Q15349 (KS6A2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 136.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ribosomal protein S6 kinase alpha-2 Short name=S6K-alpha-2 EC=2.7.11.1 Alternative name(s): 90 kDa ribosomal protein S6 kinase 2 Short name=p90-RSK 2 Short name=p90RSK2 MAP kinase-activated protein kinase 1c Short name=MAPK-activated protein kinase 1c Short name=MAPKAP kinase 1c Short name=MAPKAPK-1c Ribosomal S6 kinase 3 Short name=RSK-3 pp90RSK3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 733 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival, and differentiation. May function as tumor suppressor in epithelial ovarian cancer cells. Ref.1 Ref.8 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium. |
| Enzyme regulation | Upon extracellular signal or mitogen stimulation, phosphorylated at Thr-570 in the C-terminal kinase domain (CTKD) by MAPK1/ERK2 and MAPK3/ERK1. The activated CTKD then autophosphorylates Ser-377, allowing binding of PDPK1, which in turn phosphorylates Ser-218 in the N-terminal kinase domain (NTDK) leading to the full activation of the protein and subsequent phosphorylation of the substrates by the NTKD. Ref.7 |
| Subunit structure | Forms a complex with either MAPK1/ERK2 or MAPK3/ERK1 in quiescent cells. Transiently dissociates following mitogenic stimulation By similarity. |
| Subcellular location | |
| Tissue specificity | Widely expressed with higher expression in lung, skeletal muscle, brain, uterus, ovary, thyroid and prostate. Ref.1 Ref.8 |
| Post-translational modification | Activated by phosphorylation at Ser-218 by PDPK1. Autophosphorylated on Ser-377, as part of the activation process. May be phosphorylated at Thr-356 and Ser-360 by MAPK1/ERK2 and MAPK3/ERK1 By similarity. Ref.7 N-terminal myristoylation results in an activated kinase in the absence of added growth factors By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily. Contains 1 AGC-kinase C-terminal domain. Contains 2 protein kinase domains. |
| Sequence caution | The sequence AAC82496.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAD92353.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAG53121.1 differs from that shown. Reason: Frameshift at position 527. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15349-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15349-2) The sequence of this isoform differs from the canonical sequence as follows: 1-32: MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRL → MPIAQLLELW...ACKTKVAGSV | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q15349-3) The sequence of this isoform differs from the canonical sequence as follows: 1-32: MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRL → MPIAQLLELWKKIEVEPMEIETTEEDLNLDVEPTTEDTAE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 733 | 733 | Ribosomal protein S6 kinase alpha-2 | PRO_0000086201 | |||||
Regions | |||||||||
| Domain | 59 – 318 | 260 | Protein kinase 1 | ||||||
| Domain | 319 – 388 | 70 | AGC-kinase C-terminal | ||||||
| Domain | 415 – 672 | 258 | Protein kinase 2 | ||||||
| Nucleotide binding | 65 – 73 | 9 | ATP By similarity | ||||||
| Nucleotide binding | 421 – 429 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 184 | 1 | Proton acceptor By similarity | ||||||
| Active site | 532 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 91 | 1 | ATP By similarity | ||||||
| Binding site | 444 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 218 | 1 | Phosphoserine; by PDPK1 Ref.7 | ||||||
| Modified residue | 377 | 1 | Phosphoserine Ref.12 | ||||||
| Cross-link | 630 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.9 | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 32 | 32 | MDLSM…SLSRL → MPIAQLLELWKKIEVEPMEI ETTEEDLNLDVGPATEDTAE EGKSDSAACKTKVAGSV in isoform 2. | VSP_017732 | |||||
| Alternative sequence | 1 – 32 | 32 | MDLSM…SLSRL → MPIAQLLELWKKIEVEPMEI ETTEEDLNLDVEPTTEDTAE in isoform 3. | VSP_041836 | |||||
| Natural variant | 311 | 1 | E → K in a metastatic melanoma sample; somatic mutation. Ref.13 | VAR_040627 | |||||
| Natural variant | 732 | 1 | R → Q in a colorectal adenocarcinoma sample; somatic mutation. Ref.13 | VAR_040628 | |||||
Experimental info | |||||||||
| Sequence conflict | 256 | 1 | S → A in AAC82496. Ref.6 | ||||||
| Sequence conflict | 269 | 1 | A → S in AAC82496. Ref.6 | ||||||
| Sequence conflict | 339 | 1 | V → L in CAA59427. Ref.1 | ||||||
| Sequence conflict | 339 | 1 | V → L in AAC82496. Ref.6 | ||||||
| Sequence conflict | 447 | 1 | D → G in AAC82496. Ref.6 | ||||||
| Isoform 3: | |||||||||
| Sequence conflict | 32 | 1 | E → G in BAG53121. Ref.3 | ||||||
| Sequence conflict | 34 | 1 | T → A in BAG53121. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "RSK3 encodes a novel pp90rsk isoform with a unique N-terminal sequence: growth factor-stimulated kinase function and nuclear translocation." Zhao Y., Bjoerbaek C., Weremowicz S., Morton C.C., Moller D.E. Mol. Cell. Biol. 15:4353-4363(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [2] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [4] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle. |
| [6] | "Human rsk isoforms: cloning and characterization of tissue-specific expression." Moller D.E., Xia C.-H., Tang W., Zhu A.X., Jakubowski M. Am. J. Physiol. 266:C351-C359(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-540 (ISOFORM 1). |
| [7] | "90-kDa ribosomal S6 kinase is phosphorylated and activated by 3-phosphoinositide-dependent protein kinase-1." Jensen C.J., Buch M.-B., Krag T.O., Hemmings B.A., Gammeltoft S., Froedin M. J. Biol. Chem. 274:27168-27176(1999) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION, PHOSPHORYLATION AT SER-218. |
| [8] | "RPS6KA2, a putative tumour suppressor gene at 6q27 in sporadic epithelial ovarian cancer." Bignone P.A., Lee K.Y., Liu Y., Emilion G., Finch J., Soosay A.E., Charnock F.M., Beck S., Dunham I., Mungall A.J., Ganesan T.S. Oncogene 26:683-700(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN TUMORIGENESIS, TISSUE SPECIFICITY. |
| [9] | "Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry." Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D. Proteomics 7:868-874(2007) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-630, MASS SPECTROMETRY. Tissue: Mammary cancer. |
| [10] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [11] | "The RSK family of kinases: emerging roles in cellular signalling." Anjum R., Blenis J. Nat. Rev. Mol. Cell Biol. 9:747-758(2008) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON FUNCTION. |
| [12] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-377, MASS SPECTROMETRY. |
| [13] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] LYS-311 AND GLN-732. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X85106 mRNA. Translation: CAA59427.1. AB209116 mRNA. Translation: BAD92353.1. Different initiation. AK095751 mRNA. Translation: BAG53121.1. Frameshift. AL022069, Z98049 Genomic DNA. Translation: CAI19651.1. AL023775 Genomic DNA. No translation available. AL159163 Genomic DNA. No translation available. Z98049, AL022069 Genomic DNA. Translation: CAI20579.1. BC002363 mRNA. Translation: AAH02363.1. L07598 mRNA. Translation: AAC82496.1. Different initiation. |
| IPI | IPI00300321. IPI00478653. |
| PIR | A57459. |
| RefSeq | NP_001006933.1. NM_001006932.1. NP_066958.2. NM_021135.4. |
| UniGene | Hs.655277. |
3D structure databases | |
| ProteinModelPortal | Q15349. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-295N. |
| IntAct | Q15349. 4 interactions. |
| MINT | MINT-1542928. |
| STRING | 9606.ENSP00000386050. |
PTM databases | |
| PhosphoSite | Q15349. |
Polymorphism databases | |
| DMDM | 90110031. |
2D gel databases | |
| REPRODUCTION-2DPAGE | Q15349. |
Proteomic databases | |
| PaxDb | Q15349. |
| PRIDE | Q15349. |
Protocols and materials databases | |
| DNASU | 6196. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000265678; ENSP00000265678; ENSG00000071242. ENST00000503859; ENSP00000427015; ENSG00000071242. |
| GeneID | 6196. |
| KEGG | hsa:6196. |
| UCSC | uc003qvb.1. human. |
Organism-specific databases | |
| CTD | 6196. |
| GeneCards | GC06M166822. |
| HGNC | HGNC:10431. RPS6KA2. |
| HPA | CAB026243. |
| MIM | 601685. gene. |
| neXtProt | NX_Q15349. |
| PharmGKB | PA34846. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOGENOM | HOG000233033. |
| HOVERGEN | HBG108317. |
| KO | K04373. |
| OrthoDB | EOG402WRK. |
| PhylomeDB | Q15349. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.1. 2681. |
| Reactome | REACT_111045. Developmental Biology. REACT_111102. Signal Transduction. REACT_13685. Neuronal System. REACT_6782. TRAF6 Mediated Induction of proinflammatory cytokines. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q15349. |
| Bgee | Q15349. |
| CleanEx | HS_RPS6KA2. |
| Genevestigator | Q15349. |
| GermOnline | ENSG00000071242. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000961. AGC-kinase_C. IPR011009. Kinase-like_dom. IPR017892. Pkinase_C. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR016239. Ribosomal_S6_kinase_II. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 2 hits. PF00433. Pkinase_C. 1 hit. [Graphical view] |
| PIRSF | PIRSF000606. Ribsml_S6_kin_2. 1 hit. |
| SMART | SM00133. S_TK_X. 1 hit. SM00220. S_TKc. 2 hits. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 2 hits. |
| PROSITE | PS51285. AGC_KINASE_CTER. 1 hit. PS00107. PROTEIN_KINASE_ATP. 2 hits. PS50011. PROTEIN_KINASE_DOM. 2 hits. PS00108. PROTEIN_KINASE_ST. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q15349. |
| ChEMBL | CHEMBL3906. |
| ChiTaRS | RPS6KA2. human. |
| GenomeRNAi | 6196. |
| NextBio | 24063. |
| SOURCE | Search... |
Entry information
| Entry name | KS6A2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15349 Secondary accession number(s): B3KTK9 Q9UJN5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
