Q15154 (PCM1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Pericentriolar material 1 protein Short name=PCM-1 Short name=hPCM-1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2024 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for centrosome assembly and function. Essential for the correct localization of several centrosomal proteins including CEP250, CETN3, PCNT and NEK2. Required to anchor microtubules to the centrosome. Involved in the biogenesis of cilia. Ref.7 Ref.15 Ref.19 Ref.31 |
| Subunit structure | Self-associates By similarity. Interacts with BBS4, BBS8, CETN3, HAP1, NDE1 and NDEL1. Ref.6 Ref.7 Ref.8 Ref.9 Ref.21 |
| Subcellular location | Cytoplasm › cytoskeleton. Cytoplasm › cytoskeleton › centrosome. Cytoplasmic granule. Note: Localizes to cytoplasmic granules which are enriched around the centrosome. This centrosomal enrichment requires microtubules and dynein. The majority of the protein dissociates from the centrosome during metaphase and subsequently localizes to the cleavage site in telophase. Ref.1 Ref.5 Ref.7 Ref.8 Ref.9 Ref.15 Ref.19 Ref.21 |
| Tissue specificity | Expressed in blood, bone marrow, breast, lymph node, ovary and thyroid. Ref.5 Ref.10 Ref.12 Ref.20 |
| Induction | Expression is reduced in breast and ovarian cancer. Ref.10 Ref.12 |
| Post-translational modification | Phosphorylated upon DNA damage, probably by ATM or ATR. Ref.11 Ref.17 Ref.22 Ref.23 Ref.24 Ref.25 Ref.26 Ref.27 Ref.28 Ref.29 |
| Involvement in disease | Defects in PCM1 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving PCM1 is found in thyroid papillary carcinomas. Translocation t(8;10)(p21.3;q11.2) with RET links the protein kinase domain of RET to the major portion of PCM1. Note=A chromosomal aberration involving PCM1 is found in a variety of hematological malignancies including atypical chronic myeloid leukemia (atypical CML) and T-cell lymphoma. Translocation t(8;9)(p22;p24) with JAK2 links the protein kinase domain of JAK2 to the major portion of PCM1. |
| Sequence similarities | Belongs to the PCM1 family. |
| Sequence caution | The sequence AAH27477.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence AAH65022.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. The sequence BAC03656.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAC14882.1 differs from that shown. Reason: Contaminating sequence. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BBS1 | Q8NFJ9 | 2 | EBI-741421,EBI-1805484 | |
| BBS4 | Q96RK4 | 12 | EBI-741421,EBI-1805814 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15154-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15154-2) The sequence of this isoform differs from the canonical sequence as follows: 1315-1370: RYESASMSSTCEPCKSRNRHSAQTEEPVQAKVFSRKNHEQLEKIIKCNRSTEISSE → K | ||||||
| Isoform 3 (identifier: Q15154-3) The sequence of this isoform differs from the canonical sequence as follows: 263-263: R → RENEEEDVRTIDSAVGSGSVAESTSLNIDVQSEASDTTAR 492-2024: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2024 | 2024 | Pericentriolar material 1 protein | PRO_0000274037 | |||||
Regions | |||||||||
| Region | 1279 – 1799 | 521 | Interaction with HAP1 | ||||||
| Region | 1913 – 2024 | 112 | Interaction with BBS4 | ||||||
| Coiled coil | 218 – 301 | 84 | Potential | ||||||
| Coiled coil | 400 – 424 | 25 | Potential | ||||||
| Coiled coil | 487 – 543 | 57 | Potential | ||||||
| Coiled coil | 651 – 682 | 32 | Potential | ||||||
| Coiled coil | 726 – 769 | 44 | Potential | ||||||
| Coiled coil | 824 – 858 | 35 | Potential | ||||||
| Coiled coil | 1063 – 1089 | 27 | Potential | ||||||
| Coiled coil | 1515 – 1539 | 25 | Potential | ||||||
Sites | |||||||||
| Site | 1314 – 1315 | 2 | Breakpoint for translocation to form PCM1-JAK2 fusion protein | ||||||
| Site | 1369 – 1370 | 2 | Breakpoint for translocation to form PCM1-JAK2 fusion protein | ||||||
| Site | 1470 – 1471 | 2 | Breakpoint for translocation to form PCM1-JAK2 fusion protein | ||||||
| Site | 1609 – 1610 | 2 | Breakpoint for translocation to form PCM1-RET fusion protein | ||||||
| Site | 1947 – 1948 | 2 | Breakpoint for translocation to form PCM1-JAK2 fusion protein | ||||||
Amino acid modifications | |||||||||
| Modified residue | 61 | 1 | Phosphothreonine Ref.28 | ||||||
| Modified residue | 65 | 1 | Phosphoserine Ref.11 Ref.17 Ref.22 Ref.23 Ref.26 Ref.27 Ref.28 Ref.29 | ||||||
| Modified residue | 68 | 1 | Phosphoserine Ref.17 Ref.22 Ref.27 Ref.28 Ref.29 | ||||||
| Modified residue | 69 | 1 | Phosphoserine Ref.17 Ref.22 Ref.23 Ref.27 Ref.28 Ref.29 | ||||||
| Modified residue | 93 | 1 | Phosphoserine Ref.27 Ref.29 | ||||||
| Modified residue | 110 | 1 | Phosphoserine Ref.17 Ref.27 Ref.28 Ref.29 | ||||||
| Modified residue | 116 | 1 | Phosphoserine Ref.29 | ||||||
| Modified residue | 119 | 1 | Phosphoserine Ref.29 | ||||||
| Modified residue | 159 | 1 | Phosphoserine Ref.28 | ||||||
| Modified residue | 356 | 1 | Phosphoserine Ref.24 | ||||||
| Modified residue | 372 | 1 | Phosphoserine Ref.25 | ||||||
| Modified residue | 399 | 1 | N6-acetyllysine Ref.30 | ||||||
| Modified residue | 431 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 861 | 1 | Phosphoserine Ref.17 Ref.28 | ||||||
| Modified residue | 866 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 869 | 1 | Phosphoserine Ref.17 | ||||||
| Modified residue | 872 | 1 | Phosphoserine Ref.17 Ref.28 | ||||||
| Modified residue | 877 | 1 | Phosphothreonine Ref.22 | ||||||
| Modified residue | 960 | 1 | Phosphoserine Ref.27 | ||||||
| Modified residue | 991 | 1 | Phosphoserine Ref.23 | ||||||
| Modified residue | 1185 | 1 | Phosphoserine Ref.28 Ref.29 | ||||||
| Modified residue | 1187 | 1 | Phosphoserine Ref.28 | ||||||
| Modified residue | 1188 | 1 | Phosphoserine Ref.28 | ||||||
| Modified residue | 1231 | 1 | Phosphoserine Ref.27 | ||||||
| Modified residue | 1257 | 1 | Phosphoserine Ref.27 Ref.29 | ||||||
| Modified residue | 1260 | 1 | Phosphoserine Ref.27 | ||||||
| Modified residue | 1262 | 1 | Phosphoserine Ref.27 | ||||||
| Modified residue | 1290 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1373 | 1 | Phosphoserine Ref.29 | ||||||
| Modified residue | 1435 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1437 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1656 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1697 | 1 | Phosphoserine Ref.29 | ||||||
| Modified residue | 1730 | 1 | Phosphoserine Ref.17 Ref.27 | ||||||
| Modified residue | 1765 | 1 | Phosphoserine Ref.17 Ref.27 Ref.28 Ref.29 | ||||||
| Modified residue | 1768 | 1 | Phosphoserine Ref.17 Ref.27 Ref.28 Ref.29 | ||||||
| Modified residue | 1776 | 1 | Phosphoserine Ref.17 Ref.27 Ref.28 Ref.29 | ||||||
| Modified residue | 1977 | 1 | Phosphoserine Ref.29 | ||||||
| Modified residue | 2023 | 1 | Phosphoserine Ref.28 | ||||||
Natural variations | |||||||||
| Alternative sequence | 263 | 1 | R → RENEEEDVRTIDSAVGSGSV AESTSLNIDVQSEASDTTAR in isoform 3. | VSP_022609 | |||||
| Alternative sequence | 492 – 2024 | 1533 | Missing in isoform 3. | VSP_022610 | |||||
| Alternative sequence | 1315 – 1370 | 56 | RYESA…EISSE → K in isoform 2. | VSP_022611 | |||||
| Natural variant | 159 | 1 | S → N. Corresponds to variant rs412750 [ dbSNP | Ensembl ]. | VAR_030164 | |||||
| Natural variant | 159 | 1 | S → R. Corresponds to variant rs412750 [ dbSNP | Ensembl ]. | VAR_062172 | |||||
| Natural variant | 176 | 1 | A → D. Corresponds to variant rs2285302 [ dbSNP | Ensembl ]. | VAR_030165 | |||||
| Natural variant | 597 | 1 | M → V. Ref.1 Ref.2 Corresponds to variant rs208753 [ dbSNP | Ensembl ]. | VAR_030166 | |||||
| Natural variant | 600 | 1 | S → P. Corresponds to variant rs34325017 [ dbSNP | Ensembl ]. | VAR_047381 | |||||
| Natural variant | 691 | 1 | A → S. Corresponds to variant rs17635381 [ dbSNP | Ensembl ]. | VAR_030167 | |||||
| Natural variant | 871 | 1 | G → V. Corresponds to variant rs7009117 [ dbSNP | Ensembl ]. | VAR_030168 | |||||
| Natural variant | 1251 | 1 | R → H. Corresponds to variant rs17514547 [ dbSNP | Ensembl ]. | VAR_030169 | |||||
| Natural variant | 1326 | 1 | E → D. Corresponds to variant rs34932823 [ dbSNP | Ensembl ]. | VAR_047382 | |||||
| Natural variant | 1543 | 1 | T → I. Corresponds to variant rs370429 [ dbSNP | Ensembl ]. | VAR_030170 | |||||
| Natural variant | 1701 | 1 | K → N. Corresponds to variant rs36113670 [ dbSNP | Ensembl ]. | VAR_047383 | |||||
| Natural variant | 1865 | 1 | N → D. Corresponds to variant rs35789133 [ dbSNP | Ensembl ]. | VAR_047384 | |||||
Experimental info | |||||||||
| Sequence conflict | 294 | 1 | R → RG in AAA60120. Ref.1 | ||||||
| Sequence conflict | 311 – 312 | 2 | EQ → DE in AAA60120. Ref.1 | ||||||
| Sequence conflict | 405 | 1 | E → K in AAH27477. Ref.3 | ||||||
| Sequence conflict | 408 | 1 | Q → K in AAH27477. Ref.3 | ||||||
| Sequence conflict | 408 | 1 | Q → K in AAH65022. Ref.3 | ||||||
| Sequence conflict | 447 – 448 | 2 | SV → CL in AAA60120. Ref.1 | ||||||
| Sequence conflict | 760 | 1 | Q → H in AAA60120. Ref.1 | ||||||
| Sequence conflict | 946 | 1 | G → R in AAA60120. Ref.1 | ||||||
| Sequence conflict | 952 | 1 | R → T in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1004 | 1 | Missing in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1086 | 1 | Q → R in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1168 | 1 | Q → R in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1169 | 1 | N → I in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1170 | 1 | S → L in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1342 | 1 | V → L in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1382 | 1 | R → Q in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1532 | 1 | T → A in BAC03656. Ref.4 | ||||||
| Sequence conflict | 1849 | 1 | S → G in BAC03656. Ref.4 | ||||||
| Sequence conflict | 1853 – 1864 | 12 | PLERE…SKNDQ → HWNEKPLVKMTK in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1872 | 1 | C → S in AAA60120. Ref.1 | ||||||
| Sequence conflict | 1988 | 1 | E → V in BAC03656. Ref.4 | ||||||
| Sequence conflict | 1998 | 1 | I → M in AAA60120. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PCM-1, A 228-kD centrosome autoantigen with a distinct cell cycle distribution." Balczon R., Bao L., Zimmer W.E. J. Cell Biol. 124:783-793(1994) [PubMed: 8120099] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, VARIANT VAL-597. Tissue: Liver. |
| [2] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-597. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-404 (ISOFORMS 1/2). Tissue: Lung, Testis and Uterus. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1244-2024 (ISOFORM 2). Tissue: Brain. |
| [5] | "RET/PCM-1: a novel fusion gene in papillary thyroid carcinoma." Corvi R., Berger N., Balczon R., Romeo G. Oncogene 19:4236-4242(2000) [PubMed: 10980597] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1527-1610 (ISOFORMS 1/2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, CHROMOSOMAL TRANSLOCATION WITH RET. |
| [6] | "Huntingtin-associated protein 1 (HAP1) interacts with the p150Glued subunit of dynactin." Engelender S., Sharp A.H., Colomer V., Tokito M.K., Lanahan A., Worley P., Holzbaur E.L.F., Ross C.A. Hum. Mol. Genet. 6:2205-2212(1997) [PubMed: 9361024] [Abstract] Cited for: INTERACTION WITH HAP1. |
| [7] | "Assembly of centrosomal proteins and microtubule organization depends on PCM-1." Dammermann A., Merdes A. J. Cell Biol. 159:255-266(2002) [PubMed: 12403812] [Abstract] Cited for: FUNCTION, INTERACTION WITH CETN3, SUBCELLULAR LOCATION. |
| [8] | "Basal body dysfunction is a likely cause of pleiotropic Bardet-Biedl syndrome." Ansley S.J., Badano J.L., Blacque O.E., Hill J., Hoskins B.E., Leitch C.C., Kim J.C., Ross A.J., Eichers E.R., Teslovich T.M., Mah A.K., Johnsen R.C., Cavender J.C., Lewis R.A., Leroux M.R., Beales P.L., Katsanis N. Nature 425:628-633(2003) [PubMed: 14520415] [Abstract] Cited for: INTERACTION WITH BBS8, SUBCELLULAR LOCATION. |
| [9] | "The Bardet-Biedl protein BBS4 targets cargo to the pericentriolar region and is required for microtubule anchoring and cell cycle progression." Kim J.C., Badano J.L., Sibold S., Esmail M.A., Hill J., Hoskins B.E., Leitch C.C., Venner K., Ansley S.J., Ross A.J., Leroux M.R., Katsanis N., Beales P.L. Nat. Genet. 36:462-470(2004) [PubMed: 15107855] [Abstract] Cited for: INTERACTION WITH BBS4, SUBCELLULAR LOCATION. |
| [10] | "Candidate tumor-suppressor genes on chromosome arm 8p in early-onset and high-grade breast cancers." Armes J.E., Hammet F., de Silva M., Ciciulla J., Ramus S.J., Soo W.-K., Mahoney A., Yarovaya N., Henderson M.A., Gish K., Hutchins A.-M., Price G.R., Venter D.J. Oncogene 23:5697-5702(2004) [PubMed: 15184884] [Abstract] Cited for: TISSUE SPECIFICITY, INDUCTION. |
| [11] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Five genes from chromosomal band 8p22 are significantly down-regulated in ovarian carcinoma: N33 and EFA6R have a potential impact on overall survival." Pils D., Horak P., Gleiss A., Sax C., Fabjani G., Moebus V.J., Zielinski C., Reinthaller A., Zeillinger R., Krainer M. Cancer 104:2417-2429(2005) [PubMed: 16270321] [Abstract] Cited for: TISSUE SPECIFICITY, INDUCTION. |
| [13] | "The t(8;9)(p22;p24) is a recurrent abnormality in chronic and acute leukemia that fuses PCM1 to JAK2." Reiter A., Walz C., Watmore A., Schoch C., Blau I., Schlegelberger B., Berger U., Telford N., Aruliah S., Yin J.A., Vanstraelen D., Barker H.F., Taylor P.C., O'Driscoll A., Benedetti F., Rudolph C., Kolb H.-J., Hochhaus A. Cross N.C.P.Cancer Res. 65:2662-2667(2005) [PubMed: 15805263] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH JAK2. |
| [14] | "PCM1-JAK2 fusion in myeloproliferative disorders and acute erythroid leukemia with t(8;9) translocation." Murati A., Gelsi-Boyer V., Adelaide J., Perot C., Talmant P., Giraudier S., Lode L., Letessier A., Delaval B., Brunel V., Imbert M., Garand R., Xerri L., Birnbaum D., Mozziconacci M.-J., Chaffanet M. Leukemia 19:1692-1696(2005) [PubMed: 16034466] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH JAK2. |
| [15] | "Dynamic recruitment of Nek2 kinase to the centrosome involves microtubules, PCM-1, and localized proteasomal degradation." Hames R.S., Crookes R.E., Straatman K.R., Merdes A., Hayes M.J., Faragher A.J., Fry A.M. Mol. Biol. Cell 16:1711-1724(2005) [PubMed: 15659651] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [16] | "The t(8;9)(p22;p24) translocation in atypical chronic myeloid leukaemia yields a new PCM1-JAK2 fusion gene." Bousquet M., Quelen C., De Mas V., Duchayne E., Roquefeuil B., Delsol G., Laurent G., Dastugue N., Brousset P. Oncogene 24:7248-7252(2005) [PubMed: 16091753] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH JAK2. |
| [17] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-68; SER-69; SER-110; SER-431; SER-861; SER-866; SER-869; SER-872; SER-1730; SER-1765; SER-1768 AND SER-1776, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "A combination of cytomorphology, cytogenetic analysis, fluorescence in situ hybridization and reverse transcriptase polymerase chain reaction for establishing clonality in cases of persisting hypereosinophilia." Bacher U., Reiter A., Haferlach T., Mueller L., Schnittger S., Kern W., Schoch C. Haematologica 91:817-820(2006) [PubMed: 16769584] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH JAK2. |
| [19] | "Inhibition of centrosome protein assembly leads to p53-dependent exit from the cell cycle." Srsen V., Gnadt N., Dammermann A., Merdes A. J. Cell Biol. 174:625-630(2006) [PubMed: 16943179] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [20] | "A t(8;9) translocation with PCM1-JAK2 fusion in a patient with T-cell lymphoma." Adelaide J., Perot C., Gelsi-Boyer V., Pautas C., Murati A., Copie-Bergman C., Imbert M., Chaffanet M., Birnbaum D., Mozziconacci M.-J. Leukemia 20:536-537(2006) [PubMed: 16424865] [Abstract] Cited for: TISSUE SPECIFICITY, CHROMOSOMAL TRANSLOCATION WITH JAK2. |
| [21] | "Nudel contributes to microtubule anchoring at the mother centriole and is involved in both dynein-dependent and -independent centrosomal protein assembly." Guo J., Yang Z., Song W., Chen Q., Wang F., Zhang Q., Zhu X. Mol. Biol. Cell 17:680-689(2006) [PubMed: 16291865] [Abstract] Cited for: INTERACTION WITH NDE1 AND NDEL1, SUBCELLULAR LOCATION. |
| [22] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-68; SER-69 AND THR-877, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [23] | "Phosphoproteome analysis of the human mitotic spindle." Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R. Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006) [PubMed: 16565220] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-69 AND SER-991, MASS SPECTROMETRY. Tissue: Cervix adenocarcinoma. |
| [24] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-356, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [25] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-372, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [26] | "Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column." Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y. Anal. Sci. 24:161-166(2008) [PubMed: 18187866] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [27] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-68; SER-69; SER-93; SER-110; SER-960; SER-1231; SER-1257; SER-1260; SER-1262; SER-1730; SER-1765; SER-1768 AND SER-1776, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [28] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-61; SER-65; SER-68; SER-69; SER-110; SER-159; SER-861; SER-872; SER-1185; SER-1187; SER-1188; SER-1765; SER-1768; SER-1776 AND SER-2023, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [29] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-68; SER-69; SER-93; SER-110; SER-116; SER-119; SER-1185; SER-1257; SER-1373; SER-1697; SER-1765; SER-1768; SER-1776 AND SER-1977, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [30] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-399, MASS SPECTROMETRY. |
| [31] | "Control of ciliogenesis by FOR20, a novel centrosome and pericentriolar satellite protein." Sedjai F., Acquaviva C., Chevrier V., Chauvin J.P., Coppin E., Aouane A., Coulier F., Tolun A., Pierres M., Birnbaum D., Rosnet O. J. Cell Sci. 123:2391-2401(2010) [PubMed: 20551181] [Abstract] Cited for: FUNCTION. |
| [32] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L27841 mRNA. Translation: AAA60120.1. AC087273 Genomic DNA. No translation available. AC087625 Genomic DNA. No translation available. BC000453 mRNA. Translation: AAH00453.1. BC027477 mRNA. Translation: AAH27477.1. Sequence problems. BC065022 mRNA. Translation: AAH65022.1. Sequence problems. AK091406 mRNA. Translation: BAC03656.1. Different initiation. AJ297349 mRNA. Translation: CAC14882.1. Sequence problems. |
| IPI | IPI00006213. IPI00795923. IPI01012680. |
| PIR | A54103. |
| RefSeq | NP_006188.3. NM_006197.3. |
| UniGene | Hs.491148. |
3D structure databases | |
| ProteinModelPortal | Q15154. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q15154. 28 interactions. |
| MINT | MINT-3295236. |
| STRING | Q15154. |
PTM databases | |
| PhosphoSite | Q15154. |
Polymorphism databases | |
| DMDM | 296439495. |
Proteomic databases | |
| PRIDE | Q15154. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000325083; ENSP00000327077; ENSG00000078674. |
| GeneID | 5108. |
| KEGG | hsa:5108. |
| UCSC | uc003wyg.2. human. uc003wyi.2. human. |
Organism-specific databases | |
| CTD | 5108. |
| GeneCards | GC08P017824. |
| H-InvDB | HIX0007341. |
| HGNC | HGNC:8727. PCM1. |
| HPA | HPA023370. HPA023374. |
| MIM | 188550. phenotype. 600299. gene. |
| neXtProt | NX_Q15154. |
| Orphanet | 146. Papillary or follicular thyroid carcinoma. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10245. |
| GeneTree | ENSGT00390000006641. |
| HOGENOM | HBG444975. |
| HOVERGEN | HBG053890. |
Enzyme and pathway databases | |
| Reactome | REACT_152. Cell Cycle, Mitotic. |
Gene expression databases | |
| ArrayExpress | Q15154. |
| Bgee | Q15154. |
| CleanEx | HS_PCM1. |
| Genevestigator | Q15154. |
Family and domain databases | |
| InterPro | IPR024138. Pericentriolar_Pcm1. [Graphical view] |
| PANTHER | PTHR14164. PTHR14164. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 19712. |
| SOURCE | Search... |
Entry information
| Entry name | PCM1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15154 Secondary accession number(s): Q58F13 Q9H4A2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with