Q15637 (SF01_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 141.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Splicing factor 1 Alternative name(s): Mammalian branch point-binding protein Short name=BBP Short name=mBBP Transcription factor ZFM1 Zinc finger gene in MEN1 locus Zinc finger protein 162 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 639 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Necessary for the ATP-dependent first step of spliceosome assembly. Binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. May act as transcription repressor. Ref.1 Ref.9 Ref.11 |
| Subunit structure | Binds U2AF2. Interacts with U1 snRNA. Binds EWSR1, FUS and TAF15. Ref.1 Ref.9 Ref.10 Ref.11 |
| Subcellular location | |
| Tissue specificity | Detected in lung, ovary, adrenal gland, colon, kidney, muscle, pancreas, thyroid, placenta, brain, liver and heart. Ref.3 |
| Post-translational modification | Phosphorylation on Ser-20 interferes with U2AF2 binding and spliceosome assembly. Isoform 6 is phosphorylated on Ser-463. Ref.9 |
| Sequence similarities | Belongs to the BBP/SF1 family. Contains 1 CCHC-type zinc finger. Contains 1 KH domain. |
| Sequence caution | The sequence AAH00773.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q15637-1) Also known as: SF1-HL1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15637-2) Also known as: SF1-Bo; Bone; The sequence of this isoform differs from the canonical sequence as follows: 597-639: YAPPPPPPPP...PAPPPPPPQN → IPPRGGDGPS...WWTGWFGKAA | ||||||
| Isoform 3 (identifier: Q15637-3) Also known as: ZFM1-A; ZFM1-ABCDEF; The sequence of this isoform differs from the canonical sequence as follows: 587-639: PPPPGSAGMM...PAPPPPPPQN → RSIECLLCLL...PSPRRRWPEP | ||||||
| Isoform 4 (identifier: Q15637-4) Also known as: ZFM1-B; ZFM1-ABCDF; The sequence of this isoform differs from the canonical sequence as follows: 528-548: NTTTTTTSAGTGSIPPWQQQQ → RSLPAAAMARAMRVRTFRAHW 549-639: Missing. | ||||||
| Isoform 5 (identifier: Q15637-5) The sequence of this isoform differs from the canonical sequence as follows: 10-10: L → LGKLGPPGLP...QQPGPAGGGG 528-548: NTTTTTTSAGTGSIPPWQQQQ → RSLPAAAMARAMRVRTFRAHW | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q15637-6) Also known as: ZFM1-D; B6; The sequence of this isoform differs from the canonical sequence as follows: 448-548: DQYLGSTPVG...GSIPPWQQQQ → GKSVPGKYACGLWGLSPASRKRYDAATTYGHDA 555-639: PGAPQMQGNP...PAPPPPPPQN → QWAAPTPSLW...WWTGWFGKAA | ||||||
| Note: Contains a phosphoserine at position 463. | ||||||
| Isoform 7 (identifier: Q15637-7) The sequence of this isoform differs from the canonical sequence as follows: 1-26: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.8 | ||||||||||||||||||||||||||||||||||||
| Chain | 2 – 639 | 638 | Splicing factor 1 | PRO_0000050129 | |||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||
| Domain | 141 – 222 | 82 | KH | ||||||||||||||||||||||||||||||||||||
| Zinc finger | 277 – 296 | 20 | CCHC-type | ||||||||||||||||||||||||||||||||||||
| Motif | 15 – 19 | 5 | Nuclear localization signal Potential | ||||||||||||||||||||||||||||||||||||
| Compositional bias | 324 – 637 | 314 | Pro-rich | ||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.8 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 20 | 1 | Phosphoserine; by PKG Ref.9 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 80 | 1 | Phosphoserine Ref.15 Ref.16 Ref.17 Ref.19 | ||||||||||||||||||||||||||||||||||||
| Modified residue | 82 | 1 | Phosphoserine Ref.15 Ref.16 Ref.17 Ref.19 | ||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 26 | 26 | Missing in isoform 7. | VSP_045274 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 10 | 1 | L → LGKLGPPGLPPLPGPKGGFE PGPPPAPGPGAGLLAPGPPP PPPVGSMGALTAAFPFAALP PPPPPPPPPPPQQPPPPPPP PSPGASYPPPQPPPPPPLYQ RVSPPQPPPPQPPRKDQQPG PAGGGG in isoform 5. | VSP_008833 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 448 – 548 | 101 | DQYLG…WQQQQ → GKSVPGKYACGLWGLSPASR KRYDAATTYGHDA in isoform 6. | VSP_008834 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 528 – 548 | 21 | NTTTT…WQQQQ → RSLPAAAMARAMRVRTFRAH W in isoform 4 and isoform 