Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase 1 regulatory subunit 7

Gene

PPP1R7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of protein phosphatase 1.By similarity

GO - Molecular functioni

  • enzyme regulator activity Source: UniProtKB
  • protein phosphatase type 1 regulator activity Source: ProtInc

GO - Biological processi

  • chromosome segregation Source: Ensembl
  • positive regulation of protein dephosphorylation Source: MGI
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000115685-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase 1 regulatory subunit 7
Alternative name(s):
Protein phosphatase 1 regulatory subunit 22
Gene namesi
Name:PPP1R7
Synonyms:SDS22
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:9295. PPP1R7.

Subcellular locationi

GO - Cellular componenti

  • chromosome Source: MGI
  • cytoplasm Source: ProtInc
  • extracellular exosome Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi148D → V: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi170F → A: Severely impaired the binding of protein phosphatase 1. 1 Publication1
Mutagenesisi192E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi214F → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi280D → A: Severely impairs the binding of protein phosphatase 1. 1 Publication1
Mutagenesisi300E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi302W → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1
Mutagenesisi327Y → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication1

Organism-specific databases

DisGeNETi5510.
OpenTargetsiENSG00000115685.
PharmGKBiPA33658.

Polymorphism and mutation databases

DMDMi74762145.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002396132 – 360Protein phosphatase 1 regulatory subunit 7Add BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Modified residuei24PhosphoserineCombined sources1
Modified residuei27PhosphoserineCombined sources1
Modified residuei44PhosphoserineCombined sources1
Modified residuei47PhosphoserineCombined sources1
Modified residuei322PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ15435.
MaxQBiQ15435.
PaxDbiQ15435.
PeptideAtlasiQ15435.
PRIDEiQ15435.

2D gel databases

REPRODUCTION-2DPAGEIPI00033600.

PTM databases

iPTMnetiQ15435.
PhosphoSitePlusiQ15435.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000115685.
CleanExiHS_PPP1R7.
ExpressionAtlasiQ15435. baseline and differential.
GenevisibleiQ15435. HS.

Organism-specific databases

HPAiHPA034500.
HPA034501.

Interactioni

Subunit structurei

Interacts with PPP1CA, PPP1CB and PPP1CC/PPP1G isoform 1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
PPP1CBP621404EBI-1024281,EBI-352350
PPP1CCP368733EBI-1024281,EBI-356283
USHBP1Q8N6Y03EBI-1024281,EBI-739895

Protein-protein interaction databases

BioGridi111502. 32 interactors.
DIPiDIP-1005N.
IntActiQ15435. 41 interactors.
MINTiMINT-5004667.
STRINGi9606.ENSP00000234038.

Structurei

3D structure databases

ProteinModelPortaliQ15435.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati77 – 98LRR 1Add BLAST22
Repeati99 – 120LRR 2Add BLAST22
Repeati121 – 142LRR 3Add BLAST22
Repeati143 – 164LRR 4Add BLAST22
Repeati165 – 186LRR 5Add BLAST22
Repeati187 – 208LRR 6Add BLAST22
Repeati209 – 230LRR 7Add BLAST22
Repeati231 – 252LRR 8Add BLAST22
Repeati253 – 274LRR 9Add BLAST22
Repeati275 – 296LRR 10Add BLAST22
Repeati297 – 318LRR 11Add BLAST22
Domaini331 – 360LRRCTAdd BLAST30

Sequence similaritiesi

Belongs to the SDS22 family.Curated
Contains 11 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG0531. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00730000110223.
HOGENOMiHOG000211189.
HOVERGENiHBG082161.
InParanoidiQ15435.
KOiK17550.
OMAiEELWLNH.
OrthoDBiEOG091G0FWO.
PhylomeDBiQ15435.
TreeFamiTF105538.

