SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q15435

- PP1R7_HUMAN

UniProt

Q15435 - PP1R7_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein phosphatase 1 regulatory subunit 7
Gene
PPP1R7, SDS22
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Regulatory subunit of protein phosphatase 1 By similarity.

GO - Molecular functioni

  1. enzyme regulator activity Source: UniProtKB
  2. protein phosphatase type 1 regulator activity Source: ProtInc

GO - Biological processi

  1. regulation of catalytic activity Source: GOC
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase 1 regulatory subunit 7
Alternative name(s):
Protein phosphatase 1 regulatory subunit 22
Gene namesi
Name:PPP1R7
Synonyms:SDS22
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:9295. PPP1R7.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. cytoplasm Source: ProtInc
  2. extracellular vesicular exosome Source: UniProt
  3. nucleus Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi148 – 1481D → V: Completely abolishes the interaction with protein phosphatase 1. 1 Publication
Mutagenesisi170 – 1701F → A: Severely impaired the binding of protein phosphatase 1. 1 Publication
Mutagenesisi192 – 1921E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication
Mutagenesisi214 – 2141F → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication
Mutagenesisi280 – 2801D → A: Severely impairs the binding of protein phosphatase 1. 1 Publication
Mutagenesisi300 – 3001E → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication
Mutagenesisi302 – 3021W → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication
Mutagenesisi327 – 3271Y → A: Completely abolishes the interaction with protein phosphatase 1. 1 Publication

Organism-specific databases

PharmGKBiPA33658.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 360359Protein phosphatase 1 regulatory subunit 7
PRO_0000239613Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication
Modified residuei12 – 121Phosphoserine1 Publication
Modified residuei24 – 241Phosphoserine3 Publications
Modified residuei27 – 271Phosphoserine3 Publications
Modified residuei44 – 441Phosphoserine1 Publication
Modified residuei47 – 471Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ15435.
PaxDbiQ15435.
PRIDEiQ15435.

2D gel databases

REPRODUCTION-2DPAGEIPI00033600.

PTM databases

PhosphoSiteiQ15435.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

ArrayExpressiQ15435.
BgeeiQ15435.
CleanExiHS_PPP1R7.
GenevestigatoriQ15435.

Organism-specific databases

HPAiHPA034500.
HPA034501.

Interactioni

Subunit structurei

Interacts with PPP1CA, PPP1CB and PPP1CC/PPP1G isoform 1.1 Publication

Protein-protein interaction databases

BioGridi111502. 17 interactions.
DIPiDIP-1005N.
IntActiQ15435. 11 interactions.
MINTiMINT-5004667.
STRINGi9606.ENSP00000234038.

Structurei

3D structure databases

ProteinModelPortaliQ15435.
SMRiQ15435. Positions 57-359.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati77 – 9822LRR 1
Add
BLAST
Repeati99 – 12022LRR 2
Add
BLAST
Repeati121 – 14222LRR 3
Add
BLAST
Repeati143 – 16422LRR 4
Add
BLAST
Repeati165 – 18622LRR 5
Add
BLAST
Repeati187 – 20822LRR 6
Add
BLAST
Repeati209 – 23022LRR 7
Add
BLAST
Repeati231 – 25222LRR 8
Add
BLAST
Repeati253 – 27422LRR 9
Add
BLAST
Repeati275 – 29622LRR 10
Add
BLAST
Repeati297 – 31822LRR 11
Add
BLAST
Domaini331 – 36030LRRCT
Add
BLAST

Sequence similaritiesi

Belongs to the SDS22 family.
Contains 1 LRRCT domain.

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiCOG4886.
HOGENOMiHOG000211189.
HOVERGENiHBG082161.
InParanoidiQ15435.
KOiK17550.
OMAiANRIKKI.
PhylomeDBiQ15435.
TreeFamiTF105538.

Family and domain databases

InterProiIPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR003603. U2A'_phosphoprotein32A_C.
[Graphical view]
PfamiPF12799. LRR_4. 2 hits.
[Graphical view]
SMARTiSM00446. LRRcap. 1 hit.
[Graphical view]
PROSITEiPS51450. LRR. 12 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q15435-1) [UniParc]FASTAAdd to Basket

Also known as: sds22alpha1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAERGAGQQ QSQEMMEVDR RVESEESGDE EGKKHSSGIV ADLSEQSLKD    50
GEERGEEDPE EEHELPVDME TINLDRDAED VDLNHYRIGK IEGFEVLKKV 100
KTLCLRQNLI KCIENLEELQ SLRELDLYDN QIKKIENLEA LTELEILDIS 150
FNLLRNIEGV DKLTRLKKLF LVNNKISKIE NLSNLHQLQM LELGSNRIRA 200
IENIDTLTNL ESLFLGKNKI TKLQNLDALT NLTVLSMQSN RLTKIEGLQN 250
LVNLRELYLS HNGIEVIEGL ENNNKLTMLD IASNRIKKIE NISHLTELQE 300
FWMNDNLLES WSDLDELKGA RSLETVYLER NPLQKDPQYR RKVMLALPSV 350
RQIDATFVRF 360
Length:360
Mass (Da):41,564
Last modified:November 1, 1996 - v1
Checksum:i49BCCF675EAA94D1
GO
Isoform 2 (identifier: Q15435-2) [UniParc]FASTAAdd to Basket

Also known as: sds22alpha2

The sequence of this isoform differs from the canonical sequence as follows:
     18-60: Missing.

