 463.

Show »
Length:571
Mass (Da):61,889
Checksum:i5DA04D16D93EBDD5
GO
Isoform 7 (identifier: Q15637-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.

Note: No experimental confirmation available.

Show »
Length:613
Mass (Da):65,371
Checksum:iC1EBBE4FC3AA66BF
GO

Sequence cautioni

The sequence AAH00773.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti357 – 3571S → T.1 Publication
VAR_017196

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2626Missing in isoform 7.
VSP_045274Add
BLAST
Alternative sequencei10 – 101L → LGKLGPPGLPPLPGPKGGFE PGPPPAPGPGAGLLAPGPPP PPPVGSMGALTAAFPFAALP PPPPPPPPPPPQQPPPPPPP PSPGASYPPPQPPPPPPLYQ RVSPPQPPPPQPPRKDQQPG PAGGGG in isoform 5.
VSP_008833
Alternative sequencei448 – 548101DQYLG…WQQQQ → GKSVPGKYACGLWGLSPASR KRYDAATTYGHDA in isoform 6.
VSP_008834Add
BLAST
Alternative sequencei528 – 54821NTTTT…WQQQQ → RSLPAAAMARAMRVRTFRAH W in isoform 4 and isoform 5.
VSP_008835Add
BLAST
Alternative sequencei549 – 63991Missing in isoform 4 and isoform 5.
VSP_008836Add
BLAST
Alternative sequencei555 – 63985PGAPQ…PPPQN → QWAAPTPSLWSSSPMATTAA AASATPSAQQQYGFQYPLAM AAKIPPRGGDGPSHESEDFP RPLVTLPGRQPQQRPWWTGW FGKAA in isoform 6.
VSP_008837Add
BLAST
Alternative sequencei587 – 63953PPPPG…PPPQN → RSIECLLCLLSLLTQLPLPL PKPGRQDPSPRRRWPEP in isoform 3.
VSP_008838Add
BLAST
Alternative sequencei597 – 63943YAPPP…PPPQN → IPPRGGDGPSHESEDFPRPL VTLPGRQPQQRPWWTGWFGK AA in isoform 2.
VSP_008839Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti269 – 2691E → G in BAA05116. 1 Publication
Sequence conflicti269 – 2691E → G in BAA05117. 1 Publication
Sequence conflicti348 – 3481A → R in AAB03514. 1 Publication
Sequence conflicti348 – 3481A → R in AAB04033. 1 Publication
Sequence conflicti377 – 3771R → W in BAA05116. 1 Publication
Sequence conflicti377 – 3771R → W in BAA05117. 1 Publication
Sequence conflicti570 – 5701P → L in BAH11587. 1 Publication
Sequence conflicti591 – 5911G → V in AAB04033. 1 Publication
Sequence conflicti623 – 6231M → I in AAB04033. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y08765 mRNA. Translation: CAA70018.1.
Y08766 mRNA. Translation: CAA70019.1.
L49345 mRNA. Translation: AAB03514.1.
L49380 mRNA. Translation: AAB04033.1.
D26120 mRNA. Translation: BAA05116.1.
D26120 mRNA. Translation: BAA05117.1.
AK293753 mRNA. Translation: BAH11587.1.
AP001462 Genomic DNA. No translation available.
BC000773 mRNA. Translation: AAH00773.1. Different initiation.
BC008080 mRNA. Translation: AAH08080.1.
BC008724 mRNA. Translation: AAH08724.1.
BC011657 mRNA. No translation available.
BC020217 mRNA. Translation: AAH20217.1.
BC038446 mRNA. Translation: AAH38446.1.
AJ000051, AJ000052 Genomic DNA. Translation: CAA03883.1.
CCDSiCCDS31599.1. [Q15637-1]
CCDS44642.2. [Q15637-6]
CCDS53660.1. [Q15637-7]
CCDS53661.1. [Q15637-5]
CCDS8080.1. [Q15637-2]
CCDS8081.1. [Q15637-4]
PIRiG02919.
RefSeqiNP_001171501.1. NM_001178030.1. [Q15637-5]
NP_001171502.1. NM_001178031.1. [Q15637-7]
NP_004621.2. NM_004630.3. [Q15637-1]
NP_973724.1. NM_201995.2. [Q15637-2]
NP_973727.1. NM_201998.2. [Q15637-4]
UniGeneiHs.502829.