Family and domain databases

Gene3Di3.80.10.10. 2 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR003603. U2A'_phosphoprotein32A_C.
[Graphical view]
SMARTiSM00369. LRR_TYP. 7 hits.
SM00446. LRRcap. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
PROSITEiPS51450. LRR. 12 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15435-1) [UniParc]FASTAAdd to basket
Also known as: sds22alpha1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAERGAGQQ QSQEMMEVDR RVESEESGDE EGKKHSSGIV ADLSEQSLKD
60 70 80 90 100
GEERGEEDPE EEHELPVDME TINLDRDAED VDLNHYRIGK IEGFEVLKKV
110 120 130 140 150
KTLCLRQNLI KCIENLEELQ SLRELDLYDN QIKKIENLEA LTELEILDIS
160 170 180 190 200
FNLLRNIEGV DKLTRLKKLF LVNNKISKIE NLSNLHQLQM LELGSNRIRA
210 220 230 240 250
IENIDTLTNL ESLFLGKNKI TKLQNLDALT NLTVLSMQSN RLTKIEGLQN
260 270 280 290 300
LVNLRELYLS HNGIEVIEGL ENNNKLTMLD IASNRIKKIE NISHLTELQE
310 320 330 340 350
FWMNDNLLES WSDLDELKGA RSLETVYLER NPLQKDPQYR RKVMLALPSV
360
RQIDATFVRF
Length:360
Mass (Da):41,564
Last modified:November 1, 1996 - v1
Checksum:i49BCCF675EAA94D1
GO
Isoform 2 (identifier: Q15435-2) [UniParc]FASTAAdd to basket
Also known as: sds22alpha2

The sequence of this isoform differs from the canonical sequence as follows:
     18-60: Missing.

Show »
Length:317
Mass (Da):36,837
Checksum:i9AC120B3C729CF8B
GO
Isoform 3 (identifier: Q15435-3) [UniParc]FASTAAdd to basket
Also known as: sds22beta1

The sequence of this isoform differs from the canonical sequence as follows:
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Show »
Length:280
Mass (Da):32,053
Checksum:i4FE43AE30C65AB72
GO
Isoform 4 (identifier: Q15435-4) [UniParc]FASTAAdd to basket
Also known as: sds22beta2

The sequence of this isoform differs from the canonical sequence as follows:
     18-60: Missing.
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Show »
Length:237
Mass (Da):27,326
Checksum:i627A59386B5763BB
GO
Isoform 5 (identifier: Q15435-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE → M
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:221
Mass (Da):25,593
Checksum:i9AB66B080F2F52C0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0556721 – 60MAAER…EEDPE → M in isoform 5. CuratedAdd BLAST60
Alternative sequenceiVSP_01924418 – 60Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_019245274 – 280NKLTMLD → VQDSLTY in isoform 3, isoform 4 and isoform 5. 2 Publications7
Alternative sequenceiVSP_019246281 – 360Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST80

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z50749 mRNA. Translation: CAA90626.1.
AF067136
, AF067130, AF067132, AF067133, AF067134, AF067135 Genomic DNA. Translation: AAD26610.1.
AF067136
, AF067130, AF067132, AF067134, AF067135, AF067133, AF067131 Genomic DNA. Translation: AAD26611.1.
AF067134
, AF067130, AF067131, AF067132, AF067133 Genomic DNA. Translation: AAD26612.1.
AF067134
, AF067132, AF067130, AF067133 Genomic DNA. Translation: AAD26613.1.
BT007296 mRNA. Translation: AAP35960.1.
BT020134 mRNA. Translation: AAV38936.1.
AK294043 mRNA. Translation: BAG57395.1.
AC005237 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW71243.1.
BC000910 mRNA. Translation: AAH00910.1.
BC012397 mRNA. Translation: AAH12397.1.
BC013001 mRNA. Translation: AAH13001.1.
CCDSiCCDS2546.1. [Q15435-1]
CCDS63190.1. [Q15435-5]
CCDS63192.1. [Q15435-3]
CCDS63193.1. [Q15435-4]
CCDS63194.1. [Q15435-2]
PIRiS68209.
RefSeqiNP_001269338.1. NM_001282409.1. [Q15435-2]
NP_001269339.1. NM_001282410.1. [Q15435-3]
NP_001269340.1. NM_001282411.1. [Q15435-4]
NP_001269341.1. NM_001282412.1.
NP_001269342.1. NM_001282413.1.
NP_001269343.1. NM_001282414.1. [Q15435-5]
NP_002703.1. NM_002712.2. [Q15435-1]
UniGeneiHs.36587.