Show »
Length:317
Mass (Da):36,837
Checksum:i9AC120B3C729CF8B
GO
Isoform 3 (identifier: Q15435-3) [UniParc]FASTAAdd to Basket

Also known as: sds22beta1

The sequence of this isoform differs from the canonical sequence as follows:
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Show »
Length:280
Mass (Da):32,053
Checksum:i4FE43AE30C65AB72
GO
Isoform 4 (identifier: Q15435-4) [UniParc]FASTAAdd to Basket

Also known as: sds22beta2

The sequence of this isoform differs from the canonical sequence as follows:
     18-60: Missing.
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Show »
Length:237
Mass (Da):27,326
Checksum:i627A59386B5763BB
GO
Isoform 5 (identifier: Q15435-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE → M
     274-280: NKLTMLD → VQDSLTY
     281-360: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.

Show »
Length:221
Mass (Da):25,593
Checksum:i9AB66B080F2F52C0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6060MAAER…EEDPE → M in isoform 5.
VSP_055672Add
BLAST
Alternative sequencei18 – 6043Missing in isoform 2 and isoform 4.
VSP_019244Add
BLAST
Alternative sequencei274 – 2807NKLTMLD → VQDSLTY in isoform 3, isoform 4 and isoform 5.
VSP_019245
Alternative sequencei281 – 36080Missing in isoform 3, isoform 4 and isoform 5.
VSP_019246Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z50749 mRNA. Translation: CAA90626.1.
AF067136
, AF067130, AF067132, AF067133, AF067134, AF067135 Genomic DNA. Translation: AAD26610.1.
AF067136
, AF067130, AF067132, AF067134, AF067135, AF067133, AF067131 Genomic DNA. Translation: AAD26611.1.
AF067134
, AF067130, AF067131, AF067132, AF067133 Genomic DNA. Translation: AAD26612.1.
AF067134
, AF067132, AF067130, AF067133 Genomic DNA. Translation: AAD26613.1.
BT007296 mRNA. Translation: AAP35960.1.
BT020134 mRNA. Translation: AAV38936.1.
AK294043 mRNA. Translation: BAG57395.1.
AC005237 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW71243.1.
BC000910 mRNA. Translation: AAH00910.1.
BC012397 mRNA. Translation: AAH12397.1.
BC013001 mRNA. Translation: AAH13001.1.
CCDSiCCDS2546.1. [Q15435-1]
CCDS63192.1. [Q15435-3]
CCDS63193.1. [Q15435-4]
CCDS63194.1. [Q15435-2]
PIRiS68209.
RefSeqiNP_001269338.1. NM_001282409.1. [Q15435-2]
NP_001269339.1. NM_001282410.1. [Q15435-3]
NP_001269340.1. NM_001282411.1. [Q15435-4]
NP_001269341.1. NM_001282412.1.
NP_001269342.1. NM_001282413.1.
NP_001269343.1. NM_001282414.1.
NP_002703.1. NM_002712.2. [Q15435-1]
UniGeneiHs.36587.

Genome annotation databases

EnsembliENST00000234038; ENSP00000234038; ENSG00000115685. [Q15435-1]
ENST00000272983; ENSP00000272983; ENSG00000115685. [Q15435-2]
ENST00000401987; ENSP00000385466; ENSG00000115685. [Q15435-4]
ENST00000406106; ENSP00000385022; ENSG00000115685. [Q15435-3]
ENST00000407025; ENSP00000385657; ENSG00000115685. [Q15435-1]
GeneIDi5510.
KEGGihsa:5510.
UCSCiuc002was.3. human. [Q15435-3]
uc002wat.1. human. [Q15435-1]
uc002wau.1. human. [Q15435-2]