Genome annotation databases

EnsembliENST00000227503; ENSP00000227503; ENSG00000168066. [Q15637-4]
ENST00000334944; ENSP00000334414; ENSG00000168066. [Q15637-2]
ENST00000377387; ENSP00000366604; ENSG00000168066.
ENST00000377390; ENSP00000366607; ENSG00000168066. [Q15637-1]
ENST00000377394; ENSP00000366611; ENSG00000168066. [Q15637-6]
ENST00000433274; ENSP00000396793; ENSG00000168066. [Q15637-7]
GeneIDi7536.
KEGGihsa:7536.
UCSCiuc001oaz.2. human. [Q15637-5]
uc001oba.2. human. [Q15637-2]
uc001obb.2. human. [Q15637-1]
uc001obc.2. human. [Q15637-4]
uc001obd.2. human. [Q15637-6]

Polymorphism databases

DMDMi38258418.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y08765 mRNA. Translation: CAA70018.1 .
Y08766 mRNA. Translation: CAA70019.1 .
L49345 mRNA. Translation: AAB03514.1 .
L49380 mRNA. Translation: AAB04033.1 .
D26120 mRNA. Translation: BAA05116.1 .
D26120 mRNA. Translation: BAA05117.1 .
AK293753 mRNA. Translation: BAH11587.1 .
AP001462 Genomic DNA. No translation available.
BC000773 mRNA. Translation: AAH00773.1 . Different initiation.
BC008080 mRNA. Translation: AAH08080.1 .
BC008724 mRNA. Translation: AAH08724.1 .
BC011657 mRNA. No translation available.
BC020217 mRNA. Translation: AAH20217.1 .
BC038446 mRNA. Translation: AAH38446.1 .
AJ000051 , AJ000052 Genomic DNA. Translation: CAA03883.1 .
CCDSi CCDS31599.1. [Q15637-1 ]
CCDS44642.2. [Q15637-6 ]
CCDS53660.1. [Q15637-7 ]
CCDS53661.1. [Q15637-5 ]
CCDS8080.1. [Q15637-2 ]
CCDS8081.1. [Q15637-4 ]
PIRi G02919.
RefSeqi NP_001171501.1. NM_001178030.1. [Q15637-5 ]
NP_001171502.1. NM_001178031.1. [Q15637-7 ]
NP_004621.2. NM_004630.3. [Q15637-1 ]
NP_973724.1. NM_201995.2. [Q15637-2 ]
NP_973727.1. NM_201998.2. [Q15637-4 ]
UniGenei Hs.502829.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1K1G NMR - A 133-260 [» ]
1O0P NMR - B 13-25 [» ]
1OPI NMR - B 13-25 [» ]
2M09 NMR - A 27-145 [» ]
2M0G NMR - A 1-145 [» ]
4FXW X-ray 2.29 B/D 14-132 [» ]
4FXX X-ray 2.48 A/B/C/D 26-132 [» ]
ProteinModelPortali Q15637.
SMRi Q15637. Positions 1-255.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113368. 93 interactions.
DIPi DIP-29410N.
IntActi Q15637. 31 interactions.
MINTi MINT-1582417.

Polymorphism databases

DMDMi 38258418.

Proteomic databases

MaxQBi Q15637.
PaxDbi Q15637.
PRIDEi Q15637.

Protocols and materials databases

DNASUi 7536.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000227503 ; ENSP00000227503 ; ENSG00000168066 . [Q15637-4 ]
ENST00000334944 ; ENSP00000334414 ; ENSG00000168066 . [Q15637-2 ]
ENST00000377387 ; ENSP00000366604 ; ENSG00000168066 .
ENST00000377390 ; ENSP00000366607 ; ENSG00000168066 . [Q15637-1 ]
ENST00000377394 ; ENSP00000366611 ; ENSG00000168066 . [Q15637-6 ]
ENST00000433274 ; ENSP00000396793 ; ENSG00000168066 . [Q15637-7 ]
GeneIDi 7536.
KEGGi hsa:7536.
UCSCi uc001oaz.2. human. [Q15637-5 ]
uc001oba.2. human. [Q15637-2 ]
uc001obb.2. human. [Q15637-1 ]
uc001obc.2. human. [Q15637-4 ]
uc001obd.2. human. [Q15637-6 ]

Organism-specific databases

CTDi 7536.
GeneCardsi GC11M064532.
HGNCi HGNC:12950. SF1.
HPAi HPA018883.
MIMi 601516. gene.
neXtProti NX_Q15637.
PharmGKBi PA37533.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5176.
HOVERGENi HBG063318.
KOi K13095.
OrthoDBi EOG7K0ZC4.
PhylomeDBi Q15637.
TreeFami TF319159.

Miscellaneous databases

ChiTaRSi SF1. human.
EvolutionaryTracei Q15637.
GeneWikii SF1_(gene).
GenomeRNAii 7536.
NextBioi 29487.
PROi Q15637.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q15637.
Bgeei Q15637.
CleanExi HS_SF1.
Genevestigatori Q15637.

Family and domain databases

Gene3Di 3.30.1370.10. 1 hit.
InterProi IPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR001878. Znf_CCHC.
[Graphical view ]
Pfami PF00013. KH_1. 1 hit.
PF00098. zf-CCHC. 1 hit.
[Graphical view ]
SMARTi SM00322. KH. 1 hit.
SM00343. ZnF_C2HC. 1 hit.
[Graphical view ]
SUPFAMi SSF54791. SSF54791. 1 hit.
PROSITEi PS50084. KH_TYPE_1. 1 hit.
PS50158. ZF_CCHC. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Mammalian splicing factor SF1 is encoded by variant cDNAs and binds to RNA."
    Arning S., Grueter P., Bilbe G., Kraemer A.
    RNA 2:794-810(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), PROTEIN SEQUENCE OF 20-30 AND 136-150, VARIANT THR-357, FUNCTION, INTERACTION WITH U1 SNRNA, RNA-BINDING.
    Tissue: Bone and Cervix carcinoma.
  2. "Identification of two novel isoforms of the ZNF162 gene: a growing family of signal transduction and activator of RNA proteins."
    Caslini C., Spinelli O., Cazzaniga G., Golay J., De Gioia L., Pedretti A., Breviario F., Amaru R., Barbui T., Biondi A., Introna M., Rambaldi A.
    Genomics 42:268-277(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6).
    Tissue: Myeloid leukemia cell.
  3. "Isolation and characterization of a novel gene encoding nuclear protein at a locus (D11S636) tightly linked to multiple endocrine neoplasia type 1 (MEN1)."
    Toda T., Iida A., Miwa T., Nakamura Y., Imai T.
    Hum. Mol. Genet. 3:465-470(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), TISSUE SPECIFICITY.
    Tissue: Brain cortex, Cerebellum and Fetal liver.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    Tissue: Cerebellum.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5).
    Tissue: Brain, Eye, Kidney, Muscle and Skin.
  7. "Diverse modes of alternative splicing of human splicing factor SF1 deduced from the exon-intron structure of the gene."
    Kraemer A., Quentin M., Mulhauser F.
    Gene 211:29-37(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-295.
  8. Bienvenut W.V., Kanor S., Tissot J.-D., Quadroni M.
    Submitted (MAY-2006) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-15, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: T-cell.
  9. "Phosphorylation of splicing factor SF1 on Ser20 by cGMP-dependent protein kinase regulates spliceosome assembly."
    Wang X., Bruderer S., Rafi Z., Xue J., Milburn P.J., Kraemer A., Robinson P.J.
    EMBO J. 18:4549-4559(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 19-28; 94-103; 228-239 AND 298-308, FUNCTION, INTERACTION WITH U2AF2, MUTAGENESIS OF SER-20, PHOSPHORYLATION AT SER-20.
  10. "Large-scale proteomic analysis of the human spliceosome."
    Rappsilber J., Ryder U., Lamond A.I., Mann M.
    Genome Res. 12:1231-1245(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 110-135, IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH THE SPLICEOSOME.
  11. "The transcriptional repressor ZFM1 interacts with and modulates the ability of EWS to activate transcription."
    Zhang D., Paley A.J., Childs G.
    J. Biol. Chem. 273:18086-18091(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH EWSR1; FUS AND TAF15.
  12. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-463 (ISOFORM 6), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "U2AF-homology motif interactions are required for alternative splicing regulation by SPF45."
    Corsini L., Bonnal S., Basquin J., Hothorn M., Scheffzek K., Valcarcel J., Sattler M.
    Nat. Struct. Mol. Biol. 14:620-629(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RBM17.
  15. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-463 (ISOFORM 6), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND SER-82, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-463 (ISOFORM 6), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND SER-82, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  19. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND SER-82, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  20. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  21. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND SER-82, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  22. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  23. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  24. "Structural basis for recognition of the intron branch site RNA by splicing factor 1."
    Liu Z., Luyten I., Bottomley M.J., Messias A.C., Houngninou-Molango S., Sprangers R., Zanier K., Kraemer A., Sattler M.
    Science 294:1098-1102(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 133-255 IN COMPLEX WITH THE BRANCH SITE SEQUENCE 5'-UAUACUAACAA-3', MUTAGENESIS OF ASN-151; ARG-160; LYS-184; LEU-244; LEU-247; LEU-254 AND ARG-255.
  25. "Structural basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP."
    Selenko P., Gregorovic G., Sprangers R., Stier G., Rhani Z., Kraemer A., Sattler M.
    Mol. Cell 11:965-976(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: STRUCTURE BY NMR OF 13-25 IN COMPLEX WITH U2AF2, MUTAGENESIS OF 16-LYS--ARG-18; 17-LYS-LYS-18; ARG-21 AND TRP-22.

Entry informationi

Entry nameiSF01_HUMAN
AccessioniPrimary (citable) accession number: Q15637
Secondary accession number(s): B7Z1Q1
, C9JJE2, Q14818, Q14819, Q15913, Q8IY00, Q92744, Q92745, Q969H7, Q9BW01, Q9UEI0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 7, 2003
Last sequence update: January 23, 2007
Last modified: September 3, 2014
This is version 153 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi