Q15326 (ZMY11_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger MYND domain-containing protein 11 Alternative name(s): Adenovirus 5 E1A-binding protein Protein BS69 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 602 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Corepressor of transcription Probable. May be involved in chromatin remodeling through association with several remodeling factors. Ref.2 Ref.6 |
| Subunit structure | Interacts (via MYND-type zinc finger) with NCOR1. Interacts (via MYND-type zinc finger) with human adenovirus early E1A protein (via PXLXP motif); this interaction inhibits E1A mediated transactivation. Interacts (via MYND-type zinc finger) with Epstein-Barr virus EBNA2 protein (via PXLXP motif). Interacts (via MYND-type zinc finger) with EZH2. Interacts with E2F6. Ref.2 Ref.6 Ref.7 |
| Subcellular location | Nucleus. Chromosome. Note: Associates with chromatin and mitotic chromosomes. Ref.2 |
| Tissue specificity | Ubiquitous. Ref.2 |
| Post-translational modification | Ubiquitinated, leading to proteasomal degradation. Ref.2 |
| Sequence similarities | Contains 1 bromo domain. Contains 1 MYND-type zinc finger. Contains 1 PHD-type zinc finger. Contains 1 PWWP domain. |
| Sequence caution | The sequence BAG35465.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAA60052.1 differs from that shown. Reason: Frameshift at positions 11 and 39. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| LTBR | P36941 | 5 | EBI-2799565,EBI-3509981 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15326-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15326-2) The sequence of this isoform differs from the canonical sequence as follows: 93-146: Missing. | ||||||
| Isoform 3 (identifier: Q15326-3) The sequence of this isoform differs from the canonical sequence as follows: 563-602: CYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR → VNTSLF | ||||||
| Isoform 4 (identifier: Q15326-4) The sequence of this isoform differs from the canonical sequence as follows: 93-146: Missing. 563-602: CYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR → VNTSLF | ||||||
| Isoform 5 (identifier: Q15326-5) The sequence of this isoform differs from the canonical sequence as follows: 93-146: Missing. 173-203: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 602 | 602 | Zinc finger MYND domain-containing protein 11 | PRO_0000211218 | |||||
Regions | |||||||||
| Domain | 168 – 238 | 71 | Bromo | ||||||
| Domain | 280 – 331 | 52 | PWWP | ||||||
| Zinc finger | 100 – 148 | 49 | PHD-type | ||||||
| Zinc finger | 563 – 598 | 36 | MYND-type | ||||||
| Region | 452 – 572 | 121 | Interaction with human adenovirus E1A | ||||||
| Motif | 394 – 400 | 7 | Nuclear localization signal Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 421 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 93 – 146 | 54 | Missing in isoform 2, isoform 4 and isoform 5. | VSP_044482 | |||||
| Alternative sequence | 173 – 203 | 31 | Missing in isoform 5. | VSP_046246 | |||||
| Alternative sequence | 563 – 602 | 40 | CYNCE…CRRKR → VNTSLF in isoform 3 and isoform 4. | VSP_044483 | |||||
Experimental info | |||||||||
| Mutagenesis | 563 | 1 | C → S: Abrogates binding to EZH2. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "BS69, a novel adenovirus E1A-associated protein that inhibits E1A transactivation." Hateboer G., Gennissen A., Ramos Y.F.M., Kerkhoven R.M., Sonntag-Buck V., Stunnenberg H.G., Bernards R. EMBO J. 14:3159-3169(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Colon carcinoma. |
| [2] | "New insights into BS69 functions." Velasco G., Grkovic S., Ansieau S. J. Biol. Chem. 281:16546-16550(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, FUNCTION, UBIQUITINATION, INTERACTION WITH E2F6 AND EZH2, MUTAGENESIS OF CYS-563. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Amygdala and Brain. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The adenovirus E1A binding protein BS69 is a corepressor of transcription through recruitment of N-CoR." Masselink H., Bernards R. Oncogene 19:1538-1546(2000) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH NCOR1. |