Genome annotation databases

EnsembliENST00000234038; ENSP00000234038; ENSG00000115685. [Q15435-1]
ENST00000272983; ENSP00000272983; ENSG00000115685. [Q15435-2]
ENST00000401987; ENSP00000385466; ENSG00000115685. [Q15435-4]
ENST00000402734; ENSP00000385012; ENSG00000115685. [Q15435-5]
ENST00000406106; ENSP00000385022; ENSG00000115685. [Q15435-3]
ENST00000407025; ENSP00000385657; ENSG00000115685. [Q15435-1]
GeneIDi5510.
KEGGihsa:5510.
UCSCiuc002was.5. human. [Q15435-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z50749 mRNA. Translation: CAA90626.1.
AF067136
, AF067130, AF067132, AF067133, AF067134, AF067135 Genomic DNA. Translation: AAD26610.1.
AF067136
, AF067130, AF067132, AF067134, AF067135, AF067133, AF067131 Genomic DNA. Translation: AAD26611.1.
AF067134
, AF067130, AF067131, AF067132, AF067133 Genomic DNA. Translation: AAD26612.1.
AF067134
, AF067132, AF067130, AF067133 Genomic DNA. Translation: AAD26613.1.
BT007296 mRNA. Translation: AAP35960.1.
BT020134 mRNA. Translation: AAV38936.1.
AK294043 mRNA. Translation: BAG57395.1.
AC005237 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW71243.1.
BC000910 mRNA. Translation: AAH00910.1.
BC012397 mRNA. Translation: AAH12397.1.
BC013001 mRNA. Translation: AAH13001.1.
CCDSiCCDS2546.1. [Q15435-1]
CCDS63190.1. [Q15435-5]
CCDS63192.1. [Q15435-3]
CCDS63193.1. [Q15435-4]
CCDS63194.1. [Q15435-2]
PIRiS68209.
RefSeqiNP_001269338.1. NM_001282409.1. [Q15435-2]
NP_001269339.1. NM_001282410.1. [Q15435-3]
NP_001269340.1. NM_001282411.1. [Q15435-4]
NP_001269341.1. NM_001282412.1.
NP_001269342.1. NM_001282413.1.
NP_001269343.1. NM_001282414.1. [Q15435-5]
NP_002703.1. NM_002712.2. [Q15435-1]
UniGeneiHs.36587.

3D structure databases

ProteinModelPortaliQ15435.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111502. 32 interactors.
DIPiDIP-1005N.
IntActiQ15435. 41 interactors.
MINTiMINT-5004667.
STRINGi9606.ENSP00000234038.

PTM databases

iPTMnetiQ15435.
PhosphoSitePlusiQ15435.

Polymorphism and mutation databases

DMDMi74762145.

2D gel databases

REPRODUCTION-2DPAGEIPI00033600.

Proteomic databases

EPDiQ15435.
MaxQBiQ15435.
PaxDbiQ15435.
PeptideAtlasiQ15435.
PRIDEiQ15435.

Protocols and materials databases

DNASUi5510.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000234038; ENSP00000234038; ENSG00000115685. [Q15435-1]
ENST00000272983; ENSP00000272983; ENSG00000115685. [Q15435-2]
ENST00000401987; ENSP00000385466; ENSG00000115685. [Q15435-4]
ENST00000402734; ENSP00000385012; ENSG00000115685. [Q15435-5]
ENST00000406106; ENSP00000385022; ENSG00000115685. [Q15435-3]
ENST00000407025; ENSP00000385657; ENSG00000115685. [Q15435-1]
GeneIDi5510.
KEGGihsa:5510.
UCSCiuc002was.5. human. [Q15435-1]

Organism-specific databases

CTDi5510.
DisGeNETi5510.
GeneCardsiPPP1R7.
HGNCiHGNC:9295. PPP1R7.
HPAiHPA034500.
HPA034501.
MIMi602877. gene.
neXtProtiNX_Q15435.
OpenTargetsiENSG00000115685.
PharmGKBiPA33658.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0531. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00730000110223.
HOGENOMiHOG000211189.
HOVERGENiHBG082161.
InParanoidiQ15435.
KOiK17550.
OMAiEELWLNH.
OrthoDBiEOG091G0FWO.
PhylomeDBiQ15435.
TreeFamiTF105538.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000115685-MONOMER.

Miscellaneous databases

ChiTaRSiPPP1R7. human.
GeneWikiiPPP1R7.
GenomeRNAii5510.
PROiQ15435.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000115685.
CleanExiHS_PPP1R7.
ExpressionAtlasiQ15435. baseline and differential.
GenevisibleiQ15435. HS.

Family and domain databases

Gene3Di3.80.10.10. 2 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR003603. U2A'_phosphoprotein32A_C.
[Graphical view]
SMARTiSM00369. LRR_TYP. 7 hits.
SM00446. LRRcap. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 1 hit.
PROSITEiPS51450. LRR. 12 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPP1R7_HUMAN
AccessioniPrimary (citable) accession number: Q15435
Secondary accession number(s): B4DFD4
, B5MCY6, Q9UQE5, Q9UQE6, Q9Y6K4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: November 1, 1996
Last modified: November 30, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.