5. | VSP_008835 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 549 – 639 | 91 | Missing in isoform 4. | VSP_008836 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 555 – 639 | 85 | PGAPQ…PPPQN → QWAAPTPSLWSSSPMATTAA AASATPSAQQQYGFQYPLAM AAKIPPRGGDGPSHESEDFP RPLVTLPGRQPQQRPWWTGW FGKAA in isoform 6. | VSP_008837 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 587 – 639 | 53 | PPPPG…PPPQN → RSIECLLCLLSLLTQLPLPL PKPGRQDPSPRRRWPEP in isoform 3. | VSP_008838 | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 597 – 639 | 43 | YAPPP…PPPQN → IPPRGGDGPSHESEDFPRPL VTLPGRQPQQRPWWTGWFGK AA in isoform 2. | VSP_008839 | |||||||||||||||||||||||||||||||||||
| Natural variant | 357 | 1 | S → T. Ref.1 | VAR_017196 | |||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 15 – 17 | 3 | KKR → EED: Abolishes interaction with U2AF2. | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 16 – 18 | 3 | KRK → EDE: Abolishes interaction with U2AF2. Ref.21 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 20 | 1 | S → A: Strongly decreases interaction with U2AF2 and spliceosome assembly. Ref.9 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 20 | 1 | S → T: Decreases interaction with U2AF2. Ref.9 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 21 | 1 | R → A: Decreases interaction with U2AF2 and spliceosome assembly. Ref.21 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 21 | 1 | R → K: No effect. Ref.21 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 22 | 1 | W → A: Abolishes interaction with U2AF2. Ref.21 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 22 | 1 | W → F: No effect. Ref.21 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 151 | 1 | N → A: Decreases RNA-binding. Ref.20 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 160 | 1 | R → A: Strongly reduces RNA-binding. Ref.20 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 184 | 1 | K → A: Abolishes RNA-binding. Ref.20 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 244 | 1 | L → A: Decreases RNA-binding. Ref.20 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 247 | 1 | L → A: Decreases RNA-binding. Ref.20 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 254 | 1 | L → A: Slightly decreases RNA-binding. Ref.20 | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 255 | 1 | R → A: Slightly decreases RNA-binding. Ref.20 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 269 | 1 | E → G in BAA05116. Ref.3 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 269 | 1 | E → G in BAA05117. Ref.3 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 348 | 1 | A → R in AAB03514. Ref.2 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 348 | 1 | A → R in AAB04033. Ref.2 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 377 | 1 | R → W in BAA05116. Ref.3 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 377 | 1 | R → W in BAA05117. Ref.3 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 570 | 1 | P → L in BAH11587. Ref.4 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 591 | 1 | G → V in AAB04033. Ref.2 | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 623 | 1 | M → I in AAB04033. Ref.2 | ||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 16 – 19 | 4 | |||||||||||||||||||||||||||||||||||||
| Helix | 46 – 67 | 22 | |||||||||||||||||||||||||||||||||||||
| Helix | 76 – 79 | 4 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 93 – 95 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 97 – 115 | 19 | |||||||||||||||||||||||||||||||||||||
| Helix | 116 – 118 | 3 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 136 – 141 | 6 | |||||||||||||||||||||||||||||||||||||
| Turn | 144 – 146 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 150 – 157 | 8 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 159 – 161 | 3 | |||||||||||||||||||||||||||||||||||||
| Helix | 162 – 170 | 9 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 174 – 190 | 17 | |||||||||||||||||||||||||||||||||||||
| Beta strand | 203 – 211 | 9 | |||||||||||||||||||||||||||||||||||||
| Helix | 212 – 226 | 15 | |||||||||||||||||||||||||||||||||||||
| Turn | 227 – 230 | 4 | |||||||||||||||||||||||||||||||||||||
| Helix | 238 – 244 | 7 | |||||||||||||||||||||||||||||||||||||
| Helix | 245 – 248 | 4 | |||||||||||||||||||||||||||||||||||||
| Turn | 249 – 252 | 4 | |||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mammalian splicing factor SF1 is encoded by variant cDNAs and binds to RNA." Arning S., Grueter P., Bilbe G., Kraemer A. RNA 2:794-810(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), PROTEIN SEQUENCE OF 20-30 AND 136-150, VARIANT THR-357, FUNCTION, INTERACTION WITH U1 SNRNA, RNA-BINDING. Tissue: Bone and Cervix carcinoma. |
| [2] | "Identification of two novel isoforms of the ZNF162 gene: a growing family of signal transduction and activator of RNA proteins." Caslini C., Spinelli O., Cazzaniga G., Golay J., De Gioia L., Pedretti A., Breviario F., Amaru R., Barbui T., Biondi A., Introna M., Rambaldi A. Genomics 42:268-277(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 6). Tissue: Myeloid leukemia cell. |
| [3] | "Isolation and characterization of a novel gene encoding nuclear protein at a locus (D11S636) tightly linked to multiple endocrine neoplasia type 1 (MEN1)." Toda T., Iida A., Miwa T., Nakamura Y., Imai T. Hum. Mol. Genet. 3:465-470(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), TISSUE SPECIFICITY. Tissue: Brain cortex, Cerebellum and Fetal liver. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7). Tissue: Cerebellum. |
| [5] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5). Tissue: Brain, Eye, Kidney, Muscle and Skin. |
| [7] | "Diverse modes of alternative splicing of human splicing factor SF1 deduced from the exon-intron structure of the gene." Kraemer A., Quentin M., Mulhauser F. Gene 211:29-37(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-295. |
| [8] | Bienvenut W.V., Kanor S., Tissot J.-D., Quadroni M. Submitted (MAY-2006) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-15, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: T-cell. |
| [9] | "Phosphorylation of splicing factor SF1 on Ser20 by cGMP-dependent protein kinase regulates spliceosome assembly." Wang X., Bruderer S., Rafi Z., Xue J., Milburn P.J., Kraemer A., Robinson P.J. EMBO J. 18:4549-4559(1999) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 19-28; 94-103; 228-239 AND 298-308, FUNCTION, INTERACTION WITH U2AF2, MUTAGENESIS OF SER-20, PHOSPHORYLATION AT SER-20. |
| [10] | "Large-scale proteomic analysis of the human spliceosome." Rappsilber J., Ryder U., Lamond A.I., Mann M. Genome Res. 12:1231-1245(2002) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 110-135, MASS SPECTROMETRY, INTERACTION WITH THE SPLICEOSOME. |
| [11] | "The transcriptional repressor ZFM1 interacts with and modulates the ability of EWS to activate transcription." Zhang D., Paley A.J., Childs G. J. Biol. Chem. 273:18086-18091(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH EWSR1; FUS AND TAF15. |
| [12] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [13] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-463 (ISOFORM 6), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-463 (ISOFORM 6), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND SER-82, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-463 (ISOFORM 6), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND SER-82, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [17] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND SER-82, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [19] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND SER-82, MASS SPECTROMETRY. |
| [20] | "Structural basis for recognition of the intron branch site RNA by splicing factor 1." Liu Z., Luyten I., Bottomley M.J., Messias A.C., Houngninou-Molango S., Sprangers R., Zanier K., Kraemer A., Sattler M. Science 294:1098-1102(2001) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 133-255 IN COMPLEX WITH THE BRANCH SITE SEQUENCE 5'-UAUACUAACAA-3', MUTAGENESIS OF ASN-151; ARG-160; LYS-184; LEU-244; LEU-247; LEU-254 AND ARG-255. |
| [21] | "Structural basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP." Selenko P., Gregorovic G., Sprangers R., Stier G., Rhani Z., Kraemer A., Sattler M. Mol. Cell 11:965-976(2003) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 13-25 IN COMPLEX WITH U2AF2, MUTAGENESIS OF 16-LYS--ARG-18; 17-LYS-LYS-18; ARG-21 AND TRP-22. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y08765 mRNA. Translation: CAA70018.1. Y08766 mRNA. Translation: CAA70019.1. L49345 mRNA. Translation: AAB03514.1. L49380 mRNA. Translation: AAB04033.1. D26120 mRNA. Translation: BAA05116.1. D26120 mRNA. Translation: BAA05117.1. AK293753 mRNA. Translation: BAH11587.1. AP001462 Genomic DNA. No translation available. BC000773 mRNA. Translation: AAH00773.1. Different initiation. BC008080 mRNA. Translation: AAH08080.1. BC008724 mRNA. Translation: AAH08724.1. BC011657 mRNA. No translation available. BC020217 mRNA. Translation: AAH20217.1. BC038446 mRNA. Translation: AAH38446.1. AJ000051, AJ000052 Genomic DNA. Translation: CAA03883.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00294627. IPI00386114. IPI00386117. IPI00386119. IPI00386120. IPI00852591. IPI00941553. | ||||||||||||||||||||||||||||||||||||
| PIR | G02919. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001171501.1. NM_001178030.1. NP_001171502.1. NM_001178031.1. NP_004621.2. NM_004630.3. NP_973724.1. NM_201995.2. NP_973726.2. NM_201997.2. NP_973727.1. NM_201998.2. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.502829. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q15637. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| DIP | DIP-29410N. | ||||||||||||||||||||||||||||||||||||
| IntAct | Q15637. 14 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-1582417. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 38258418. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | Q15637. | ||||||||||||||||||||||||||||||||||||
| PRIDE | Q15637. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 7536. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000227503; ENSP00000227503; ENSG00000168066. ENST00000334944; ENSP00000334414; ENSG00000168066. ENST00000377387; ENSP00000366604; ENSG00000168066. ENST00000377390; ENSP00000366607; ENSG00000168066. ENST00000377394; ENSP00000366611; ENSG00000168066. ENST00000433274; ENSP00000396793; ENSG00000168066. | ||||||||||||||||||||||||||||||||||||
| GeneID | 7536. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:7536. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc001oaz.2. human. uc001oba.2. human. uc001obb.2. human. uc001obc.2. human. uc001obd.2. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 7536. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC11M064532. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:12950. SF1. | ||||||||||||||||||||||||||||||||||||
| HPA | HPA018883. | ||||||||||||||||||||||||||||||||||||
| MIM | 601516. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q15637. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA37533. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | COG5176. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG063318. | ||||||||||||||||||||||||||||||||||||
| KO | K13095. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q15637. | ||||||||||||||||||||||||||||||||||||
| Bgee | Q15637. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SF1. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q15637. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000168066. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR004087. KH_dom. IPR004088. KH_dom_type_1. IPR001878. Znf_CCHC. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00013. KH_1. 1 hit. PF00098. zf-CCHC. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SMART | SM00322. KH. 1 hit. SM00343. ZnF_C2HC. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS50084. KH_TYPE_1. 1 hit. PS50158. ZF_CCHC. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| ChiTaRS | SF1. human. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q15637. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 7536. | ||||||||||||||||||||||||||||||||||||
| NextBio | 29487. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SF01_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15637 Secondary accession number(s): B7Z1Q1 Q9UEI0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