| [7] | "The conserved Mynd domain of BS69 binds cellular and oncoviral proteins through a common PXLXP motif." Ansieau S., Leutz A. J. Biol. Chem. 277:4906-4910(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HUMAN ADENOVIRUS EARLY E1A PROTEIN, INTERACTION WITH EPSTEIN-BARR VIRUS EBNA2 PROTEIN. |
| [8] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Embryonic kidney. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-421, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X86098 mRNA. Translation: CAA60052.1. Frameshift. DQ335452 mRNA. Translation: ABC72408.1. DQ335453 mRNA. Translation: ABC72409.1. DQ335454 mRNA. Translation: ABC72410.1. DQ335455 mRNA. Translation: ABC72411.1. AK294469 mRNA. Translation: BAH11779.1. AK312570 mRNA. Translation: BAG35465.1. Different initiation. AL589988, AL603831 Genomic DNA. Translation: CAH69845.1. AL603831, AL589988 Genomic DNA. Translation: CAI40899.1. AL713922 Genomic DNA. No translation available. AL731539 Genomic DNA. No translation available. CH471072 Genomic DNA. Translation: EAW86540.1. CH471072 Genomic DNA. Translation: EAW86541.1. |
| IPI | IPI00480004. IPI00556262. IPI00873394. IPI00878480. IPI00930718. IPI00967676. |
| PIR | S56145. |
| RefSeq | NP_001189393.1. NM_001202464.1. NP_001189394.1. NM_001202465.1. NP_001189396.1. NM_001202467.1. NP_001189397.1. NM_001202468.1. NP_006615.2. NM_006624.5. |
| UniGene | Hs.292265. Hs.740145. |
3D structure databases | |
| ProteinModelPortal | Q15326. |
| SMR | Q15326. Positions 98-239, 279-352, 560-600. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q15326. 7 interactions. |
| MINT | MINT-156360. |
| STRING | 9606.ENSP00000309992. |
PTM databases | |
| PhosphoSite | Q15326. |
Polymorphism databases | |
| DMDM | 10719919. |
Proteomic databases | |
| PaxDb | Q15326. |
| PRIDE | Q15326. |
Protocols and materials databases | |
| DNASU | 10771. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000309776; ENSP00000309992; ENSG00000015171. ENST00000381591; ENSP00000371003; ENSG00000015171. ENST00000381604; ENSP00000371017; ENSG00000015171. ENST00000397959; ENSP00000381050; ENSG00000015171. ENST00000397962; ENSP00000381053; ENSG00000015171. ENST00000565311; ENSP00000457248; ENSG00000260150. |
| GeneID | 10771. |
| KEGG | hsa:10771. |
| UCSC | uc001ifk.3. human. uc001ifm.3. human. uc001ifn.3. human. uc009xhg.3. human. uc010pzw.2. human. |
Organism-specific databases | |
| CTD | 10771. |
| GeneCards | GC10P000170. |
| H-InvDB | HIX0025946. |
| HGNC | HGNC:16966. ZMYND11. |
| HPA | HPA015816. HPA030553. |
| MIM | 608668. gene. |
| neXtProt | NX_Q15326. |
| PharmGKB | PA128394578. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG265768. |
| HOGENOM | HOG000038026. |
| HOVERGEN | HBG054949. |
| InParanoid | Q15326. |
| OMA | TSDGVCQ. |
Gene expression databases | |
| ArrayExpress | Q15326. |
| Bgee | Q15326. |
| CleanEx | HS_ZMYND11. |
| Genevestigator | Q15326. |
| GermOnline | ENSG00000015171. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.920.10. 1 hit. 3.30.40.10. 1 hit. |
| InterPro | IPR001487. Bromodomain. IPR000313. PWWP. IPR019786. Zinc_finger_PHD-type_CS. IPR011011. Znf_FYVE_PHD. IPR002893. Znf_MYND. IPR001965. Znf_PHD. IPR019787. Znf_PHD-finger. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Pfam | PF00439. Bromodomain. 1 hit. PF00855. PWWP. 1 hit. [Graphical view] |
| SMART | SM00297. BROMO. 1 hit. SM00249. PHD. 1 hit. SM00293. PWWP. 1 hit. SM00184. RING. 1 hit. [Graphical view] |
| SUPFAM | SSF47370. Bromodomain. 1 hit. SSF57903. FYVE_PHD_ZnF. 1 hit. |
| PROSITE | PS50014. BROMODOMAIN_2. 1 hit. PS50812. PWWP. 1 hit. PS01360. ZF_MYND_1. 1 hit. PS50865. ZF_MYND_2. 1 hit. PS01359. ZF_PHD_1. 1 hit. PS50016. ZF_PHD_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ZMYND11. human. |
| GenomeRNAi | 10771. |
| NextBio | 40897. |
| SOURCE | Search... |
Entry information
| Entry name | ZMY11_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15326 Secondary accession number(s): B2R6G8 Q5VUI1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
