Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Splicing factor 1

Gene

SF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Necessary for the ATP-dependent first step of spliceosome assembly. Binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. May act as transcription repressor.3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri277 – 296CCHC-typePROSITE-ProRule annotationAdd BLAST20

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
  • RNA binding Source: UniProtKB
  • transcription corepressor activity Source: ProtInc
  • zinc ion binding Source: InterPro

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

mRNA processing, mRNA splicing, Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, RNA-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-72163. mRNA Splicing - Major Pathway.
SIGNORiQ15637.

Names & Taxonomyi

Protein namesi
Recommended name:
Splicing factor 1
Alternative name(s):
Mammalian branch point-binding protein
Short name:
BBP
Short name:
mBBP
Transcription factor ZFM1
Zinc finger gene in MEN1 locus
Zinc finger protein 162
Gene namesi
Name:SF1
Synonyms:ZFM1, ZNF162
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:12950. SF1.

Subcellular locationi

GO - Cellular componenti

  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • ribosome Source: UniProtKB
  • spliceosomal complex Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi15 – 17KKR → EED: Abolishes interaction with U2AF2. 3
Mutagenesisi16 – 18KRK → EDE: Abolishes interaction with U2AF2. 1 Publication3
Mutagenesisi20S → A: Strongly decreases interaction with U2AF2 and spliceosome assembly. 1 Publication1
Mutagenesisi20S → T: Decreases interaction with U2AF2. 1 Publication1
Mutagenesisi21R → A: Decreases interaction with U2AF2 and spliceosome assembly. 1 Publication1
Mutagenesisi21R → K: No effect. 1 Publication1
Mutagenesisi22W → A: Abolishes interaction with U2AF2. 1 Publication1
Mutagenesisi22W → F: No effect. 1 Publication1
Mutagenesisi151N → A: Decreases RNA-binding. 1 Publication1
Mutagenesisi160R → A: Strongly reduces RNA-binding. 1 Publication1
Mutagenesisi184K → A: Abolishes RNA-binding. 1 Publication1
Mutagenesisi244L → A: Decreases RNA-binding. 1 Publication1
Mutagenesisi247L → A: Decreases RNA-binding. 1 Publication1
Mutagenesisi254L → A: Slightly decreases RNA-binding. 1 Publication1
Mutagenesisi255R → A: Slightly decreases RNA-binding. 1 Publication1

Organism-specific databases

DisGeNETi7536.
MalaCardsiSF1.
OpenTargetsiENSG00000168066.
PharmGKBiPA37533.

Polymorphism and mutation databases

BioMutaiSF1.
DMDMi38258418.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00000501292 – 639Splicing factor 1Add BLAST638

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei14PhosphoserineCombined sources1
Modified residuei20Phosphoserine; by PKG1 Publication1
Modified residuei80PhosphoserineCombined sources1
Modified residuei82PhosphoserineCombined sources1
Modified residuei87PhosphotyrosineCombined sources1
Modified residuei89PhosphoserineCombined sources1
Isoform 6 (identifier: Q15637-6)
Modified residuei463PhosphoserineCombined sources1
Modified residuei467Omega-N-methylarginineCombined sources1

Post-translational modificationi

Phosphorylation on Ser-20 interferes with U2AF2 binding and spliceosome assembly. Isoform 6 is phosphorylated on Ser-463.1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiQ15637.
MaxQBiQ15637.
PaxDbiQ15637.
PeptideAtlasiQ15637.
PRIDEiQ15637.
TopDownProteomicsiQ15637-4. [Q15637-4]

PTM databases

iPTMnetiQ15637.
PhosphoSitePlusiQ15637.
SwissPalmiQ15637.

Expressioni

Tissue specificityi

Detected in lung, ovary, adrenal gland, colon, kidney, muscle, pancreas, thyroid, placenta, brain, liver and heart.1 Publication

Gene expression databases

BgeeiENSG00000168066.
CleanExiHS_SF1.
ExpressionAtlasiQ15637. baseline and differential.
GenevisibleiQ15637. HS.

Organism-specific databases

HPAiHPA018883.

Interactioni

Subunit structurei

Binds U2AF2. Interacts with U1 snRNA. Binds EWSR1, FUS and TAF15. Interacts with RBM17.7 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-744603,EBI-744603
ABL2P426843EBI-744603,EBI-1102694
CEP104O603084EBI-744603,EBI-2685240
Cep104Q80V313EBI-744603,EBI-11073001From a different organism.
CHERPQ8IWX86EBI-744603,EBI-2555370
CherpQ8CGZ03EBI-744603,EBI-2366446From a different organism.
CIAO1O760713EBI-744603,EBI-725145
CltcQ68FD53EBI-744603,EBI-769168From a different organism.
DDX17Q928414EBI-744603,EBI-746012
DDX5P178443EBI-744603,EBI-351962
FAM168AQ925673EBI-744603,EBI-7957930
HNRNPABQ997294EBI-744603,EBI-1044873
HNRNPDLO149794EBI-744603,EBI-299727
KIAA0907Q7Z7F05EBI-744603,EBI-751942
Kiaa0907Q3TCX33EBI-744603,EBI-11298408From a different organism.
KPNA1P522943EBI-744603,EBI-358383
Kpna1Q609603EBI-744603,EBI-8573008From a different organism.
KPNA2P522925EBI-744603,EBI-349938
Kpna2P522933EBI-744603,EBI-3043908From a different organism.
Kpna4O353433EBI-744603,EBI-8372758From a different organism.
KPNA6O606844EBI-744603,EBI-359923
KRTAP26-1Q6PEX33EBI-744603,EBI-3957672
MKRN3Q130643EBI-744603,EBI-2340269
PRMT2P553455EBI-744603,EBI-78458
PRPF40AO754003EBI-744603,EBI-473291
PSMA3P257883EBI-744603,EBI-348380
RBM17Q96I256EBI-744603,EBI-740272
SF3A1Q154598EBI-744603,EBI-1054743
SF3A2Q154282EBI-744603,EBI-2462271
SFSWAPQ128722EBI-744603,EBI-1055938
SfswapQ3USH53EBI-744603,EBI-8387273From a different organism.
TRIM69Q86WT63EBI-744603,EBI-749955
U2AF2P2636812EBI-744603,EBI-742339
U2af2P263693EBI-744603,EBI-8321355From a different organism.
UHMK1Q8TAS14EBI-744603,EBI-1753608

Protein-protein interaction databases

BioGridi113368. 149 interactors.
DIPiDIP-29410N.
IntActiQ15637. 206 interactors.
MINTiMINT-1582417.
STRINGi9606.ENSP00000366604.

Structurei

Secondary structure

1639
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi15 – 17Combined sources3
Helixi27 – 30Combined sources4
Helixi46 – 67Combined sources22
Helixi76 – 79Combined sources4
Beta strandi93 – 95Combined sources3
Helixi97 – 115Combined sources19
Helixi116 – 118Combined sources3
Beta strandi136 – 141Combined sources6
Turni144 – 146Combined sources3
Helixi150 – 157Combined sources8
Beta strandi159 – 161Combined sources3
Helixi162 – 170Combined sources9
Beta strandi174 – 190Combined sources17
Beta strandi203 – 211Combined sources9
Helixi212 – 226Combined sources15
Turni227 – 230Combined sources4
Helixi238 – 244Combined sources7
Helixi245 – 248Combined sources4
Turni249 – 252Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K1GNMR-A133-260[»]
1O0PNMR-B13-25[»]
1OPINMR-B13-25[»]
2M09NMR-A27-145[»]
2M0GNMR-A1-145[»]
4FXWX-ray2.29B/D14-132[»]
4FXXX-ray2.48A/B/C/D26-132[»]
ProteinModelPortaliQ15637.
SMRiQ15637.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ15637.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini141 – 222KHPROSITE-ProRule annotationAdd BLAST82

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi15 – 19Nuclear localization signalSequence analysis5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi324 – 637Pro-richAdd BLAST314

Sequence similaritiesi

Belongs to the BBP/SF1 family.Curated
Contains 1 CCHC-type zinc finger.PROSITE-ProRule annotation
Contains 1 KH domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri277 – 296CCHC-typePROSITE-ProRule annotationAdd BLAST20

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG0119. Eukaryota.
COG5176. LUCA.
GeneTreeiENSGT00550000074434.
HOGENOMiHOG000237321.
HOVERGENiHBG063318.
InParanoidiQ15637.
KOiK13095.
OMAiHGMGMEH.
OrthoDBiEOG091G0AEL.
PhylomeDBiQ15637.
TreeFamiTF319159.

Family and domain databases

Gene3Di3.30.1370.10. 1 hit.
4.10.60.10. 1 hit.
InterProiIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR032570. SF1-HH.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00013. KH_1. 1 hit.
PF16275. SF1-HH. 1 hit.
PF00098. zf-CCHC. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 1 hit.
SM00343. ZnF_C2HC. 1 hit.
[Graphical view]
SUPFAMiSSF54791. SSF54791. 1 hit.
PROSITEiPS50084. KH_TYPE_1. 1 hit.
PS50158. ZF_CCHC. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q15637-1) [UniParc]FASTAAdd to basket
Also known as: SF1-HL1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATGANATPL DFPSKKRKRS RWNQDTMEQK TVIPGMPTVI PPGLTREQER
60 70 80 90 100
AYIVQLQIED LTRKLRTGDL GIPPNPEDRS PSPEPIYNSE GKRLNTREFR
110 120 130 140 150
TRKKLEEERH NLITEMVALN PDFKPPADYK PPATRVSDKV MIPQDEYPEI
160 170 180 190 200
NFVGLLIGPR GNTLKNIEKE CNAKIMIRGK GSVKEGKVGR KDGQMLPGED
210 220 230 240 250
EPLHALVTAN TMENVKKAVE QIRNILKQGI ETPEDQNDLR KMQLRELARL
260 270 280 290 300
NGTLREDDNR ILRPWQSSET RSITNTTVCT KCGGAGHIAS DCKFQRPGDP
310 320 330 340 350
QSAQDKARMD KEYLSLMAEL GEAPVPASVG STSGPATTPL ASAPRPAAPA
360 370 380 390 400
NNPPPPSLMS TTQSRPPWMN SGPSESRPYH GMHGGGPGGP GGGPHSFPHP
410 420 430 440 450
LPSLTGGHGG HPMQHNPNGP PPPWMQPPPP PMNQGPHPPG HHGPPPMDQY
460 470 480 490 500
LGSTPVGSGV YRLHQGKGMM PPPPMGMMPP PPPPPSGQPP PPPSGPLPPW
510 520 530 540 550
QQQQQQPPPP PPPSSSMASS TPLPWQQNTT TTTTSAGTGS IPPWQQQQAA
560 570 580 590 600
AAASPGAPQM QGNPTMVPLP PGVQPPLPPG APPPPPPPPP GSAGMMYAPP
610 620 630
PPPPPPMDPS NFVTMMGMGV AGMPPFGMPP APPPPPPQN
Length:639
Mass (Da):68,330
Last modified:January 23, 2007 - v4
Checksum:iEEBC6A02B29DAE4D
GO
Isoform 2 (identifier: Q15637-2) [UniParc]FASTAAdd to basket
Also known as: SF1-Bo, Bone

The sequence of this isoform differs from the canonical sequence as follows:
     597-639: YAPPPPPPPP...PAPPPPPPQN → IPPRGGDGPS...WWTGWFGKAA

Show »
Length:638
Mass (Da):68,633
Checksum:i06044F670EDC10C9
GO
Isoform 3 (identifier: Q15637-3) [UniParc]FASTAAdd to basket
Also known as: ZFM1-A, ZFM1-ABCDEF

The sequence of this isoform differs from the canonical sequence as follows:
     587-639: PPPPGSAGMM...PAPPPPPPQN → RSIECLLCLL...PSPRRRWPEP

Show »
Length:623
Mass (Da):67,277
Checksum:iC07C74BBDC4093B7
GO
Isoform 4 (identifier: Q15637-4) [UniParc]FASTAAdd to basket
Also known as: ZFM1-B, ZFM1-ABCDF

The sequence of this isoform differs from the canonical sequence as follows:
     528-548: NTTTTTTSAGTGSIPPWQQQQ → RSLPAAAMARAMRVRTFRAHW
     549-639: Missing.

Show »
Length:548
Mass (Da):59,712
Checksum:iDDB42B66ABA2AD18
GO
Isoform 5 (identifier: Q15637-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-10: L → LGKLGPPGLP...QQPGPAGGGG
     528-548: NTTTTTTSAGTGSIPPWQQQQ → RSLPAAAMARAMRVRTFRAHW
     549-639: Missing.

Note: No experimental confirmation available.
Show »
Length:673
Mass (Da):71,752
Checksum:i8F39B77A4DAE9FBD
GO
Isoform 6 (identifier: Q15637-6) [UniParc]FASTAAdd to basket
Also known as: ZFM1-D, B6

The sequence of this isoform differs from the canonical sequence as follows:
     448-548: DQYLGSTPVG...GSIPPWQQQQ → GKSVPGKYACGLWGLSPASRKRYDAATTYGHDA
     555-639: PGAPQMQGNP...PAPPPPPPQN → QWAAPTPSLW...WWTGWFGKAA

Show »
Length:571
Mass (Da):61,889
Checksum:i5DA04D16D93EBDD5
GO
Isoform 7 (identifier: Q15637-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.

Note: No experimental confirmation available.
Show »
Length:613
Mass (Da):65,371
Checksum:iC1EBBE4FC3AA66BF
GO

Sequence cautioni

The sequence AAH00773 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti269E → G in BAA05116 (PubMed:7912130).Curated1
Sequence conflicti269E → G in BAA05117 (PubMed:7912130).Curated1
Sequence conflicti348A → R in AAB03514 (PubMed:9192847).Curated1
Sequence conflicti348A → R in AAB04033 (PubMed:9192847).Curated1
Sequence conflicti377R → W in BAA05116 (PubMed:7912130).Curated1
Sequence conflicti377R → W in BAA05117 (PubMed:7912130).Curated1
Sequence conflicti570P → L in BAH11587 (PubMed:14702039).Curated1
Sequence conflicti591G → V in AAB04033 (PubMed:9192847).Curated1
Sequence conflicti623M → I in AAB04033 (PubMed:9192847).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_017196357S → T.1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0452741 – 26Missing in isoform 7. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_00883310L → LGKLGPPGLPPLPGPKGGFE PGPPPAPGPGAGLLAPGPPP PPPVGSMGALTAAFPFAALP PPPPPPPPPPPQQPPPPPPP PSPGASYPPPQPPPPPPLYQ RVSPPQPPPPQPPRKDQQPG PAGGGG in isoform 5. 1 Publication1
Alternative sequenceiVSP_008834448 – 548DQYLG…WQQQQ → GKSVPGKYACGLWGLSPASR KRYDAATTYGHDA in isoform 6. 1 PublicationAdd BLAST101
Alternative sequenceiVSP_008835528 – 548NTTTT…WQQQQ → RSLPAAAMARAMRVRTFRAH W in isoform 4 and isoform 5. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_008836549 – 639Missing in isoform 4 and isoform 5. 2 PublicationsAdd BLAST91
Alternative sequenceiVSP_008837555 – 639PGAPQ…PPPQN → QWAAPTPSLWSSSPMATTAA AASATPSAQQQYGFQYPLAM AAKIPPRGGDGPSHESEDFP RPLVTLPGRQPQQRPWWTGW FGKAA in isoform 6. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_008838587 – 639PPPPG…PPPQN → RSIECLLCLLSLLTQLPLPL PKPGRQDPSPRRRWPEP in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_008839597 – 639YAPPP…PPPQN → IPPRGGDGPSHESEDFPRPL VTLPGRQPQQRPWWTGWFGK AA in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08765 mRNA. Translation: CAA70018.1.
Y08766 mRNA. Translation: CAA70019.1.
L49345 mRNA. Translation: AAB03514.1.
L49380 mRNA. Translation: AAB04033.1.
D26120 mRNA. Translation: BAA05116.1.
D26120 mRNA. Translation: BAA05117.1.
AK293753 mRNA. Translation: BAH11587.1.
AP001462 Genomic DNA. No translation available.
BC000773 mRNA. Translation: AAH00773.1. Different initiation.
BC008080 mRNA. Translation: AAH08080.1.
BC008724 mRNA. Translation: AAH08724.1.
BC011657 mRNA. No translation available.
BC020217 mRNA. Translation: AAH20217.1.
BC038446 mRNA. Translation: AAH38446.1.
AJ000051, AJ000052 Genomic DNA. Translation: CAA03883.1.
CCDSiCCDS31599.1. [Q15637-1]
CCDS44642.2. [Q15637-6]
CCDS53660.1. [Q15637-7]
CCDS53661.1. [Q15637-5]
CCDS8080.1. [Q15637-2]
CCDS8081.1. [Q15637-4]
PIRiG02919.
RefSeqiNP_001171501.1. NM_001178030.1. [Q15637-5]
NP_001171502.1. NM_001178031.1. [Q15637-7]
NP_004621.2. NM_004630.3. [Q15637-1]
NP_973724.1. NM_201995.2. [Q15637-2]
NP_973727.1. NM_201998.2. [Q15637-4]
XP_016873733.1. XM_017018244.1. [Q15637-7]
UniGeneiHs.502829.

Genome annotation databases

EnsembliENST00000227503; ENSP00000227503; ENSG00000168066. [Q15637-4]
ENST00000334944; ENSP00000334414; ENSG00000168066. [Q15637-2]
ENST00000377387; ENSP00000366604; ENSG00000168066. [Q15637-5]
ENST00000377390; ENSP00000366607; ENSG00000168066. [Q15637-1]
ENST00000377394; ENSP00000366611; ENSG00000168066. [Q15637-6]
ENST00000433274; ENSP00000396793; ENSG00000168066. [Q15637-7]
GeneIDi7536.
KEGGihsa:7536.
UCSCiuc001oaz.3. human. [Q15637-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08765 mRNA. Translation: CAA70018.1.
Y08766 mRNA. Translation: CAA70019.1.
L49345 mRNA. Translation: AAB03514.1.
L49380 mRNA. Translation: AAB04033.1.
D26120 mRNA. Translation: BAA05116.1.
D26120 mRNA. Translation: BAA05117.1.
AK293753 mRNA. Translation: BAH11587.1.
AP001462 Genomic DNA. No translation available.
BC000773 mRNA. Translation: AAH00773.1. Different initiation.
BC008080 mRNA. Translation: AAH08080.1.
BC008724 mRNA. Translation: AAH08724.1.
BC011657 mRNA. No translation available.
BC020217 mRNA. Translation: AAH20217.1.
BC038446 mRNA. Translation: AAH38446.1.
AJ000051, AJ000052 Genomic DNA. Translation: CAA03883.1.
CCDSiCCDS31599.1. [Q15637-1]
CCDS44642.2. [Q15637-6]
CCDS53660.1. [Q15637-7]
CCDS53661.1. [Q15637-5]
CCDS8080.1. [Q15637-2]
CCDS8081.1. [Q15637-4]
PIRiG02919.
RefSeqiNP_001171501.1. NM_001178030.1. [Q15637-5]
NP_001171502.1. NM_001178031.1. [Q15637-7]
NP_004621.2. NM_004630.3. [Q15637-1]
NP_973724.1. NM_201995.2. [Q15637-2]
NP_973727.1. NM_201998.2. [Q15637-4]
XP_016873733.1. XM_017018244.1. [Q15637-7]
UniGeneiHs.502829.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K1GNMR-A133-260[»]
1O0PNMR-B13-25[»]
1OPINMR-B13-25[»]
2M09NMR-A27-145[»]
2M0GNMR-A1-145[»]
4FXWX-ray2.29B/D14-132[»]
4FXXX-ray2.48A/B/C/D26-132[»]
ProteinModelPortaliQ15637.
SMRiQ15637.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113368. 149 interactors.
DIPiDIP-29410N.
IntActiQ15637. 206 interactors.
MINTiMINT-1582417.
STRINGi9606.ENSP00000366604.

PTM databases

iPTMnetiQ15637.
PhosphoSitePlusiQ15637.
SwissPalmiQ15637.

Polymorphism and mutation databases

BioMutaiSF1.
DMDMi38258418.

Proteomic databases

EPDiQ15637.
MaxQBiQ15637.
PaxDbiQ15637.
PeptideAtlasiQ15637.
PRIDEiQ15637.
TopDownProteomicsiQ15637-4. [Q15637-4]

Protocols and materials databases

DNASUi7536.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000227503; ENSP00000227503; ENSG00000168066. [Q15637-4]
ENST00000334944; ENSP00000334414; ENSG00000168066. [Q15637-2]
ENST00000377387; ENSP00000366604; ENSG00000168066. [Q15637-5]
ENST00000377390; ENSP00000366607; ENSG00000168066. [Q15637-1]
ENST00000377394; ENSP00000366611; ENSG00000168066. [Q15637-6]
ENST00000433274; ENSP00000396793; ENSG00000168066. [Q15637-7]
GeneIDi7536.
KEGGihsa:7536.
UCSCiuc001oaz.3. human. [Q15637-1]

Organism-specific databases

CTDi7536.
DisGeNETi7536.
GeneCardsiSF1.
HGNCiHGNC:12950. SF1.
HPAiHPA018883.
MalaCardsiSF1.
MIMi601516. gene.
neXtProtiNX_Q15637.
OpenTargetsiENSG00000168066.
PharmGKBiPA37533.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0119. Eukaryota.
COG5176. LUCA.
GeneTreeiENSGT00550000074434.
HOGENOMiHOG000237321.
HOVERGENiHBG063318.
InParanoidiQ15637.
KOiK13095.
OMAiHGMGMEH.
OrthoDBiEOG091G0AEL.
PhylomeDBiQ15637.
TreeFamiTF319159.

Enzyme and pathway databases

ReactomeiR-HSA-72163. mRNA Splicing - Major Pathway.
SIGNORiQ15637.

Miscellaneous databases

ChiTaRSiSF1. human.
EvolutionaryTraceiQ15637.
GeneWikiiSF1_(gene).
GenomeRNAii7536.
PROiQ15637.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168066.
CleanExiHS_SF1.
ExpressionAtlasiQ15637. baseline and differential.
GenevisibleiQ15637. HS.

Family and domain databases

Gene3Di3.30.1370.10. 1 hit.
4.10.60.10. 1 hit.
InterProiIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR032570. SF1-HH.
IPR001878. Znf_CCHC.
[Graphical view]
PfamiPF00013. KH_1. 1 hit.
PF16275. SF1-HH. 1 hit.
PF00098. zf-CCHC. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 1 hit.
SM00343. ZnF_C2HC. 1 hit.
[Graphical view]
SUPFAMiSSF54791. SSF54791. 1 hit.
PROSITEiPS50084. KH_TYPE_1. 1 hit.
PS50158. ZF_CCHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSF01_HUMAN
AccessioniPrimary (citable) accession number: Q15637
Secondary accession number(s): B7Z1Q1
, C9JJE2, Q14818, Q14819, Q15913, Q8IY00, Q92744, Q92745, Q969H7, Q9BW01, Q9UEI0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 7, 2003
Last sequence update: January 23, 2007
Last modified: November 30, 2016
This is version 178 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.