Q15149 (PLEC_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 16, 2012.
Version 145.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Plectin Short name=PCN Short name=PLTN Alternative name(s): Hemidesmosomal protein 1 Short name=HD1 Plectin-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 4684 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Interlinks intermediate filaments with microtubules and microfilaments and anchors intermediate filaments to desmosomes or hemidesmosomes. Could also bind muscle proteins such as actin to membrane complexes in muscle. May be involved not only in the filaments network, but also in the regulation of their dynamics. Structural component of muscle. Isoform 9 plays a major role in the maintenance of myofibers integrity. Ref.6 Ref.26 |
| Subunit structure | Homodimer or homotetramer. Interacts (via actin-binding domain) with Nesprin-3. Interacts (via CH 1 domain) with VIM (via rod region) By similarity. Interacts with COL17A1 (via N-terminus). Interacts (via N-terminus) with DST isoform 1 (via N-terminus). Ref.6 Ref.27 |
| Subcellular location | Cytoplasm › cytoskeleton. Cell junction › hemidesmosome Ref.6. |
| Tissue specificity | Widely expressed with highest levels in muscle, heart, placenta and spinal cord. |
| Domain | The N-terminus interacts with actin, the C-terminus with vimentin, desmin, GFAP, cytokeratins, lamin B; whereas both the N- and the C-terminus can bind integrin beta-4. |
| Post-translational modification | Phosphorylated by CDK1; regulates dissociation from intermediate filaments during mitosis By similarity. Phosphorylated upon DNA damage, probably by ATM or ATR. Ref.5 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 Ref.21 Ref.22 Ref.23 Ref.24 |
| Involvement in disease | Defects in PLEC are the cause of epidermolysis bullosa simplex with pyloric atresia (EBS-PA) [MIM:612138]. EBS-PA is an autosomal recessive genodermatosis characterized by severe skin blistering at birth and congenital pyloric atresia. Death usually occurs in infancy. This disorder is allelic to MD-EBS. Ref.2 Ref.28 Ref.35 Defects in PLEC are the cause of epidermolysis bullosa simplex with muscular dystrophy (MD-EBS) [MIM:226670]. MD-EBS is an autosomal recessive disorder characterized by epidermal blister formation at the level of the hemidesmosome and associated with late-onset muscular dystrophy. Defects in PLEC are the cause of epidermolysis bullosa simplex Ogna type (O-EBS) [MIM:131950]; also called epidermolysis bullosa simplex 1. O-EBS is a form of intraepidermal epidermolysis bullosa characterized by generalized skin bruising, skin fragility with non-scarring blistering and small hemorrhagic blisters on hands. At the ultrastructural level, it is differentiated from classical cases of K-EBS, WC-EBS and DM-EBS, by the occurrence of blisters originating in basal cells above hemidesmosomes, and abnormal hemidesmosome intracellular attachment plates. Defects in PLEC are the cause of limb-girdle muscular dystrophy type 2Q (LGMD2Q) [MIM:613723]. An autosomal recessive degenerative myopathy characterized by early childhood onset of proximal muscle weakness. Note=A 9 bp deletion containing the initiation codon in exon 1f of PLEC have been found in limb-girdle muscular dystrophy patients. The mutation results in deficient expression of isoform 9 and disorganization of the myofibers, without any effect on the skin. Ref.2 Ref.26 |
| Sequence similarities | Belongs to the plakin or cytolinker family. Contains 1 actin-binding domain. Contains 2 CH (calponin-homology) domains. Contains 33 plectin repeats. Contains 4 spectrin repeats. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15149-1) Also known as: Plectin-6; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15149-2) Also known as: Plectin-1; 1c; The sequence of this isoform differs from the canonical sequence as follows: 1-174: MVAGMLMPRD...RPGPEPAPAT → MSGEDAEVRA...PAERAVIRIA | ||||||
| Isoform 3 (identifier: Q15149-3) The sequence of this isoform differs from the canonical sequence as follows: 1-174: MVAGMLMPRD...RPGPEPAPAT → MSGEDAEVRA...PAERAVIRIA 409-412: Missing. | ||||||
| Isoform 4 (identifier: Q15149-4) Also known as: Plectin-11; 1a; The sequence of this isoform differs from the canonical sequence as follows: 1-174: MVAGMLMPRD...RPGPEPAPAT → MSQHQLRVPQ...AVLRASEGKK | ||||||
| Note: Phosphorylated on Ser-21 and Tyr-26. | ||||||
| Isoform 5 (identifier: Q15149-5) Also known as: Plectin-8; 1b; The sequence of this isoform differs from the canonical sequence as follows: 1-137: Missing. 138-174: RVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPAT → MEPSGSLFPSLVVVGHVVTLAAVWHWRRGRRWAQDEQ | ||||||
| Isoform 6 (identifier: Q15149-6) Also known as: Plectin-10; 1g; The sequence of this isoform differs from the canonical sequence as follows: 1-133: Missing. 134-174: TEEQRVYRRK...RPGPEPAPAT → MSGAGGAFAS...GYLYQQLCCV | ||||||
| Isoform 7 (identifier: Q15149-7) Also known as: Plectin-7; 1d; The sequence of this isoform differs from the canonical sequence as follows: 1-169: Missing. 170-174: PAPAT → MKIVP | ||||||
| Isoform 8 (identifier: Q15149-8) Also known as: Plectin-3; 1e; The sequence of this isoform differs from the canonical sequence as follows: 1-159: Missing. 160-174: QRTLARPGPEPAPAT → MDPSRAIQNEISSLK | ||||||
| Isoform 9 (identifier: Q15149-9) Also known as: Plectin-2; 1f; The sequence of this isoform differs from the canonical sequence as follows: 1-151: Missing. 152-174: TPVVPATTQRTLARPGPEPAPAT → MAGPLPDEQDFIQAYEEVREKYK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 4684 | 4684 | Plectin | PRO_0000078135 | |||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 175 – 400 | 226 | Actin-binding | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 179 – 282 | 104 | CH 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 295 – 397 | 103 | CH 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 645 – 710 | 66 | Spectrin 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 740 – 824 | 85 | Spectrin 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 837 – 930 | 94 | Spectrin 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 1315 – 1415 | 101 | Spectrin 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2826 – 2863 | 38 | Plectin 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2864 – 2901 | 38 | Plectin 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2902 – 2939 | 38 | Plectin 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2940 – 2977 | 38 | Plectin 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 2981 – 3015 | 35 | Plectin 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3116 – 3153 | 38 | Plectin 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3154 – 3191 | 38 | Plectin 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3192 – 3229 | 38 | Plectin 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3230 – 3267 | 38 | Plectin 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3268 – 3305 | 38 | Plectin 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3306 – 3343 | 38 | Plectin 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3485 – 3522 | 38 | Plectin 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3523 – 3560 | 38 | Plectin 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3561 – 3598 | 38 | Plectin 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3599 – 3636 | 38 | Plectin 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3640 – 3674 | 35 | Plectin 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3820 – 3857 | 38 | Plectin 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3858 – 3895 | 38 | Plectin 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3896 – 3933 | 38 | Plectin 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3934 – 3971 | 38 | Plectin 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 3975 – 4008 | 34 | Plectin 21 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4063 – 4100 | 38 | Plectin 22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4101 – 4138 | 38 | Plectin 23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4139 – 4176 | 38 | Plectin 24 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4177 – 4214 | 38 | Plectin 25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4218 – 4252 | 35 | Plectin 26 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4265 – 4305 | 41 | Plectin 27 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4319 – 4356 | 38 | Plectin 28 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4408 – 4445 | 38 | Plectin 29 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4446 – 4483 | 38 | Plectin 30 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4484 – 4521 | 38 | Plectin 31 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4522 – 4559 | 38 | Plectin 32 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 4560 – 4597 | 38 | Plectin 33 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 1470 | 1470 | Globular 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1471 – 2755 | 1285 | Central fibrous rod domain | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 2756 – 4684 | 1929 | Globular 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 4250 – 4300 | 51 | Binding to intermediate filaments By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 4625 – 4640 | 16 | 4 X 4 AA tandem repeats of G-S-R-X | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 1469 – 2756 | 1288 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 125 | 1 | Phosphoserine Ref.12 Ref.19 Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 149 | 1 | Phosphoserine Ref.12 Ref.17 Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 187 | 1 | N6-acetyllysine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 201 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 720 | 1 | Phosphoserine Ref.7 Ref.12 Ref.17 Ref.19 Ref.20 Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 782 | 1 | Phosphoserine Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1435 | 1 | Phosphoserine Ref.7 Ref.12 Ref.13 Ref.15 Ref.17 Ref.19 Ref.20 Ref.21 Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1444 | 1 | Phosphoserine Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1644 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1721 | 1 | Phosphoserine Ref.8 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1732 | 1 | Phosphoserine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2516 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2755 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2814 | 1 | Phosphothreonine Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2841 | 1 | N6-acetyllysine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 3033 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 3091 | 1 | N6-acetyllysine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 3362 | 1 | Phosphotyrosine Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 3420 | 1 | N6-acetyllysine Ref.25 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4030 | 1 | Phosphothreonine Ref.12 Ref.17 Ref.20 Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4155 | 1 | Phosphotyrosine Ref.14 Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4382 | 1 | Phosphoserine Ref.12 Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4384 | 1 | Phosphoserine Ref.12 Ref.13 Ref.20 Ref.21 Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4385 | 1 | Phosphoserine Ref.5 Ref.12 Ref.20 Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4386 | 1 | Phosphoserine Ref.7 Ref.8 Ref.12 Ref.18 Ref.20 Ref.21 Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4389 | 1 | Phosphoserine Ref.8 Ref.17 Ref.20 Ref.21 Ref.23 Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4390 | 1 | Phosphoserine Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4391 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4392 | 1 | Phosphoserine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4393 | 1 | Phosphotyrosine Ref.20 Ref.21 Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4396 | 1 | Phosphoserine Ref.13 Ref.17 Ref.20 Ref.21 Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4400 | 1 | Phosphoserine Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4402 | 1 | Phosphothreonine Ref.7 Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4411 | 1 | Phosphothreonine Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4539 | 1 | Phosphothreonine; by CDK1 By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4611 | 1 | Phosphotyrosine Ref.9 Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4613 | 1 | Phosphoserine Ref.7 Ref.13 Ref.17 Ref.20 Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4615 | 1 | Phosphotyrosine Ref.10 Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4618 | 1 | Phosphoserine Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4620 | 1 | Phosphoserine Ref.12 Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4622 | 1 | Phosphoserine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4623 | 1 | Phosphothreonine Ref.7 Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4626 | 1 | Phosphoserine Ref.20 Ref.23 Ref.24 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4628 | 1 | Phosphothreonine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4642 | 1 | Phosphoserine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4658 | 1 | Phosphoserine Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 4675 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 174 | 174 | MVAGM…PAPAT → MSGEDAEVRAVSEDVSNGSS GSPSPGDTLPWNLGKTQRSR RSGGGAGSNGSVLDPAERAV IRIA in isoform 2 and isoform 3. | VSP_005030 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 174 | 174 | MVAGM…PAPAT → MSQHQLRVPQPEGLGRKRTS SEDNLYLAVLRASEGKK in isoform 4. | VSP_023510 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 169 | 169 | Missing in isoform 7. | VSP_037100 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 159 | 159 | Missing in isoform 8. | VSP_037101 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 151 | 151 | Missing in isoform 9. | VSP_037102 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 137 | 137 | Missing in isoform 5. | VSP_037103 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 133 | 133 | Missing in isoform 6. | VSP_037104 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 134 – 174 | 41 | TEEQR…PAPAT → MSGAGGAFASPREVLLERPC WLDGGCEPARRGYLYQQLCC V in isoform 6. | VSP_037105 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 138 – 174 | 37 | RVYRR…PAPAT → MEPSGSLFPSLVVVGHVVTL AAVWHWRRGRRWAQDEQ in isoform 5. | VSP_037106 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 152 – 174 | 23 | TPVVP…PAPAT → MAGPLPDEQDFIQAYEEVRE KYK in isoform 9. | VSP_037107 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 160 – 174 | 15 | QRTLA…PAPAT → MDPSRAIQNEISSLK in isoform 8. | VSP_037108 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 170 – 174 | 5 | PAPAT → MKIVP in isoform 7. | VSP_037109 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 409 – 412 | 4 | Missing in isoform 3. | VSP_005031 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 429 | 1 | L → LL in MD-EBS. Ref.33 | VAR_011336 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 641 | 1 | A → V. Corresponds to variant rs11136336 [ dbSNP | Ensembl ]. | VAR_053585 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1003 – 1005 | 3 | Missing in MD-EBS. | VAR_011337 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1321 | 1 | L → V. Ref.2 Corresponds to variant rs3135109 [ dbSNP | Ensembl ]. | VAR_060088 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1386 | 1 | R → Q. Corresponds to variant rs11136334 [ dbSNP | Ensembl ]. | VAR_060089 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1459 | 1 | H → R. Corresponds to variant rs55895668 [ dbSNP | Ensembl ]. | VAR_062133 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2110 | 1 | R → W in O-EBS. Ref.34 | VAR_015817 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2150 | 1 | R → W. Corresponds to variant rs34893635 [ dbSNP | Ensembl ]. | VAR_053586 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2194 | 1 | A → V. Corresponds to variant rs7002002 [ dbSNP | Ensembl ]. | VAR_053587 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2791 | 1 | S → P. Corresponds to variant rs7833924 [ dbSNP | Ensembl ]. | VAR_053588 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2821 | 1 | R → W. Corresponds to variant rs35723243 [ dbSNP | Ensembl ]. | VAR_053589 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2969 | 1 | R → H. Corresponds to variant rs6558407 [ dbSNP | Ensembl ]. | VAR_053590 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3162 | 1 | V → I. Corresponds to variant rs35027700 [ dbSNP | Ensembl ]. | VAR_053591 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3171 | 1 | A → V. Corresponds to variant rs35858667 [ dbSNP | Ensembl ]. | VAR_053592 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3486 | 1 | T → M. Corresponds to variant rs34725742 [ dbSNP | Ensembl ]. | VAR_053593 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3490 | 1 | G → A. Corresponds to variant rs35261863 [ dbSNP | Ensembl ]. | VAR_053594 | |||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 71 | 1 | Y → F in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 94 | 1 | P → A in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 139 | 1 | V → L in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 185 | 1 | F → S in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 259 | 1 | N → D in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 259 | 1 | N → D in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 550 | 1 | N → H in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 560 | 1 | V → I in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 706 | 1 | R → Q in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 886 | 1 | Y → N in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1002 | 1 | A → V in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1309 | 1 | V → L in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1309 | 1 | V → L in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1334 | 1 | V → L in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1334 | 1 | V → L in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1534 | 1 | M → I in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1662 | 1 | A → T in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1662 | 1 | A → T in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1688 – 1690 | 3 | RLR → WLC in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1767 | 1 | E → Q in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1789 | 1 | A → L in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1910 | 1 | R → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in CAA65765. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAR95680. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAR95682. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2154 | 1 | K → N in AAR95683. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2160 | 1 | R → S in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2215 | 1 | Q → R in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2244 | 1 | S → A in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2244 | 1 | S → A in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2244 | 1 | S → A in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 2244 | 1 | S → A in CAA65765. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3027 | 1 | K → E in AAB05427. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3027 | 1 | K → E in AAB05428. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3310 | 1 | A → E in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3361 | 1 | L → F in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3408 | 1 | L → F in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3447 | 1 | A → S in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3531 | 1 | A → G in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3580 | 1 | S → R in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3589 | 1 | Q → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3596 | 1 | Q → E in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3616 | 1 | H → N in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3686 | 1 | A → V in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3786 | 1 | A → G in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3808 | 1 | R → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3816 | 1 | A → G in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3821 | 1 | C → F in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3915 | 1 | Q → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3999 | 1 | R → K in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4007 | 1 | T → S in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4467 | 1 | F → L in CAA91196. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 175 – 193 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 203 – 209 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 211 – 221 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 233 – 249 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 259 – 263 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 267 – 282 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 297 – 308 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 309 – 311 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 322 – 324 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 328 – 337 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 339 – 341 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 344 – 347 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 352 – 367 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 375 – 378 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 380 – 382 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 385 – 398 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 414 – 440 | 27 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 448 – 463 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 466 – 489 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 490 – 492 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 500 – 564 | 65 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 572 – 598 | 27 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 604 – 629 | 26 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human plectin: organization of the gene, sequence analysis, and chromosome localization (8q24)." Liu C.-G., Maercker C., Castanon M.J., Hauptmann R., Wiche G. Proc. Natl. Acad. Sci. U.S.A. 93:4278-4283(1996) [PubMed: 8633055] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Placenta. |
| [2] | "Loss of plectin causes epidermolysis bullosa with muscular dystrophy: cDNA cloning and genomic organization." McLean W.H.I., Pulkkinen L., Smith F.J.D., Rugg E.L., Lane E.B., Bullrich F., Burgeson R.E., Amano S., Hudson D.L., Owaribe K., McGrath J.A., McMillan J.R., Eady R.A.J., Leigh I.M., Christiano A.M., Uitto J. Genes Dev. 10:1724-1735(1996) [PubMed: 8698233] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 2 AND 3), DISEASE, VARIANT VAL-1321. |
| [3] | "Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation." Zhang T., Haws P., Wu Q. Genome Res. 14:79-89(2004) [PubMed: 14672974] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4; 5; 6; 7; 8 AND 9). |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Bienvenut W.V., Lilla S., von Kriegsheim A., Lempens A., Kolch W. Submitted (DEC-2008) to UniProtKB Cited for: PROTEIN SEQUENCE OF 14-21; 209-227; 237-248; 301-316; 329-336; 350-365; 372-417; 510-517; 588-597; 631-675; 697-706; 714-724; 734-740; 751-764; 857-869; 897-908; 927-934; 1029-1037; 1045-1052; 1076-1088; 1131-1139; 1166-1175; 1187-1210; 1216-1224; 1227-1243; 1251-1266; 1274-1291; 1318-1335; 1338-1344; 1351-1364; 1366-1382; 1411-1438; 1473-1479; 1499-1508; 1554-1563; 1596-1603; 1606-1616; 1628-1638; 1649-1657; 1671-1679; 1699-1709; 1732-1744; 1783-1792; 1825-1833; 1846-1854; 1867-1875; 1888-1908; 1976-1994; 2006-2014; 2048-2055; 2058-2068; 2079-2087; 2098-2108; 2130-2139; 2142-2150; 2172-2182; 2199-2217; 2310-2316; 2319-2329; 2340-2348; 2361-2379; 2402-2409; 2420-2429; 2432-2442; 2462-2473; 2483-2503; 2512-2521; 2565-2575; 2587-2594; 2651-2663; 2685-2693; 2705-2761; 2768-2787; 2795-2821; 2833-2841; 2847-2881; 2885-2903; 2942-2968; 2979-3007; 3028-3039; 3045-3053; 3095-3106; 3109-3127; 3132-3139; 3146-3154; 3175-3183; 3213-3231; 3244-3259; 3270-3285; 3289-3297; 3317-3335; 3356-3368; 3374-3384; 3424-3436; 3447-3469; 3477-3485; 3506-3513; 3519-3540; 3544-3568; 3601-3637; 3648-3661; 3667-3676; 3686-3702; 3739-3749; 3771-3781; 3784-3804; 3839-3878; 3887-3897; 3926-3963; 3969-3999; 4004-4018; 4027-4060; 4084-4091; 4122-4138; 4159-4167; 4179-4205; 4278-4296; 4339-4348; 4354-4360; 4384-4401; 4429-4447; 4467-4475; 4492-4500; 4543-4551; 4590-4627 AND 4668-4684, PHOSPHORYLATION AT SER-4385, MASS SPECTROMETRY. Tissue: Ovarian carcinoma. |
| [6] | "Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly." Koster J., Geerts D., Favre B., Borradori L., Sonnenberg A. J. Cell Sci. 116:387-399(2003) [PubMed: 12482924] [Abstract] Cited for: FUNCTION, INTERACTION WITH COL17A1, SUBCELLULAR LOCATION. |
| [7] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-720; SER-1435; SER-4386; THR-4402; SER-4613 AND THR-4623, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Global phosphoproteome of HT-29 human colon adenocarcinoma cells." Kim J.-E., Tannenbaum S.R., White F.M. J. Proteome Res. 4:1339-1346(2005) [PubMed: 16083285] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1721; SER-4386 AND SER-4389, MASS SPECTROMETRY. Tissue: Colon adenocarcinoma. |
| [9] | "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J., Lauffenburger D.A., White F.M. Mol. Cell. Proteomics 4:1240-1250(2005) [PubMed: 15951569] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-4611, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [10] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-4615, MASS SPECTROMETRY. |
| [11] | "Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC." Gevaert K., Staes A., Van Damme J., De Groot S., Hugelier K., Demol H., Martens L., Goethals M., Vandekerckhove J. Proteomics 5:3589-3599(2005) [PubMed: 16097034] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-782, MASS SPECTROMETRY. Tissue: Hepatoma. |
| [12] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125; SER-149; SER-720; SER-1435; SER-1721; THR-2814; THR-4030; SER-4382; SER-4384; SER-4385; SER-4386; THR-4411 AND SER-4620, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21 (ISOFORM 4), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Phosphoproteome analysis of the human mitotic spindle." Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R. Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006) [PubMed: 16565220] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1435; SER-4384; SER-4396; SER-4613 AND SER-4620, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21 (ISOFORM 4), MASS SPECTROMETRY. Tissue: Cervix adenocarcinoma. |
| [14] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-3362 AND TYR-4155, MASS SPECTROMETRY. Tissue: Lung carcinoma. |
| [15] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1435, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21 (ISOFORM 4), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [16] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1644 AND SER-2755, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [17] | "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis." Wang B., Malik R., Nigg E.A., Korner R. Anal. Chem. 80:9526-9533(2008) [PubMed: 19007248] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-149; SER-720; SER-1435; SER-2516; THR-4030; SER-4389; SER-4396; SER-4613 AND SER-4675, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [18] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4386, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [19] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125; SER-720 AND SER-1435, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [20] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125; SER-149; SER-720; SER-1435; SER-1732; THR-4030; SER-4382; SER-4384; SER-4385; SER-4386; SER-4389; SER-4392; TYR-4393; SER-4396; SER-4613; SER-4622; THR-4623; SER-4626; THR-4628; SER-4642 AND SER-4658, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [21] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1435; SER-4384; SER-4385; SER-4386; SER-4389; TYR-4393; SER-4396 AND SER-4400, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [22] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-26; (ISOFORM 4) TYR-4155; TYR-4393; TYR-4611 AND TYR-4615, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [23] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-720; SER-1435; SER-1444; THR-4030; SER-4384; SER-4389; SER-4390; THR-4402 AND SER-4626, MASS SPECTROMETRY. |
| [24] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4386; SER-4389; SER-4396; SER-4613; SER-4618 AND SER-4626, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [25] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-187; LYS-2841; LYS-3091 AND LYS-3420, MASS SPECTROMETRY. |
| [26] | "Mutation in exon 1f of PLEC, leading to disruption of plectin isoform 1f, causes autosomal-recessive limb-girdle muscular dystrophy." Gundesli H., Talim B., Korkusuz P., Balci-Hayta B., Cirak S., Akarsu N.A., Topaloglu H., Dincer P. Am. J. Hum. Genet. 87:834-841(2010) [PubMed: 21109228] [Abstract] Cited for: FUNCTION OF ISOFORM 9, INVOLVEMENT IN LGMD2Q. |
| [27] | "BPAG1 isoform-b: complex distribution pattern in striated and heart muscle and association with plectin and alpha-actinin." Steiner-Champliaud M.F., Schneider Y., Favre B., Paulhe F., Praetzel-Wunder S., Faulkner G., Konieczny P., Raith M., Wiche G., Adebola A., Liem R.K., Langbein L., Sonnenberg A., Fontao L., Borradori L. Exp. Cell Res. 316:297-313(2010) [PubMed: 19932097] [Abstract] Cited for: INTERACTION WITH DST. |
| [28] | "Plectin deficiency leads to both muscular dystrophy and pyloric atresia in epidermolysis bullosa simplex." Natsuga K., Nishie W., Shinkuma S., Arita K., Nakamura H., Ohyama M., Osaka H., Kambara T., Hirako Y., Shimizu H. Hum. Mutat. 31:E1687-E1698(2010) [PubMed: 20665883] [Abstract] Cited for: INVOLVEMENT IN MD-EBS AND EBS-PA. |
| [29] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [30] | "The structure of a tandem pair of spectrin repeats of plectin reveals a modular organization of the plakin domain." Sonnenberg A., Rojas A.M., de Pereda J.M. J. Mol. Biol. 368:1379-1391(2007) [PubMed: 17397861] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.05 ANGSTROMS) OF 409-640. |
| [31] | "Structural and functional analysis of the actin binding domain of plectin suggests alternative mechanisms for binding to F-actin and integrin beta4." Garcia-Alvarez B., Bobkov A., Sonnenberg A., de Pereda J.M. Structure 11:615-625(2003) [PubMed: 12791251] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 159-403. |
| [32] | "Homozygous deletion mutations in the plectin gene (PLEC1) in patients with epidermolysis bullosa simplex associated with late-onset muscular dystrophy." Pulkkinen L., Smith F.J.D., Shimizu H., Murata S., Yaoita H., Hachisuka H., Nishikawa T., McLean W.H.I., Uitto J. Hum. Mol. Genet. 5:1539-1546(1996) [PubMed: 8894687] [Abstract] Cited for: VARIANT MD-EBS 1003-GLN--ALA-1005 DEL. |
| [33] | "A compound heterozygous one amino-acid insertion/nonsense mutation in the plectin gene causes epidermolysis bullosa simplex with plectin deficiency." Bauer J.W., Rouan F., Kofler B., Rezniczek G.A., Kornacker I., Muss W., Hametner R., Klausegger A., Huber A., Pohla-Gubo G., Wiche G., Uitto J., Hintner H. Am. J. Pathol. 158:617-625(2001) [PubMed: 11159198] [Abstract] Cited for: VARIANT MD-EBS LEU-429 INS. |
| [34] | "A site-specific plectin mutation causes dominant epidermolysis bullosa simplex Ogna: two identical de novo mutations." Koss-Harnes D., Hoeyheim B., Anton-Lamprecht I., Gjesti A., Joergensen R.S., Jahnsen F.L., Olaisen B., Wiche G., Gedde-Dahl T. Jr. J. Invest. Dermatol. 118:87-93(2002) [PubMed: 11851880] [Abstract] Cited for: VARIANT O-EBS TRP-2110. |
| [35] | "Identification of a lethal form of epidermolysis bullosa simplex associated with a homozygous genetic mutation in plectin." Charlesworth A., Gagnoux-Palacios L., Bonduelle M., Ortonne J.-P., De Raeve L., Meneguzzi G. J. Invest. Dermatol. 121:1344-1348(2003) [PubMed: 14675180] [Abstract] Cited for: INVOLVEMENT IN EBS-PA. |
| + | Additional computationally mapped references. |
Web resources
| Wikipedia Plectin entry |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Z54367 Genomic DNA. Translation: CAA91196.1. U53204 mRNA. Translation: AAB05427.1. U63610, U63609 Genomic DNA. Translation: AAB05428.1. X97053 mRNA. Translation: CAA65765.1. AY480044 mRNA. Translation: AAR95677.1. AY480045 mRNA. Translation: AAR95678.1. AY480046 mRNA. Translation: AAR95679.1. AY480047 mRNA. Translation: AAR95680.1. AY480048 mRNA. Translation: AAR95681.1. AY480049 mRNA. Translation: AAR95682.1. AY480050 mRNA. Translation: AAR95683.1. AY480051 mRNA. Translation: AAR95684.1. AC109322 Genomic DNA. No translation available. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00014898. IPI00186711. IPI00398002. IPI00398775. IPI00398776. IPI00398777. IPI00398778. IPI00398779. IPI00420096. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | A59404. C59404. G02520. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_000436.2. NM_000445.3. NP_958780.1. NM_201378.2. NP_958781.1. NM_201379.1. NP_958782.1. NM_201380.2. NP_958783.1. NM_201381.1. NP_958784.1. NM_201382.2. NP_958785.1. NM_201383.1. NP_958786.1. NM_201384.1. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.434248. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q15149. | ||||||||||||||||||||||||||||||||||||||||||
| SMR | Q15149. Positions 5-101, 175-400, 413-630, 653-1109, 2782-3023, 3110-3351, 3441-3681, 3776-4302, 4338-4605. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q15149. 12 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-257064. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | Q15149. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q15149. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 209572726. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q15149. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000322810; ENSP00000323856; ENSG00000178209. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 5339. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:5339. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003zab.1. human. uc003zac.1. human. uc003zad.2. human. uc003zae.1. human. uc003zaf.1. human. uc003zag.1. human. uc003zah.2. human. uc003zaj.2. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 5339. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08M144989. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:9069. PLEC. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB003847. HPA025967. HPA029906. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 131950. phenotype. 226670. phenotype. 601282. gene. 612138. phenotype. 613723. phenotype. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q15149. | ||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 254361. Autosomal recessive limb-girdle muscular dystrophy due to plectin deficiency. 257. Epidermolysis bullosa simplex - limb girdle muscular dystrophy. 158684. Epidermolysis bullosa simplex - pyloric atresia. 79401. Epidermolysis bullosa simplex, Ogna type. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA165585856. PA33399. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG5069. | ||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00610000085715. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG053616. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q15149. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K10388. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | MVMPARR. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111155. Cell-Cell communication. REACT_578. Apoptosis. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q15149. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q15149. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PLEC1. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q15149. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000178209. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.418.10. Calponin-homology. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001589. Actinin_actin-bd_CS. IPR001715. CH-domain. IPR001101. Plectin_repeat. IPR005326. S10_plectin_N. IPR018159. Spectrin/alpha-actinin. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00307. CH. 2 hits. PF00681. Plectin. 18 hits. PF03501. S10_plectin. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00033. CH. 2 hits. SM00250. PLEC. 32 hits. SM00150. SPEC. 7 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF47576. Calponin-homology. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00019. ACTININ_1. 1 hit. PS00020. ACTININ_2. 1 hit. PS50021. CH. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q15149. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 20680. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PLEC_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15149 Secondary accession number(s): Q15148 Q6S383 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with