Polymorphism databases

DMDMi74762145.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Z50749 mRNA. Translation: CAA90626.1 .
AF067136
, AF067130 , AF067132 , AF067133 , AF067134 , AF067135 Genomic DNA. Translation: AAD26610.1 .
AF067136
, AF067130 , AF067132 , AF067134 , AF067135 , AF067133 , AF067131 Genomic DNA. Translation: AAD26611.1 .
AF067134
, AF067130 , AF067131 , AF067132 , AF067133 Genomic DNA. Translation: AAD26612.1 .
AF067134
, AF067132 , AF067130 , AF067133 Genomic DNA. Translation: AAD26613.1 .
BT007296 mRNA. Translation: AAP35960.1 .
BT020134 mRNA. Translation: AAV38936.1 .
AK294043 mRNA. Translation: BAG57395.1 .
AC005237 Genomic DNA. No translation available.
CH471063 Genomic DNA. Translation: EAW71243.1 .
BC000910 mRNA. Translation: AAH00910.1 .
BC012397 mRNA. Translation: AAH12397.1 .
BC013001 mRNA. Translation: AAH13001.1 .
CCDSi CCDS2546.1. [Q15435-1 ]
CCDS63192.1. [Q15435-3 ]
CCDS63193.1. [Q15435-4 ]
CCDS63194.1. [Q15435-2 ]
PIRi S68209.
RefSeqi NP_001269338.1. NM_001282409.1. [Q15435-2 ]
NP_001269339.1. NM_001282410.1. [Q15435-3 ]
NP_001269340.1. NM_001282411.1. [Q15435-4 ]
NP_001269341.1. NM_001282412.1.
NP_001269342.1. NM_001282413.1.
NP_001269343.1. NM_001282414.1.
NP_002703.1. NM_002712.2. [Q15435-1 ]
UniGenei Hs.36587.

3D structure databases

ProteinModelPortali Q15435.
SMRi Q15435. Positions 57-359.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 111502. 17 interactions.
DIPi DIP-1005N.
IntActi Q15435. 11 interactions.
MINTi MINT-5004667.
STRINGi 9606.ENSP00000234038.

PTM databases

PhosphoSitei Q15435.

Polymorphism databases

DMDMi 74762145.

2D gel databases

REPRODUCTION-2DPAGE IPI00033600.

Proteomic databases

MaxQBi Q15435.
PaxDbi Q15435.
PRIDEi Q15435.

Protocols and materials databases

DNASUi 5510.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000234038 ; ENSP00000234038 ; ENSG00000115685 . [Q15435-1 ]
ENST00000272983 ; ENSP00000272983 ; ENSG00000115685 . [Q15435-2 ]
ENST00000401987 ; ENSP00000385466 ; ENSG00000115685 . [Q15435-4 ]
ENST00000406106 ; ENSP00000385022 ; ENSG00000115685 . [Q15435-3 ]
ENST00000407025 ; ENSP00000385657 ; ENSG00000115685 . [Q15435-1 ]
GeneIDi 5510.
KEGGi hsa:5510.
UCSCi uc002was.3. human. [Q15435-3 ]
uc002wat.1. human. [Q15435-1 ]
uc002wau.1. human. [Q15435-2 ]

Organism-specific databases

CTDi 5510.
GeneCardsi GC02P242088.
HGNCi HGNC:9295. PPP1R7.
HPAi HPA034500.
HPA034501.
MIMi 602877. gene.
neXtProti NX_Q15435.
PharmGKBi PA33658.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG4886.
HOGENOMi HOG000211189.
HOVERGENi HBG082161.
InParanoidi Q15435.
KOi K17550.
OMAi ANRIKKI.
PhylomeDBi Q15435.
TreeFami TF105538.

Miscellaneous databases

ChiTaRSi PPP1R7. human.
GeneWikii PPP1R7.
GenomeRNAii 5510.
NextBioi 21312.
PROi Q15435.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q15435.
Bgeei Q15435.
CleanExi HS_PPP1R7.
Genevestigatori Q15435.

Family and domain databases

InterProi IPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR003603. U2A'_phosphoprotein32A_C.
[Graphical view ]
Pfami PF12799. LRR_4. 2 hits.
[Graphical view ]
SMARTi SM00446. LRRcap. 1 hit.
[Graphical view ]
PROSITEi PS51450. LRR. 12 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of a human polypeptide related to yeast sds22, a regulator of protein phosphatase-1."
    Renouf S., Beullens M., Wera S., Van Eynde A., Sikela J., Stalmans W., Bollen M.
    FEBS Lett. 375:75-78(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Structure and splice products of the human gene encoding sds22, a putative mitotic regulator of protein phosphatase-1."
    Ceulemans H., Van Eynde A., Perez-Callejon E., Beullens M., Stalmans W., Bollen M.
    Eur. J. Biochem. 262:36-42(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING.
  3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Cerebellum.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Cervix.
  8. "Binding of the concave surface of the Sds22 superhelix to the alpha 4/alpha 5/alpha 6-triangle of protein phosphatase-1."
    Ceulemans H., Vulsteke V., De Maeyer M., Tatchell K., Stalmans W., Bollen M.
    J. Biol. Chem. 277:47331-47337(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PPP1CA; PPP1CB AND PPP1CC ISOFORM 1, MUTAGENESIS OF ASP-148; PHE-170; GLU-192; PHE-214; ASP-280; GLU-300; TRP-302 AND TYR-327.
  9. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
    Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
    Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24 AND SER-27, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  11. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24; SER-27; SER-44 AND SER-47, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12; SER-24 AND SER-27, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPP1R7_HUMAN
AccessioniPrimary (citable) accession number: Q15435
Secondary accession number(s): B4DFD4
, B5MCY6, Q9UQE5, Q9UQE6, Q9Y6K4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: November 1, 1996
Last modified: September 3, 2014
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi