Reviewed,
UniProtKB/Swiss-Prot Q15149 (PLEC1_HUMAN)
Last modified
November 3, 2009.
Version 114.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Plectin-1 Short name=PLTN Short name=PCN Alternative name(s): Hemidesmosomal protein 1 Short name=HD1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 4684 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Interlinks intermediate filaments with microtubules and microfilaments and anchors intermediate filaments to desmosomes or hemidesmosomes. Could also bind muscle proteins such as actin to membrane complexes in muscle. May be involved not only in the cross-linking and stabilization of cytoskeletal intermediate filaments network, but also in the regulation of their dynamics. |
| Subunit structure | Homodimer or homotetramer. Interacts with Nesprin-3 By similarity. |
| Subcellular location | |
| Tissue specificity | Widely expressed with highest levels in muscle, heart, placenta and spinal cord. |
| Domain | The N-terminus interacts with actin, the C-terminus with vimentin, desmin, GFAP, cytokeratins, lamin B; whereas both the N- and the C-terminus can bind integrin beta-4. |
| Post-translational modification | Phosphorylated by CDC2; regulates dissociation from intermediate filaments during mitosis By similarity. Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Involvement in disease | Defects in PLEC1 are the cause of epidermolysis bullosa simplex with pyloric atresia (EBS-PA) [MIM:612138]. EBS-PA is an autosomal recessive genodermatosis characterized by severe skin blistering at birth and congenital pyloric atresia. Death usually occurs in infancy. This disorder is allelic to MD-EBS. Ref.2 Ref.28 Defects in PLEC1 are the cause of epidermolysis bullosa simplex with muscular dystrophy (MD-EBS) [MIM:226670]. MD-EBS is an autosomal recessive disorder characterized by epidermal blister formation at the level of the hemidesmosome and associated with late-onset muscular dystrophy. Defects in PLEC1 are the cause of epidermolysis bullosa simplex Ogna type (O-EBS) [MIM:131950]; also called epidermolysis bullosa simplex 1. O-EBS is a form of intraepidermal epidermolysis bullosa characterized by generalized skin bruising, skin fragility with non-scarring blistering and small hemorrhagic blisters on hands. At the ultrastructural level, it is differentiated from classical cases of K-EBS, WC-EBS and DM-EBS, by the occurrence of blisters originating in basal cells above hemidesmosomes, and abnormal hemidesmosome intracellular attachment plates. |
| Sequence similarities | Belongs to the plakin or cytolinker family. Contains 1 actin-binding domain. Contains 2 CH (calponin-homology) domains. Contains 33 plectin repeats. Contains 4 spectrin repeats. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Epidermolysis bullosa |
| Domain | Coiled coil Repeat |
| Ligand | Actin-binding |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing |
| Gene Ontology (GO) | |
| Cellular component | cytoskeleton Inferred from electronic annotation. Source: UniProtKB-SubCell cytosolInferred from Experiment. Source: Reactome plasma membrane Ref.1Non-traceable author statement. Source: ProtInc |
| Molecular function | actin binding Inferred from electronic annotation. Source: UniProtKB-KW structural constituent of muscleTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15149-1) Also known as: Plectin-6; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15149-2) Also known as: Plectin-1; The sequence of this isoform differs from the canonical sequence as follows: 1-174: MVAGMLMPRD...RPGPEPAPAT → MSGEDAEVRA...PAERAVIRIA | ||||||
| Isoform 3 (identifier: Q15149-3) The sequence of this isoform differs from the canonical sequence as follows: 1-174: MVAGMLMPRD...RPGPEPAPAT → MSGEDAEVRA...PAERAVIRIA 409-412: Missing. | ||||||
| Isoform 4 (identifier: Q15149-4) Also known as: Plectin-11; The sequence of this isoform differs from the canonical sequence as follows: 1-174: MVAGMLMPRD...RPGPEPAPAT → MSQHQLRVPQ...AVLRASEGKK | ||||||
| Note: Phosphorylated on Ser-21 and Tyr-26. | ||||||
| Isoform 5 (identifier: Q15149-5) Also known as: Plectin-8; The sequence of this isoform differs from the canonical sequence as follows: 1-137: Missing. 138-174: RVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPAT → MEPSGSLFPSLVVVGHVVTLAAVWHWRRGRRWAQDEQ | ||||||
| Isoform 6 (identifier: Q15149-6) Also known as: Plectin-10; The sequence of this isoform differs from the canonical sequence as follows: 1-133: Missing. 134-174: TEEQRVYRRK...RPGPEPAPAT → MSGAGGAFAS...GYLYQQLCCV | ||||||
| Isoform 7 (identifier: Q15149-7) Also known as: Plectin-7; The sequence of this isoform differs from the canonical sequence as follows: 1-169: Missing. 170-174: PAPAT → MKIVP | ||||||
| Isoform 8 (identifier: Q15149-8) Also known as: Plectin-3; The sequence of this isoform differs from the canonical sequence as follows: 1-159: Missing. 160-174: QRTLARPGPEPAPAT → MDPSRAIQNEISSLK | ||||||
| Isoform 9 (identifier: Q15149-9) Also known as: Plectin-2; The sequence of this isoform differs from the canonical sequence as follows: 1-151: Missing. 152-174: TPVVPATTQRTLARPGPEPAPAT → MAGPLPDEQDFIQAYEEVREKYK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 4684 | 4684 | Plectin-1 | PRO_0000078135 | |||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 175 – 400 | 226 | Actin-binding | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 179 – 282 | 104 | CH 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 295 – 397 | 103 | CH 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 645 – 710 | 66 | Spectrin 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 740 – 824 | 85 | Spectrin 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 837 – 930 | 94 | Spectrin 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 1315 – 1415 | 101 | Spectrin 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2826 – 2863 | 38 | Plectin 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2864 – 2901 | 38 | Plectin 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2902 – 2939 | 38 | Plectin 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2940 – 2977 | 38 | Plectin 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2981 – 3015 | 35 | Plectin 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3116 – 3153 | 38 | Plectin 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3154 – 3191 | 38 | Plectin 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3192 – 3229 | 38 | Plectin 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3230 – 3267 | 38 | Plectin 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3268 – 3305 | 38 | Plectin 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3306 – 3343 | 38 | Plectin 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3485 – 3522 | 38 | Plectin 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3523 – 3560 | 38 | Plectin 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3561 – 3598 | 38 | Plectin 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3599 – 3636 | 38 | Plectin 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3640 – 3674 | 35 | Plectin 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3820 – 3857 | 38 | Plectin 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3858 – 3895 | 38 | Plectin 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3896 – 3933 | 38 | Plectin 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3934 – 3971 | 38 | Plectin 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3975 – 4008 | 34 | Plectin 21 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4063 – 4100 | 38 | Plectin 22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4101 – 4138 | 38 | Plectin 23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4139 – 4176 | 38 | Plectin 24 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4177 – 4214 | 38 | Plectin 25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4218 – 4252 | 35 | Plectin 26 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4265 – 4305 | 41 | Plectin 27 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4319 – 4356 | 38 | Plectin 28 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4408 – 4445 | 38 | Plectin 29 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4446 – 4483 | 38 | Plectin 30 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4484 – 4521 | 38 | Plectin 31 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4522 – 4559 | 38 | Plectin 32 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4560 – 4597 | 38 | Plectin 33 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 1470 | 1470 | Globular 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1471 – 2755 | 1285 | Central fibrous rod domain | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 2756 – 4684 | 1929 | Globular 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 4250 – 4300 | 51 | Binding to intermediate filaments By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 4625 – 4640 | 16 | 4 X 4 AA tandem repeats of G-S-R-X | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 1469 – 2756 | 1288 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 125 | 1 | Phosphoserine Ref.11 Ref.18 Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 149 | 1 | Phosphoserine Ref.11 Ref.19 Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 187 | 1 | N6-acetyllysine Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 201 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 720 | 1 | Phosphoserine Ref.11 Ref.18 Ref.19 Ref.16 Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 782 | 1 | Phosphoserine Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1435 | 1 | Phosphoserine Ref.11 Ref.18 Ref.19 Ref.16 Ref.6 Ref.12 Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1644 | 1 | Phosphoserine Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1721 | 1 | Phosphoserine Ref.11 Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1732 | 1 | Phosphoserine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2516 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2755 | 1 | Phosphoserine Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2814 | 1 | Phosphothreonine Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2841 | 1 | N6-acetyllysine Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 3033 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 3091 | 1 | N6-acetyllysine Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 3362 | 1 | Phosphotyrosine Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 3420 | 1 | N6-acetyllysine Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4030 | 1 | Phosphothreonine Ref.11 Ref.19 Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4155 | 1 | Phosphotyrosine Ref.13 Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4382 | 1 | Phosphoserine Ref.11 Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4384 | 1 | Phosphoserine Ref.11 Ref.19 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4385 | 1 | Phosphoserine Ref.11 Ref.19 Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4386 | 1 | Phosphoserine Ref.11 Ref.19 Ref.6 Ref.7 Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4389 | 1 | Phosphoserine Ref.19 Ref.16 Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4390 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4391 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4392 | 1 | Phosphoserine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4393 | 1 | Phosphotyrosine Ref.19 Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4396 | 1 | Phosphoserine Ref.19 Ref.16 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4402 | 1 | Phosphothreonine Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4411 | 1 | Phosphothreonine Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4539 | 1 | Phosphothreonine; by CDC2 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4611 | 1 | Phosphotyrosine Ref.21 Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4613 | 1 | Phosphoserine Ref.19 Ref.16 Ref.6 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4615 | 1 | Phosphotyrosine Ref.21 Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4620 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4622 | 1 | Phosphoserine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4623 | 1 | Phosphothreonine Ref.19 Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4626 | 1 | Phosphoserine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4628 | 1 | Phosphothreonine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4642 | 1 | Phosphoserine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4658 | 1 | Phosphoserine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4675 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 174 | 174 | MVAGM…PAPAT → MSGEDAEVRAVSEDVSNGSS GSPSPGDTLPWNLGKTQRSR RSGGGAGSNGSVLDPAERAV IRIA in isoform 2 and isoform 3. | VSP_005030 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 174 | 174 | MVAGM…PAPAT → MSQHQLRVPQPEGLGRKRTS SEDNLYLAVLRASEGKK in isoform 4. | VSP_023510 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 169 | 169 | Missing in isoform 7. | VSP_037100 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 159 | 159 | Missing in isoform 8. | VSP_037101 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 151 | 151 | Missing in isoform 9. | VSP_037102 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 137 | 137 | Missing in isoform 5. | VSP_037103 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 133 | 133 | Missing in isoform 6. | VSP_037104 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 134 – 174 | 41 | TEEQR…PAPAT → MSGAGGAFASPREVLLERPC WLDGGCEPARRGYLYQQLCC V in isoform 6. | VSP_037105 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 138 – 174 | 37 | RVYRR…PAPAT → MEPSGSLFPSLVVVGHVVTL AAVWHWRRGRRWAQDEQ in isoform 5. | VSP_037106 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 152 – 174 | 23 | TPVVP…PAPAT → MAGPLPDEQDFIQAYEEVRE KYK in isoform 9. | VSP_037107 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 160 – 174 | 15 | QRTLA…PAPAT → MDPSRAIQNEISSLK in isoform 8. | VSP_037108 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 170 – 174 | 5 | PAPAT → MKIVP in isoform 7. | VSP_037109 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 409 – 412 | 4 | Missing in isoform 3. | VSP_005031 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 429 | 1 | L → LL in MD-EBS. Ref.26 | VAR_011336 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 641 | 1 | A → V: dbSNP rs11136336. | VAR_053585 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1003 – 1005 | 3 | Missing in MD-EBS. | VAR_011337 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1321 | 1 | L → V: dbSNP rs3135109. Ref.2 | VAR_060088 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1386 | 1 | R → Q: dbSNP rs11136334. | VAR_060089 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2110 | 1 | R → W in O-EBS. Ref.27 | VAR_015817 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2150 | 1 | R → W: dbSNP rs34893635. | VAR_053586 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2194 | 1 | A → V: dbSNP rs7002002. | VAR_053587 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2791 | 1 | S → P: dbSNP rs7833924. | VAR_053588 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2821 | 1 | R → W: dbSNP rs35723243. | VAR_053589 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2969 | 1 | R → H: dbSNP rs6558407. | VAR_053590 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3162 | 1 | V → I: dbSNP rs35027700. | VAR_053591 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3171 | 1 | A → V: dbSNP rs35858667. | VAR_053592 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3486 | 1 | T → M: dbSNP rs34725742. | VAR_053593 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3490 | 1 | G → A: dbSNP rs35261863. | VAR_053594 | |||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 71 | 1 | Y → F in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 94 | 1 | P → A in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 139 | 1 | V → L in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 185 | 1 | F → S in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 259 | 1 | N → D in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 259 | 1 | N → D in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 550 | 1 | N → H in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 560 | 1 | V → I in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 706 | 1 | R → Q in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 886 | 1 | Y → N in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1002 | 1 | A → V in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1309 | 1 | V → L in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1309 | 1 | V → L in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1334 | 1 | V → L in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1334 | 1 | V → L in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1534 | 1 | M → I in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1662 | 1 | A → T in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1662 | 1 | A → T in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1688 – 1690 | 3 | RLR → WLC in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1767 | 1 | E → Q in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1789 | 1 | A → L in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1910 | 1 | R → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in CAA65765. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAR95680. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAR95682. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAR95683. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2160 | 1 | R → S in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2215 | 1 | Q → R in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2244 | 1 | S → A in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2244 | 1 | S → A in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2244 | 1 | S → A in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2244 | 1 | S → A in CAA65765. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3027 | 1 | K → E in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3027 | 1 | K → E in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3310 | 1 | A → E in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3361 | 1 | L → F in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3408 | 1 | L → F in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3447 | 1 | A → S in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3531 | 1 | A → G in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3580 | 1 | S → R in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3589 | 1 | Q → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3596 | 1 | Q → E in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3616 | 1 | H → N in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3686 | 1 | A → V in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3786 | 1 | A → G in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3808 | 1 | R → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3816 | 1 | A → G in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3821 | 1 | C → F in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3915 | 1 | Q → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3999 | 1 | R → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4007 | 1 | T → S in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4467 | 1 | F → L in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 175 – 193 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 203 – 209 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 211 – 221 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 249 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 259 – 263 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 267 – 282 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 297 – 308 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 309 – 311 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 322 – 324 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 328 – 337 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 339 – 341 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 344 – 347 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 352 – 367 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 375 – 378 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 380 – 382 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 385 – 398 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 414 – 440 | 27 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 448 – 463 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 466 – 489 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 490 – 492 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 500 – 564 | 65 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 572 – 598 | 27 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 604 – 629 | 26 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human plectin: organization of the gene, sequence analysis, and chromosome localization (8q24)." Liu C.-G., Maercker C., Castanon M.J., Hauptmann R., Wiche G. Proc. Natl. Acad. Sci. U.S.A. 93:4278-4283(1996) [PubMed: 8633055] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Placenta. |
| [2] | "Loss of plectin causes epidermolysis bullosa with muscular dystrophy: cDNA cloning and genomic organization." McLean W.H.I., Pulkkinen L., Smith F.J.D., Rugg E.L., Lane E.B., Bullrich F., Burgeson R.E., Amano S., Hudson D.L., Owaribe K., McGrath J.A., McMillan J.R., Eady R.A.J., Leigh I.M., Christiano A.M., Uitto J. Genes Dev. 10:1724-1735(1996) [PubMed: 8698233] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 2 AND 3), DISEASE, VARIANT VAL-1321. |
| [3] | "Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation." Zhang T., Haws P., Wu Q. Genome Res. 14:79-89(2004) [PubMed: 14672974] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4; 5; 6; 7; 8 AND 9). |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Bienvenut W.V., Lilla S., von Kriegsheim A., Lempens A., Kolch W. Submitted (DEC-2008) to UniProtKB Cited for: PROTEIN SEQUENCE OF 14-21; 209-227; 237-248; 301-316; 329-336; 350-365; 372-417; 510-517; 588-597; 631-675; 697-706; 714-724; 734-740; 751-764; 857-869; 897-908; 927-934; 1029-1037; 1045-1052; 1076-1088; 1131-1139; 1166-1175; 1187-1210; 1216-1224; 1227-1243; 1251-1266; 1274-1291; 1318-1335; 1338-1344; 1351-1364; 1366-1382; 1411-1438; 1473-1479; 1499-1508; 1554-1563; 1596-1603; 1606-1616; 1628-1638; 1649-1657; 1671-1679; 1699-1709; 1732-1744; 1783-1792; 1825-1833; 1846-1854; 1867-1875; 1888-1908; 1976-1994; 2006-2014; 2048-2055; 2058-2068; 2079-2087; 2098-2108; 2130-2139; 2142-2150; 2172-2182; 2199-2217; 2310-2316; 2319-2329; 2340-2348; 2361-2379; 2402-2409; 2420-2429; 2432-2442; 2462-2473; 2483-2503; 2512-2521; 2565-2575; 2587-2594; 2651-2663; 2685-2693; 2705-2761; 2768-2787; 2795-2821; 2833-2841; 2847-2881; 2885-2903; 2942-2968; 2979-3007; 3028-3039; 3045-3053; 3095-3106; 3109-3127; 3132-3139; 3146-3154; 3175-3183; 3213-3231; 3244-3259; 3270-3285; 3289-3297; 3317-3335; 3356-3368; 3374-3384; 3424-3436; 3447-3469; 3477-3485; 3506-3513; 3519-3540; 3544-3568; 3601-3637; 3648-3661; 3667-3676; 3686-3702; 3739-3749; 3771-3781; 3784-3804; 3839-3878; 3887-3897; 3926-3963; 3969-3999; 4004-4018; 4027-4060; 4084-4091; 4122-4138; 4159-4167; 4179-4205; 4278-4296; 4339-4348; 4354-4360; 4384-4401; 4429-4447; 4467-4475; 4492-4500; 4543-4551; 4590-4627 AND 4668-4684, PHOSPHORYLATION AT SER-4385, MASS SPECTROMETRY. Tissue: Ovarian carcinoma. |
| [6] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-720; SER-1435; SER-4386; THR-4402; SER-4613 AND THR-4623, MASS SPECTROMETRY. Tissue: Epithelium. |
| [7] | "Global phosphoproteome of HT-29 human colon adenocarcinoma cells." Kim J.-E., Tannenbaum S.R., White F.M. J. Proteome Res. 4:1339-1346(2005) [PubMed: 16083285] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1721; SER-4386 AND SER-4389, MASS SPECTROMETRY. |
| [8] | "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J., Lauffenburger D.A., White F.M. Mol. Cell. Proteomics 4:1240-1250(2005) [PubMed: 15951569] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-4611, MASS SPECTROMETRY. Tissue: Epithelium. |
| [9] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-4615, MASS SPECTROMETRY. |
| [10] | "Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC." Gevaert K., Staes A., Van Damme J., De Groot S., Hugelier K., Demol H., Martens L., Goethals M., Vandekerckhove J. Proteomics 5:3589-3599(2005) [PubMed: 16097034] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-782, MASS SPECTROMETRY. Tissue: Hepatocyte. |
| [11] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125; SER-149; SER-720; SER-1435; SER-1721; THR-2814; THR-4030; SER-4382; SER-4384; SER-4385; SER-4386; THR-4411 AND SER-4620, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21 (ISOFORM 4), MASS SPECTROMETRY. Tissue: Epithelium. |
| [12] | "Phosphoproteome analysis of the human mitotic spindle." Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R. Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006) [PubMed: 16565220] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1435; SER-4384; SER-4396; SER-4613 AND SER-4620, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21 (ISOFORM 4), MASS SPECTROMETRY. Tissue: Epithelium. |
| [13] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-3362 AND TYR-4155, MASS SPECTROMETRY. |
| [14] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1435, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21 (ISOFORM 4), MASS SPECTROMETRY. Tissue: Epithelium. |
| [15] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1644 AND SER-2755, MASS SPECTROMETRY. |
| [16] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-149; SER-720; SER-1435; SER-2516; THR-4030; SER-4389; SER-4396; SER-4613 AND SER-4675, MASS SPECTROMETRY. |
| [17] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4386, MASS SPECTROMETRY. |
| [18] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125; SER-720 AND SER-1435, MASS SPECTROMETRY. |
| [19] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125; SER-149; SER-720; SER-1435; SER-1732; THR-4030; SER-4382; SER-4384; SER-4385; SER-4386; SER-4389; SER-4392; TYR-4393; SER-4396; SER-4613; SER-4622; THR-4623; SER-4626; THR-4628; SER-4642 AND SER-4658, MASS SPECTROMETRY. |
| [20] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [21] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-26; (ISOFORM 4) TYR-4155; TYR-4393; TYR-4611 AND TYR-4615, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [22] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-187; LYS-2841; LYS-3091 AND LYS-3420, MASS SPECTROMETRY. |
| [23] | "The structure of a tandem pair of spectrin repeats of plectin reveals a modular organization of the plakin domain." Sonnenberg A., Rojas A.M., de Pereda J.M. J. Mol. Biol. 368:1379-1391(2007) [PubMed: 17397861] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.05 ANGSTROMS) OF 409-640. |
| [24] | "Structural and functional analysis of the actin binding domain of plectin suggests alternative mechanisms for binding to F-actin and integrin beta4." Garcia-Alvarez B., Bobkov A., Sonnenberg A., de Pereda J.M. Structure 11:615-625(2003) [PubMed: 12791251] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 159-403. |
| [25] | "Homozygous deletion mutations in the plectin gene (PLEC1) in patients with epidermolysis bullosa simplex associated with late-onset muscular dystrophy." Pulkkinen L., Smith F.J.D., Shimizu H., Murata S., Yaoita H., Hachisuka H., Nishikawa T., McLean W.H.I., Uitto J. Hum. Mol. Genet. 5:1539-1546(1996) [PubMed: 8894687] [Abstract] Cited for: VARIANT MD-EBS 1003-GLN--ALA-1005 DEL. |
| [26] | "A compound heterozygous one amino-acid insertion/nonsense mutation in the plectin gene causes epidermolysis bullosa simplex with plectin deficiency." Bauer J.W., Rouan F., Kofler B., Rezniczek G.A., Kornacker I., Muss W., Hametner R., Klausegger A., Huber A., Pohla-Gubo G., Wiche G., Uitto J., Hintner H. Am. J. Pathol. 158:617-625(2001) [PubMed: 11159198] [Abstract] Cited for: VARIANT MD-EBS LEU-429 INS. |
| [27] | "A site-specific plectin mutation causes dominant epidermolysis bullosa simplex Ogna: two identical de novo mutations." Koss-Harnes D., Hoeyheim B., Anton-Lamprecht I., Gjesti A., Joergensen R.S., Jahnsen F.L., Olaisen B., Wiche G., Gedde-Dahl T. Jr. J. Invest. Dermatol. 118:87-93(2002) [PubMed: 11851880] [Abstract] Cited for: VARIANT O-EBS TRP-2110. |
| [28] | "Identification of a lethal form of epidermolysis bullosa simplex associated with a homozygous genetic mutation in plectin." Charlesworth A., Gagnoux-Palacios L., Bonduelle M., Ortonne J.-P., De Raeve L., Meneguzzi G. J. Invest. Dermatol. 121:1344-1348(2003) [PubMed: 14675180] [Abstract] Cited for: INVOLVEMENT IN EBS-PA. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Z54367 Genomic DNA. Translation: CAA91196.1. U53204 mRNA. Translation: AAB05427.1. U63610, U63609 Genomic DNA. Translation: AAB05428.1. X97053 mRNA. Translation: CAA65765.1. AY480044 mRNA. Translation: AAR95677.1. AY480045 mRNA. Translation: AAR95678.1. AY480046 mRNA. Translation: AAR95679.1. AY480047 mRNA. Translation: AAR95680.1. AY480048 mRNA. Translation: AAR95681.1. AY480049 mRNA. Translation: AAR95682.1. AY480050 mRNA. Translation: AAR95683.1. AY480051 mRNA. Translation: AAR95684.1. AC109322 Genomic DNA. No translation available. | |||||||||||||||||||||||||||||||
| IPI | IPI00014898. IPI00186711. IPI00398002. IPI00398775. IPI00398776. IPI00398777. IPI00398778. IPI00398779. IPI00420096. | ||||||||||||||||||||||||||||||
| PIR | A59404. C59404. G02520. | ||||||||||||||||||||||||||||||
| RefSeq | NP_000436.2. NP_958780.1. NP_958781.1. NP_958782.1. NP_958783.1. NP_958784.1. NP_958785.1. NP_958786.1. | ||||||||||||||||||||||||||||||
| UniGene | Hs.434248 | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| IntAct | Q15149. 3 interactions. | ||||||||||||||||||||||||||||||
| STRING | Q15149. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q15149. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | Q15149. | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000322810; ENSP00000323856; ENSG00000178209; Homo sapiens. [Genome view] ENST00000345136; ENSP00000344848; ENSG00000178209; Homo sapiens. [Genome view] ENST00000354589; ENSP00000346602; ENSG00000178209; Homo sapiens. [Genome view] ENST00000354958; ENSP00000347044; ENSG00000178209; Homo sapiens. [Genome view] ENST00000356346; ENSP00000348702; ENSG00000178209; Homo sapiens. [Genome view] ENST00000357316; ENSP00000349868; ENSG00000178209; Homo sapiens. [Genome view] ENST00000357649; ENSP00000350277; ENSG00000178209; Homo sapiens. [Genome view] ENST00000398774; ENSP00000381756; ENSG00000178209; Homo sapiens. [Genome view] ENST00000436759; ENSP00000388180; ENSG00000178209; Homo sapiens. [Genome view] | ||||||||||||||||||||||||||||||
| GeneID | 5339. | ||||||||||||||||||||||||||||||
| KEGG | hsa:5339. | ||||||||||||||||||||||||||||||
| UCSC | uc003zab.1. human. uc003zac.1. human. uc003zad.1. human. uc003zae.1. human. uc003zaf.1. human. uc003zag.1. human. uc003zah.1. human. uc003zai.1. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 5339. | ||||||||||||||||||||||||||||||
| GeneCards | GC08M145061. GC08M145062. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0055497. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:9069. PLEC1. | ||||||||||||||||||||||||||||||
| HPA | CAB003847. | ||||||||||||||||||||||||||||||
| MIM | 131950. phenotype. 226670. phenotype. 601282. gene. 612138. phenotype. | ||||||||||||||||||||||||||||||
| Orphanet | 257. Epidermolysis bullosa simplex - limb girdle muscular dystrophy. 158684. Epidermolysis bullosa simplex - pyloric atresia. 79401. Epidermolysis bullosa simplex, Ogna type. 304. Epidermolysis bullosa, epidermolytic. | ||||||||||||||||||||||||||||||
| PharmGKB | PA33399. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| HOGENOM | Q15149. | ||||||||||||||||||||||||||||||
| HOVERGEN | Q15149. | ||||||||||||||||||||||||||||||
| OMA | DVFEKAT. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q15149. | ||||||||||||||||||||||||||||||
| Bgee | Q15149. | ||||||||||||||||||||||||||||||
| CleanEx | HS_PLEC1. | ||||||||||||||||||||||||||||||
| Genevestigator | Q15149. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000178209. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR001589. Actinin_actin-bd_CS. IPR001715. Calponin_act_bd. IPR015622. Plectin. IPR001101. Plectin_repeat. IPR005326. S10_plectin_N. IPR018159. Spectrin/alpha-actinin. [Graphical view] | ||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.418.10. Calponin-homology. 2 hits. | ||||||||||||||||||||||||||||||
| PANTHER | PTHR11915:SF52. Plectin. 1 hit. | ||||||||||||||||||||||||||||||
| Pfam | PF00307. CH. 2 hits. PF00681. Plectin. 17 hits. PF03501. S10_plectin. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProDom | PD006662. S10_plectin_N. 1 hit. [Graphical view] [Entries sharing at least one domain] | ||||||||||||||||||||||||||||||
| SMART | SM00033. CH. 2 hits. SM00250. PLEC. 32 hits. SM00150. SPEC. 7 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| PROSITE | PS00019. ACTININ_1. 1 hit. PS00020. ACTININ_2. 1 hit. PS50021. CH. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||
| NextBio | 20680. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | PLEC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15149 Secondary accession number(s): Q15148 Q6S383 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


