Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plectin

Gene

PLEC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Interlinks intermediate filaments with microtubules and microfilaments and anchors intermediate filaments to desmosomes or hemidesmosomes. Could also bind muscle proteins such as actin to membrane complexes in muscle. May be involved not only in the filaments network, but also in the regulation of their dynamics. Structural component of muscle. Isoform 9 plays a major role in the maintenance of myofiber integrity.2 Publications

GO - Molecular functioni

  • ankyrin binding Source: BHF-UCL
  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL
  • poly(A) RNA binding Source: UniProtKB
  • structural constituent of muscle Source: UniProtKB

GO - Biological processi

  • hemidesmosome assembly Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000178209-MONOMER.
ReactomeiR-HSA-2022090. Assembly of collagen fibrils and other multimeric structures.
R-HSA-264870. Caspase-mediated cleavage of cytoskeletal proteins.
R-HSA-446107. Type I hemidesmosome assembly.
SIGNORiQ15149.

Names & Taxonomyi

Protein namesi
Recommended name:
Plectin
Short name:
PCN
Short name:
PLTN
Alternative name(s):
Hemidesmosomal protein 1
Short name:
HD1
Plectin-1
Gene namesi
Name:PLEC
Synonyms:PLEC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:9069. PLEC.

Subcellular locationi

GO - Cellular componenti

  • brush border Source: Ensembl
  • cell-cell adherens junction Source: BHF-UCL
  • costamere Source: BHF-UCL
  • cytoplasm Source: HPA
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • extracellular matrix Source: BHF-UCL
  • focal adhesion Source: UniProtKB
  • hemidesmosome Source: UniProtKB
  • intermediate filament cytoskeleton Source: HPA
  • plasma membrane Source: ProtInc
  • sarcolemma Source: UniProtKB
  • sarcoplasm Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Involvement in diseasei

Epidermolysis bullosa simplex with pyloric atresia (EBS-PA)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAutosomal recessive genodermatosis characterized by severe skin blistering at birth and congenital pyloric atresia. Death usually occurs in infancy. This disorder is allelic to MD-EBS.
See also OMIM:612138
Epidermolysis bullosa simplex, with muscular dystrophy (MD-EBS)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epidermolysis bullosa characterized by the association of blister formation at the level of the hemidesmosome with late-onset muscular dystrophy.
See also OMIM:226670
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_011336429L → LL in MD-EBS. 1 Publication1
Natural variantiVAR_0113371003 – 1005Missing in MD-EBS. 1 Publication3
Epidermolysis bullosa simplex, Ogna type (O-EBS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of intraepidermal epidermolysis bullosa characterized by generalized skin bruising, skin fragility with non-scarring blistering and small hemorrhagic blisters on hands. At the ultrastructural level, it is differentiated from classical cases of K-EBS, WC-EBS and DM-EBS, by the occurrence of blisters originating in basal cells above hemidesmosomes, and abnormal hemidesmosome intracellular attachment plates.
See also OMIM:131950
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0158172110R → W in O-EBS. 1 PublicationCorresponds to variant rs80338756dbSNPEnsembl.1
Limb-girdle muscular dystrophy 2Q (LGMD2Q)3 Publications
The disease is caused by mutations affecting the gene represented in this entry. A 9 bp deletion containing the initiation codon in exon 1f of PLEC have been found in limb-girdle muscular dystrophy patients. The mutation results in deficient expression of isoform 9 and disorganization of the myofibers, without any effect on the skin.
Disease descriptionA form of limb-girdle muscular dystrophy characterized by early childhood onset of proximal muscle weakness. Limb-girdle muscular dystrophies are characterized by proximal weakness, weakness of the hip and shoulder girdles and prominent asymmetrical quadriceps femoris and biceps brachii atrophy.
See also OMIM:613723
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0765653945G → S in LGMD2Q. 2 Publications1
Epidermolysis bullosa simplex with nail dystrophy (EBSND)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epidermolysis bullosa, a dermatologic disorder characterized by skin blistering. EBSND patients also manifest nail dystrophy.
See also OMIM:616487

Keywords - Diseasei

Disease mutation, Epidermolysis bullosa, Limb-girdle muscular dystrophy

Organism-specific databases

DisGeNETi5339.
MalaCardsiPLEC.
MIMi131950. phenotype.
226670. phenotype.
612138. phenotype.
613723. phenotype.
616487. phenotype.
OpenTargetsiENSG00000178209.
Orphaneti254361. Autosomal recessive limb-girdle muscular dystrophy type 2Q.
257. Epidermolysis bullosa simplex with muscular dystrophy.
158684. Epidermolysis bullosa simplex with pyloric atresia.
79401. Epidermolysis bullosa simplex, Ogna type.
PharmGKBiPA33399.

Chemistry databases

ChEMBLiCHEMBL1293240.

Polymorphism and mutation databases

BioMutaiPLEC.
DMDMi209572726.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000781351 – 4684PlectinAdd BLAST4684

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei113PhosphothreonineCombined sources1
Modified residuei125PhosphoserineCombined sources1
Modified residuei149PhosphoserineCombined sources1
Modified residuei720PhosphoserineCombined sources1
Modified residuei1047PhosphoserineCombined sources1
Modified residuei1435PhosphoserineCombined sources1
Modified residuei1721PhosphoserineCombined sources1
Modified residuei1725N6-acetyllysineBy similarity1
Modified residuei1732PhosphoserineCombined sources1
Modified residuei2631PhosphoserineCombined sources1
Modified residuei2636N6-acetyllysineBy similarity1
Modified residuei2782PhosphoserineCombined sources1
Modified residuei2802PhosphoserineCombined sources1
Modified residuei2886PhosphothreonineCombined sources1
Modified residuei3033PhosphotyrosineBy similarity1
Modified residuei3036PhosphoserineCombined sources1
Modified residuei3053N6-acetyllysineBy similarity1
Modified residuei3091N6-acetyllysineCombined sources1
Modified residuei3362PhosphotyrosineBy similarity1
Modified residuei3420N6-acetyllysineCombined sources1
Modified residuei3580PhosphoserineBy similarity1
Modified residuei3785PhosphothreonineCombined sources1
Modified residuei4030PhosphothreonineCombined sources1
Modified residuei4054PhosphoserineCombined sources1
Modified residuei4382PhosphoserineCombined sources1
Modified residuei4384PhosphoserineBy similarity1
Modified residuei4385PhosphoserineCombined sources1 Publication1
Modified residuei4386PhosphoserineCombined sources1
Modified residuei4389PhosphoserineCombined sources1
Modified residuei4390PhosphoserineCombined sources1
Modified residuei4391PhosphoserineCombined sources1
Modified residuei4392PhosphoserineCombined sources1
Modified residuei4393PhosphotyrosineCombined sources1
Modified residuei4396PhosphoserineCombined sources1
Modified residuei4400PhosphoserineCombined sources1
Modified residuei4406PhosphoserineBy similarity1
Modified residuei4411PhosphothreonineCombined sources1
Modified residuei4539Phosphothreonine; by CDK1By similarity1
Modified residuei4607PhosphoserineCombined sources1
Modified residuei4613PhosphoserineCombined sources1
Modified residuei4615PhosphotyrosineBy similarity1
Modified residuei4616PhosphoserineCombined sources1
Modified residuei4618PhosphoserineCombined sources1
Modified residuei4622PhosphoserineCombined sources1
Modified residuei4623PhosphothreonineBy similarity1
Modified residuei4626PhosphoserineCombined sources1
Modified residuei4627Omega-N-methylarginineBy similarity1
Modified residuei4640Omega-N-methylarginineCombined sources1
Modified residuei4642PhosphoserineCombined sources1
Modified residuei4672PhosphoserineCombined sources1
Modified residuei4675PhosphoserineCombined sources1
Isoform 4 (identifier: Q15149-4)
Modified residuei20PhosphoserineCombined sourcesBy similarity1
Modified residuei21PhosphoserineCombined sourcesBy similarity1
Modified residuei26Phosphotyrosine By similarityCombined sourcesBy similarity1
Isoform 2 (identifier: Q15149-2)
Modified residuei42PhosphoserineCombined sources1
Isoform 3 (identifier: Q15149-3)
Modified residuei42PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by CDK1; regulates dissociation from intermediate filaments during mitosis.By similarity

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiQ15149.
MaxQBiQ15149.
PaxDbiQ15149.
PeptideAtlasiQ15149.
PRIDEiQ15149.

PTM databases

iPTMnetiQ15149.
PhosphoSitePlusiQ15149.
SwissPalmiQ15149.

Expressioni

Tissue specificityi

Widely expressed with highest levels in muscle, heart, placenta and spinal cord.

Gene expression databases

BgeeiENSG00000178209.
CleanExiHS_PLEC1.
ExpressionAtlasiQ15149. baseline and differential.
GenevisibleiQ15149. HS.

Organism-specific databases

HPAiCAB003847.
HPA025967.
HPA029906.

Interactioni

Subunit structurei

Homodimer or homotetramer. Interacts (via actin-binding domain) with SYNE3. Interacts (via CH 1 domain) with VIM (via rod region) (By similarity). Interacts (via N-terminus) with DST isoform 2 (via N-terminus) (PubMed:19932097). Interacts with FER. Interacts with TOR1A (PubMed:18827015). Interacts with ANK3 (PubMed:21223964). Identified in complexes that contain VIM, EZR, AHNAK, BFSP1, BFSP2, ANK2, PLEC, PRX and spectrin (By similarity). Interacts with COL17A1 (PubMed:12482924).By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
FUSP356374EBI-297903,EBI-400434
ITGB4P161447EBI-297903,EBI-948678

GO - Molecular functioni

  • ankyrin binding Source: BHF-UCL
  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL

Protein-protein interaction databases

BioGridi111355. 97 interactors.
IntActiQ15149. 50 interactors.
MINTiMINT-257064.
STRINGi9606.ENSP00000323856.

Chemistry databases

BindingDBiQ15149.

Structurei

Secondary structure

14684
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi175 – 193Combined sources19
Helixi194 – 196Combined sources3
Turni203 – 209Combined sources7
Helixi211 – 221Combined sources11
Helixi233 – 249Combined sources17
Helixi260 – 263Combined sources4
Helixi267 – 282Combined sources16
Turni283 – 285Combined sources3
Helixi297 – 308Combined sources12
Turni309 – 311Combined sources3
Helixi322 – 324Combined sources3
Helixi328 – 337Combined sources10
Helixi339 – 341Combined sources3
Helixi344 – 347Combined sources4
Helixi352 – 367Combined sources16
Helixi375 – 378Combined sources4
Beta strandi380 – 382Combined sources3
Helixi385 – 398Combined sources14
Helixi414 – 440Combined sources27
Helixi448 – 464Combined sources17
Helixi466 – 488Combined sources23
Beta strandi490 – 492Combined sources3
Helixi500 – 562Combined sources63
Turni563 – 566Combined sources4
Helixi572 – 598Combined sources27
Helixi604 – 628Combined sources25
Helixi656 – 678Combined sources23
Helixi685 – 714Combined sources30
Helixi715 – 718Combined sources4
Helixi721 – 778Combined sources58
Helixi788 – 821Combined sources34
Helixi827 – 854Combined sources28
Helixi861 – 886Combined sources26
Helixi894 – 913Combined sources20
Helixi915 – 926Combined sources12
Helixi932 – 934Combined sources3
Beta strandi944 – 948Combined sources5
Beta strandi964 – 970Combined sources7
Beta strandi975 – 979Combined sources5
Beta strandi985 – 989Combined sources5
Helixi990 – 992Combined sources3
Helixi999 – 1044Combined sources46
Helixi1048 – 1052Combined sources5
Helixi1056 – 1076Combined sources21
Beta strandi1077 – 1079Combined sources3
Beta strandi1080 – 1082Combined sources3
Helixi1085 – 1109Combined sources25
Helixi1118 – 1144Combined sources27
Helixi1152 – 1188Combined sources37
Beta strandi1190 – 1192Combined sources3
Helixi1197 – 1252Combined sources56
Helixi1259 – 1277Combined sources19
Helixi1280 – 1304Combined sources25
Helixi1311 – 1340Combined sources30
Helixi1378 – 1397Combined sources20
Helixi1399 – 1430Combined sources32
Helixi1445 – 1476Combined sources32
Helixi1493 – 1527Combined sources35
Beta strandi4417 – 4422Combined sources6
Turni4423 – 4425Combined sources3
Helixi4431 – 4437Combined sources7
Helixi4442 – 4454Combined sources13
Beta strandi4456 – 4458Combined sources3
Turni4461 – 4464Combined sources4
Helixi4469 – 4475Combined sources7
Helixi4480 – 4482Combined sources3
Helixi4483 – 4494Combined sources12
Turni4499 – 4501Combined sources3
Helixi4507 – 4513Combined sources7
Helixi4518 – 4531Combined sources14
Beta strandi4532 – 4535Combined sources4
Beta strandi4537 – 4543Combined sources7
Helixi4545 – 4551Combined sources7
Helixi4556 – 4563Combined sources8
Helixi4565 – 4567Combined sources3
Beta strandi4575 – 4577Combined sources3
Helixi4583 – 4589Combined sources7
Beta strandi4591 – 4597Combined sources7
Beta strandi4599 – 4603Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1MB8X-ray2.15A175-258[»]
A260-403[»]
2N03NMR-A4403-4606[»]
2ODUX-ray2.30A410-640[»]
2ODVX-ray2.05A410-640[»]
3F7PX-ray2.75A/B175-403[»]
3PDYX-ray2.22A/B653-858[»]
3PE0X-ray2.95A/B750-1028[»]
4GDOX-ray1.70A/B/C/D/E/F1492-1530[»]
4Q58X-ray4.00A/B175-400[»]
4Q59X-ray2.30A/B175-400[»]
5J1FX-ray3.00A/B860-928[»]
A/B999-1116[»]
5J1GX-ray1.80A/B1114-1343[»]
5J1HX-ray2.80A/B860-928[»]
A/B999-1116[»]
5J1IX-ray2.80A/B1114-1482[»]
ProteinModelPortaliQ15149.
SMRiQ15149.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ15149.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini175 – 400Actin-bindingAdd BLAST226
Domaini179 – 282CH 1PROSITE-ProRule annotationAdd BLAST104
Domaini295 – 397CH 2PROSITE-ProRule annotationAdd BLAST103
Repeati645 – 710Spectrin 1Add BLAST66
Repeati740 – 824Spectrin 2Add BLAST85
Repeati837 – 930Spectrin 3Add BLAST94
Repeati1315 – 1415Spectrin 4Add BLAST101
Repeati2826 – 2863Plectin 1Add BLAST38
Repeati2864 – 2901Plectin 2Add BLAST38
Repeati2902 – 2939Plectin 3Add BLAST38
Repeati2940 – 2977Plectin 4Add BLAST38
Repeati2981 – 3015Plectin 5Add BLAST35
Repeati3116 – 3153Plectin 6Add BLAST38
Repeati3154 – 3191Plectin 7Add BLAST38
Repeati3192 – 3229Plectin 8Add BLAST38
Repeati3230 – 3267Plectin 9Add BLAST38
Repeati3268 – 3305Plectin 10Add BLAST38
Repeati3306 – 3343Plectin 11Add BLAST38
Repeati3485 – 3522Plectin 12Add BLAST38
Repeati3523 – 3560Plectin 13Add BLAST38
Repeati3561 – 3598Plectin 14Add BLAST38
Repeati3599 – 3636Plectin 15Add BLAST38
Repeati3640 – 3674Plectin 16Add BLAST35
Repeati3820 – 3857Plectin 17Add BLAST38
Repeati3858 – 3895Plectin 18Add BLAST38
Repeati3896 – 3933Plectin 19Add BLAST38
Repeati3934 – 3971Plectin 20Add BLAST38
Repeati3975 – 4008Plectin 21Add BLAST34
Repeati4063 – 4100Plectin 22Add BLAST38
Repeati4101 – 4138Plectin 23Add BLAST38
Repeati4139 – 4176Plectin 24Add BLAST38
Repeati4177 – 4214Plectin 25Add BLAST38
Repeati4218 – 4252Plectin 26Add BLAST35
Repeati4265 – 4305Plectin 27Add BLAST41
Repeati4319 – 4356Plectin 28Add BLAST38
Repeati4408 – 4445Plectin 29Add BLAST38
Repeati4446 – 4483Plectin 30Add BLAST38
Repeati4484 – 4521Plectin 31Add BLAST38
Repeati4522 – 4559Plectin 32Add BLAST38
Repeati4560 – 4597Plectin 33Add BLAST38

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 1470Globular 1Add BLAST1470
Regioni1471 – 2755Central fibrous rod domainAdd BLAST1285
Regioni2756 – 4684Globular 2Add BLAST1929
Regioni4250 – 4300Binding to intermediate filamentsBy similarityAdd BLAST51
Regioni4625 – 46404 X 4 AA tandem repeats of G-S-R-XAdd BLAST16

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1469 – 2756Sequence analysisAdd BLAST1288

Domaini

The N-terminus interacts with actin, the C-terminus with vimentin, desmin, GFAP, cytokeratins, lamin B; whereas both the N- and the C-terminus can bind integrin beta-4.

Sequence similaritiesi

Belongs to the plakin or cytolinker family.Curated
Contains 1 actin-binding domain.Curated
Contains 2 CH (calponin-homology) domains.PROSITE-ProRule annotation
Contains 33 plectin repeats.Curated
Contains 4 spectrin repeats.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0516. Eukaryota.
KOG3344. Eukaryota.
COG5045. LUCA.
COG5069. LUCA.
GeneTreeiENSGT00760000119163.
HOVERGENiHBG053616.
InParanoidiQ15149.
KOiK10388.
OMAiYLNKDTH.
OrthoDBiEOG091G0012.
PhylomeDBiQ15149.
TreeFamiTF335163.

Family and domain databases

CDDicd00014. CH. 2 hits.
Gene3Di1.10.418.10. 2 hits.
3.90.1290.10. 7 hits.
InterProiIPR001589. Actinin_actin-bd_CS.
IPR001715. CH-domain.
IPR030269. Plectin.
IPR001101. Plectin_repeat.
IPR005326. S10_plectin_N.
IPR018159. Spectrin/alpha-actinin.
[Graphical view]
PANTHERiPTHR11915:SF247. PTHR11915:SF247. 4 hits.
PfamiPF00307. CH. 2 hits.
PF00681. Plectin. 18 hits.
PF03501. S10_plectin. 1 hit.
[Graphical view]
SMARTiSM00033. CH. 2 hits.
SM00250. PLEC. 32 hits.
SM00150. SPEC. 7 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF75399. SSF75399. 8 hits.
PROSITEiPS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15149-1) [UniParc]FASTAAdd to basket
Also known as: Plectin-6

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVAGMLMPRD QLRAIYEVLF REGVMVAKKD RRPRSLHPHV PGVTNLQVMR
60 70 80 90 100
AMASLRARGL VRETFAWCHF YWYLTNEGIA HLRQYLHLPP EIVPASLQRV
110 120 130 140 150
RRPVAMVMPA RRTPHVQAVQ GPLGSPPKRG PLPTEEQRVY RRKELEEVSP
160 170 180 190 200
ETPVVPATTQ RTLARPGPEP APATDERDRV QKKTFTKWVN KHLIKAQRHI
210 220 230 240 250
SDLYEDLRDG HNLISLLEVL SGDSLPREKG RMRFHKLQNV QIALDYLRHR
260 270 280 290 300
QVKLVNIRND DIADGNPKLT LGLIWTIILH FQISDIQVSG QSEDMTAKEK
310 320 330 340 350
LLLWSQRMVE GYQGLRCDNF TSSWRDGRLF NAIIHRHKPL LIDMNKVYRQ
360 370 380 390 400
TNLENLDQAF SVAERDLGVT RLLDPEDVDV PQPDEKSIIT YVSSLYDAMP
410 420 430 440 450
RVPDVQDGVR ANELQLRWQE YRELVLLLLQ WMRHHTAAFE ERRFPSSFEE
460 470 480 490 500
IEILWSQFLK FKEMELPAKE ADKNRSKGIY QSLEGAVQAG QLKVPPGYHP
510 520 530 540 550
LDVEKEWGKL HVAILEREKQ LRSEFERLEC LQRIVTKLQM EAGLCEEQLN
560 570 580 590 600
QADALLQSDV RLLAAGKVPQ RAGEVERDLD KADSMIRLLF NDVQTLKDGR
610 620 630 640 650
HPQGEQMYRR VYRLHERLVA IRTEYNLRLK AGVAAPATQV AQVTLQSVQR
660 670 680 690 700
RPELEDSTLR YLQDLLAWVE ENQHRVDGAE WGVDLPSVEA QLGSHRGLHQ
710 720 730 740 750
SIEEFRAKIE RARSDEGQLS PATRGAYRDC LGRLDLQYAK LLNSSKARLR
760 770 780 790 800
SLESLHSFVA AATKELMWLN EKEEEEVGFD WSDRNTNMTA KKESYSALMR
810 820 830 840 850
ELELKEKKIK ELQNAGDRLL REDHPARPTV ESFQAALQTQ WSWMLQLCCC
860 870 880 890 900
IEAHLKENAA YFQFFSDVRE AEGQLQKLQE ALRRKYSCDR SATVTRLEDL
910 920 930 940 950
LQDAQDEKEQ LNEYKGHLSG LAKRAKAVVQ LKPRHPAHPM RGRLPLLAVC
960 970 980 990 1000
DYKQVEVTVH KGDECQLVGP AQPSHWKVLS SSGSEAAVPS VCFLVPPPNQ
1010 1020 1030 1040 1050
EAQEAVTRLE AQHQALVTLW HQLHVDMKSL LAWQSLRRDV QLIRSWSLAT
1060 1070 1080 1090 1100
FRTLKPEEQR QALHSLELHY QAFLRDSQDA GGFGPEDRLM AEREYGSCSH
1110 1120 1130 1140 1150
HYQQLLQSLE QGAQEESRCQ RCISELKDIR LQLEACETRT VHRLRLPLDK
1160 1170 1180 1190 1200
EPARECAQRI AEQQKAQAEV EGLGKGVARL SAEAEKVLAL PEPSPAAPTL
1210 1220 1230 1240 1250
RSELELTLGK LEQVRSLSAI YLEKLKTISL VIRGTQGAEE VLRAHEEQLK
1260 1270 1280 1290 1300
EAQAVPATLP ELEATKASLK KLRAQAEAQQ PTFDALRDEL RGAQEVGERL
1310 1320 1330 1340 1350
QQRHGERDVE VERWRERVAQ LLERWQAVLA QTDVRQRELE QLGRQLRYYR
1360 1370 1380 1390 1400
ESADPLGAWL QDARRRQEQI QAMPLADSQA VREQLRQEQA LLEEIERHGE
1410 1420 1430 1440 1450
KVEECQRFAK QYINAIKDYE LQLVTYKAQL EPVASPAKKP KVQSGSESVI
1460 1470 1480 1490 1500
QEYVDLRTHY SELTTLTSQY IKFISETLRR MEEEERLAEQ QRAEERERLA
1510 1520 1530 1540 1550
EVEAALEKQR QLAEAHAQAK AQAEREAKEL QQRMQEEVVR REEAAVDAQQ
1560 1570 1580 1590 1600
QKRSIQEELQ QLRQSSEAEI QAKARQAEAA ERSRLRIEEE IRVVRLQLEA
1610 1620 1630 1640 1650
TERQRGGAEG ELQALRARAE EAEAQKRQAQ EEAERLRRQV QDESQRKRQA
1660 1670 1680 1690 1700
EVELASRVKA EAEAAREKQR ALQALEELRL QAEEAERRLR QAEVERARQV
1710 1720 1730 1740 1750
QVALETAQRS AEAELQSKRA SFAEKTAQLE RSLQEEHVAV AQLREEAERR
1760 1770 1780 1790 1800
AQQQAEAERA REEAERELER WQLKANEALR LRLQAEEVAQ QKSLAQAEAE
1810 1820 1830 1840 1850
KQKEEAEREA RRRGKAEEQA VRQRELAEQE LEKQRQLAEG TAQQRLAAEQ
1860 1870 1880 1890 1900
ELIRLRAETE QGEQQRQLLE EELARLQREA AAATQKRQEL EAELAKVRAE
1910 1920 1930 1940 1950
MEVLLASKAR AEEESRSTSE KSKQRLEAEA GRFRELAEEA ARLRALAEEA
1960 1970 1980 1990 2000
KRQRQLAEED AARQRAEAER VLAEKLAAIG EATRLKTEAE IALKEKEAEN
2010 2020 2030 2040 2050
ERLRRLAEDE AFQRRRLEEQ AAQHKADIEE RLAQLRKASD SELERQKGLV
2060 2070 2080 2090 2100
EDTLRQRRQV EEEILALKAS FEKAAAGKAE LELELGRIRS NAEDTLRSKE
2110 2120 2130 2140 2150
QAELEAARQR QLAAEEERRR REAEERVQKS LAAEEEAARQ RKAALEEVER
2160 2170 2180 2190 2200
LKAKVEEARR LRERAEQESA RQLQLAQEAA QKRLQAEEKA HAFAVQQKEQ
2210 2220 2230 2240 2250
ELQQTLQQEQ SVLDQLRGEA EAARRAAEEA EEARVQAERE AAQSRRQVEE
2260 2270 2280 2290 2300
AERLKQSAEE QAQARAQAQA AAEKLRKEAE QEAARRAQAE QAALRQKQAA
2310 2320 2330 2340 2350
DAEMEKHKKF AEQTLRQKAQ VEQELTTLRL QLEETDHQKN LLDEELQRLK
2360 2370 2380 2390 2400
AEATEAARQR SQVEEELFSV RVQMEELSKL KARIEAENRA LILRDKDNTQ
2410 2420 2430 2440 2450
RFLQEEAEKM KQVAEEAARL SVAAQEAARL RQLAEEDLAQ QRALAEKMLK
2460 2470 2480 2490 2500
EKMQAVQEAT RLKAEAELLQ QQKELAQEQA RRLQEDKEQM AQQLAEETQG
2510 2520 2530 2540 2550
FQRTLEAERQ RQLEMSAEAE RLKLRVAEMS RAQARAEEDA QRFRKQAEEI
2560 2570 2580 2590 2600
GEKLHRTELA TQEKVTLVQT LEIQRQQSDH DAERLREAIA ELEREKEKLQ
2610 2620 2630 2640 2650
QEAKLLQLKS EEMQTVQQEQ LLQETQALQQ SFLSEKDSLL QRERFIEQEK
2660 2670 2680 2690 2700
AKLEQLFQDE VAKAQQLREE QQRQQQQMEQ ERQRLVASME EARRRQHEAE
2710 2720 2730 2740 2750
EGVRRKQEEL QQLEQQRRQQ EELLAEENQR LREQLQLLEE QHRAALAHSE
2760 2770 2780 2790 2800
EVTASQVAAT KTLPNGRDAL DGPAAEAEPE HSFDGLRRKV SAQRLQEAGI
2810 2820 2830 2840 2850
LSAEELQRLA QGHTTVDELA RREDVRHYLQ GRSSIAGLLL KATNEKLSVY
2860 2870 2880 2890 2900
AALQRQLLSP GTALILLEAQ AASGFLLDPV RNRRLTVNEA VKEGVVGPEL
2910 2920 2930 2940 2950
HHKLLSAERA VTGYKDPYTG QQISLFQAMQ KGLIVREHGI RLLEAQIATG
2960 2970 2980 2990 3000
GVIDPVHSHR VPVDVAYRRG YFDEEMNRVL ADPSDDTKGF FDPNTHENLT
3010 3020 3030 3040 3050
YLQLLERCVE DPETGLCLLP LTDKAAKGGE LVYTDSEARD VFEKATVSAP
3060 3070 3080 3090 3100
FGKFQGKTVT IWEIINSEYF TAEQRRDLLR QFRTGRITVE KIIKIIITVV
3110 3120 3130 3140 3150
EEQEQKGRLC FEGLRSLVPA AELLESRVID RELYQQLQRG ERSVRDVAEV
3160 3170 3180 3190 3200
DTVRRALRGA NVIAGVWLEE AGQKLSIYNA LKKDLLPSDM AVALLEAQAG
3210 3220 3230 3240 3250
TGHIIDPATS ARLTVDEAVR AGLVGPEFHE KLLSAEKAVT GYRDPYTGQS
3260 3270 3280 3290 3300
VSLFQALKKG LIPREQGLRL LDAQLSTGGI VDPSKSHRVP LDVACARGCL
3310 3320 3330 3340 3350
DEETSRALSA PRADAKAYSD PSTGEPATYG ELQQRCRPDQ LTGLSLLPLS
3360 3370 3380 3390 3400
EKAARARQEE LYSELQARET FEKTPVEVPV GGFKGRTVTV WELISSEYFT
3410 3420 3430 3440 3450
AEQRQELLRQ FRTGKVTVEK VIKILITIVE EVETLRQERL SFSGLRAPVP
3460 3470 3480 3490 3500
ASELLASGVL SRAQFEQLKD GKTTVKDLSE LGSVRTLLQG SGCLAGIYLE
3510 3520 3530 3540 3550
DTKEKVSIYE AMRRGLLRAT TAALLLEAQA ATGFLVDPVR NQRLYVHEAV
3560 3570 3580 3590 3600
KAGVVGPELH EQLLSAEKAV TGYRDPYSGS TISLFQAMQK GLVLRQHGIR
3610 3620 3630 3640 3650
LLEAQIATGG IIDPVHSHRV PVDVAYQRGY FSEEMNRVLA DPSDDTKGFF
3660 3670 3680 3690 3700
DPNTHENLTY RQLLERCVED PETGLRLLPL KGAEKAEVVE TTQVYTEEET
3710 3720 3730 3740 3750
RRAFEETQID IPGGGSHGGS TMSLWEVMQS DLIPEEQRAQ LMADFQAGRV
3760 3770 3780 3790 3800
TKERMIIIII EIIEKTEIIR QQGLASYDYV RRRLTAEDLF EARIISLETY
3810 3820 3830 3840 3850
NLLREGTRSL REALEAESAW CYLYGTGSVA GVYLPGSRQT LSIYQALKKG
3860 3870 3880 3890 3900
LLSAEVARLL LEAQAATGFL LDPVKGERLT VDEAVRKGLV GPELHDRLLS
3910 3920 3930 3940 3950
AERAVTGYRD PYTEQTISLF QAMKKELIPT EEALRLLDAQ LATGGIVDPR
3960 3970 3980 3990 4000
LGFHLPLEVA YQRGYLNKDT HDQLSEPSEV RSYVDPSTDE RLSYTQLLRR
4010 4020 4030 4040 4050
CRRDDGTGQL LLPLSDARKL TFRGLRKQIT MEELVRSQVM DEATALQLRE
4060 4070 4080 4090 4100
GLTSIEEVTK NLQKFLEGTS CIAGVFVDAT KERLSVYQAM KKGIIRPGTA
4110 4120 4130 4140 4150
FELLEAQAAT GYVIDPIKGL KLTVEEAVRM GIVGPEFKDK LLSAERAVTG
4160 4170 4180 4190 4200
YKDPYSGKLI SLFQAMKKGL ILKDHGIRLL EAQIATGGII DPEESHRLPV
4210 4220 4230 4240 4250
EVAYKRGLFD EEMNEILTDP SDDTKGFFDP NTEENLTYLQ LMERCITDPQ
4260 4270 4280 4290 4300
TGLCLLPLKE KKRERKTSSK SSVRKRRVVI VDPETGKEMS VYEAYRKGLI
4310 4320 4330 4340 4350
DHQTYLELSE QECEWEEITI SSSDGVVKSM IIDRRSGRQY DIDDAIAKNL
4360 4370 4380 4390 4400
IDRSALDQYR AGTLSITEFA DMLSGNAGGF RSRSSSVGSS SSYPISPAVS
4410 4420 4430 4440 4450
RTQLASWSDP TEETGPVAGI LDTETLEKVS ITEAMHRNLV DNITGQRLLE
4460 4470 4480 4490 4500
AQACTGGIID PSTGERFPVT DAVNKGLVDK IMVDRINLAQ KAFCGFEDPR
4510 4520 4530 4540 4550
TKTKMSAAQA LKKGWLYYEA GQRFLEVQYL TGGLIEPDTP GRVPLDEALQ
4560 4570 4580 4590 4600
RGTVDARTAQ KLRDVGAYSK YLTCPKTKLK ISYKDALDRS MVEEGTGLRL
4610 4620 4630 4640 4650
LEAAAQSTKG YYSPYSVSGS GSTAGSRTGS RTGSRAGSRR GSFDATGSGF
4660 4670 4680
SMTFSSSSYS SSGYGRRYAS GSSASLGGPE SAVA
Length:4,684
Mass (Da):531,791
Last modified:October 14, 2008 - v3
Checksum:i04772E4F70A304C8
GO
Isoform 2 (identifier: Q15149-2) [UniParc]FASTAAdd to basket
Also known as: Plectin-1, 1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: MVAGMLMPRD...RPGPEPAPAT → MSGEDAEVRA...PAERAVIRIA

Show »
Length:4,574
Mass (Da):518,473
Checksum:i7EAEA5A83DEF52EA
GO
Isoform 3 (identifier: Q15149-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: MVAGMLMPRD...RPGPEPAPAT → MSGEDAEVRA...PAERAVIRIA
     409-412: Missing.

Show »
Length:4,570
Mass (Da):518,032
Checksum:iA0AF260B8C095C8D
GO
Isoform 4 (identifier: Q15149-4) [UniParc]FASTAAdd to basket
Also known as: Plectin-11, 1a

The sequence of this isoform differs from the canonical sequence as follows:
     1-174: MVAGMLMPRD...RPGPEPAPAT → MSQHQLRVPQ...AVLRASEGKK

Show »
Length:4,547
Mass (Da):516,198
Checksum:i0A1A2AB2E557110A
GO
Isoform 5 (identifier: Q15149-5) [UniParc]FASTAAdd to basket
Also known as: Plectin-8, 1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-137: Missing.
     138-174: RVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPAT → MEPSGSLFPSLVVVGHVVTLAAVWHWRRGRRWAQDEQ

Show »
Length:4,547
Mass (Da):516,276
Checksum:i0EC98F109B723779
GO
Isoform 6 (identifier: Q15149-6) [UniParc]FASTAAdd to basket
Also known as: Plectin-10, 1g

The sequence of this isoform differs from the canonical sequence as follows:
     1-133: Missing.
     134-174: TEEQRVYRRK...RPGPEPAPAT → MSGAGGAFAS...GYLYQQLCCV

Show »
Length:4,551
Mass (Da):516,479
Checksum:iC2E0FDA51BC17BF2
GO
Isoform 7 (identifier: Q15149-7) [UniParc]FASTAAdd to basket
Also known as: Plectin-7, 1d

The sequence of this isoform differs from the canonical sequence as follows:
     1-169: Missing.
     170-174: PAPAT → MKIVP

Show »
Length:4,515
Mass (Da):512,604
Checksum:iC8701AD6D1C1B26E
GO
Isoform 8 (identifier: Q15149-8) [UniParc]FASTAAdd to basket
Also known as: Plectin-3, 1e

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     160-174: QRTLARPGPEPAPAT → MDPSRAIQNEISSLK

Show »
Length:4,525
Mass (Da):513,706
Checksum:i37A4DFAB46C3B4DD
GO
Isoform 9 (identifier: Q15149-9) [UniParc]FASTAAdd to basket
Also known as: Plectin-2, 1f

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.
     152-174: TPVVPATTQRTLARPGPEPAPAT → MAGPLPDEQDFIQAYEEVREKYK

Show »
Length:4,533
Mass (Da):514,775
Checksum:i5D6382389A66B955
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti71Y → F in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti94P → A in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti139V → L in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti185F → S in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti259N → D in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti259N → D in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti550N → H in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti560V → I in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti706R → Q in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti886Y → N in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1002A → V in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1309V → L in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti1309V → L in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti1334V → L in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti1334V → L in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti1534M → I in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1662A → T in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti1662A → T in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti1688 – 1690RLR → WLC in CAA91196 (PubMed:8633055).Curated3
Sequence conflicti1767E → Q in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1789A → L in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti1910R → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti2154K → N in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti2154K → N in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti2154K → N in CAA65765 (PubMed:8698233).Curated1
Sequence conflicti2154K → N in AAR95680 (PubMed:14672974).Curated1
Sequence conflicti2154K → N in AAR95682 (PubMed:14672974).Curated1
Sequence conflicti2154K → N in AAR95683 (PubMed:14672974).Curated1
Sequence conflicti2160R → S in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti2215Q → R in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti2244S → A in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti2244S → A in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti2244S → A in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti2244S → A in CAA65765 (PubMed:8698233).Curated1
Sequence conflicti3027K → E in AAB05427 (PubMed:8698233).Curated1
Sequence conflicti3027K → E in AAB05428 (PubMed:8698233).Curated1
Sequence conflicti3310A → E in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3361L → F in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3408L → F in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3447A → S in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3531A → G in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3580S → R in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3589Q → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3596Q → E in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3616H → N in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3686A → V in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3786A → G in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3808R → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3816A → G in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3821C → F in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3915Q → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti3999R → K in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti4007T → S in CAA91196 (PubMed:8633055).Curated1
Sequence conflicti4467F → L in CAA91196 (PubMed:8633055).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075706102R → H.1 PublicationCorresponds to variant rs200335928dbSNPEnsembl.1
Natural variantiVAR_011336429L → LL in MD-EBS. 1 Publication1
Natural variantiVAR_053585641A → V.Corresponds to variant rs11136336dbSNPEnsembl.1
Natural variantiVAR_0113371003 – 1005Missing in MD-EBS. 1 Publication3
Natural variantiVAR_0600881321L → V.1 PublicationCorresponds to variant rs3135109dbSNPEnsembl.1
Natural variantiVAR_0600891386R → Q.Corresponds to variant rs11136334dbSNPEnsembl.1
Natural variantiVAR_0621331459H → R.Corresponds to variant rs55895668dbSNPEnsembl.1
Natural variantiVAR_0765642005R → W.1 PublicationCorresponds to variant rs200543521dbSNPEnsembl.1
Natural variantiVAR_0158172110R → W in O-EBS. 1 PublicationCorresponds to variant rs80338756dbSNPEnsembl.1
Natural variantiVAR_0535862150R → W.Corresponds to variant rs34893635dbSNPEnsembl.1
Natural variantiVAR_0535872194A → V.Corresponds to variant rs7002002dbSNPEnsembl.1
Natural variantiVAR_0535882791S → P.Corresponds to variant rs7833924dbSNPEnsembl.1
Natural variantiVAR_0535892821R → W.Corresponds to variant rs35723243dbSNPEnsembl.1
Natural variantiVAR_0535902969R → H.Corresponds to variant rs6558407dbSNPEnsembl.1
Natural variantiVAR_0535913162V → I.Corresponds to variant rs35027700dbSNPEnsembl.1
Natural variantiVAR_0535923171A → V.Corresponds to variant rs35858667dbSNPEnsembl.1
Natural variantiVAR_0535933486T → M.Corresponds to variant rs34725742dbSNPEnsembl.1
Natural variantiVAR_0535943490G → A.Corresponds to variant rs35261863dbSNPEnsembl.1
Natural variantiVAR_0765653945G → S in LGMD2Q. 2 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0050301 – 174MVAGM…PAPAT → MSGEDAEVRAVSEDVSNGSS GSPSPGDTLPWNLGKTQRSR RSGGGAGSNGSVLDPAERAV IRIA in isoform 2 and isoform 3. 2 PublicationsAdd BLAST174
Alternative sequenceiVSP_0235101 – 174MVAGM…PAPAT → MSQHQLRVPQPEGLGRKRTS SEDNLYLAVLRASEGKK in isoform 4. 1 PublicationAdd BLAST174
Alternative sequenceiVSP_0371001 – 169Missing in isoform 7. 1 PublicationAdd BLAST169
Alternative sequenceiVSP_0371011 – 159Missing in isoform 8. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_0371021 – 151Missing in isoform 9. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_0371031 – 137Missing in isoform 5. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_0371041 – 133Missing in isoform 6. 1 PublicationAdd BLAST133
Alternative sequenceiVSP_037105134 – 174TEEQR…PAPAT → MSGAGGAFASPREVLLERPC WLDGGCEPARRGYLYQQLCC V in isoform 6. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_037106138 – 174RVYRR…PAPAT → MEPSGSLFPSLVVVGHVVTL AAVWHWRRGRRWAQDEQ in isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_037107152 – 174TPVVP…PAPAT → MAGPLPDEQDFIQAYEEVRE KYK in isoform 9. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_037108160 – 174QRTLA…PAPAT → MDPSRAIQNEISSLK in isoform 8. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_037109170 – 174PAPAT → MKIVP in isoform 7. 1 Publication5
Alternative sequenceiVSP_005031409 – 412Missing in isoform 3. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z54367 Genomic DNA. Translation: CAA91196.1.
U53204 mRNA. Translation: AAB05427.1.
U63610, U63609 Genomic DNA. Translation: AAB05428.1.
X97053 mRNA. Translation: CAA65765.1.
AY480044 mRNA. Translation: AAR95677.1.
AY480045 mRNA. Translation: AAR95678.1.
AY480046 mRNA. Translation: AAR95679.1.
AY480047 mRNA. Translation: AAR95680.1.
AY480048 mRNA. Translation: AAR95681.1.
AY480049 mRNA. Translation: AAR95682.1.
AY480050 mRNA. Translation: AAR95683.1.
AY480051 mRNA. Translation: AAR95684.1.
AC109322 Genomic DNA. No translation available.
CCDSiCCDS43769.1. [Q15149-2]
CCDS43770.1. [Q15149-9]
CCDS43771.1. [Q15149-8]
CCDS43772.1. [Q15149-1]
CCDS43773.1. [Q15149-5]
CCDS43774.1. [Q15149-6]
CCDS43775.1. [Q15149-4]
CCDS47936.1. [Q15149-7]
PIRiC59404. A59404.
G02520.
RefSeqiNP_000436.2. NM_000445.4. [Q15149-2]
NP_958780.1. NM_201378.3. [Q15149-9]
NP_958781.1. NM_201379.2. [Q15149-8]
NP_958782.1. NM_201380.3. [Q15149-1]
NP_958783.1. NM_201381.2. [Q15149-7]
NP_958784.1. NM_201382.3. [Q15149-5]
NP_958785.1. NM_201383.2. [Q15149-6]
NP_958786.1. NM_201384.2. [Q15149-4]
UniGeneiHs.434248.

Genome annotation databases

EnsembliENST00000322810; ENSP00000323856; ENSG00000178209. [Q15149-1]
ENST00000345136; ENSP00000344848; ENSG00000178209. [Q15149-4]
ENST00000354589; ENSP00000346602; ENSG00000178209. [Q15149-5]
ENST00000354958; ENSP00000347044; ENSG00000178209. [Q15149-8]
ENST00000356346; ENSP00000348702; ENSG00000178209. [Q15149-9]
ENST00000357649; ENSP00000350277; ENSG00000178209. [Q15149-6]
ENST00000398774; ENSP00000381756; ENSG00000178209. [Q15149-7]
ENST00000436759; ENSP00000388180; ENSG00000178209. [Q15149-2]
ENST00000527096; ENSP00000434583; ENSG00000178209. [Q15149-3]
GeneIDi5339.
KEGGihsa:5339.
UCSCiuc003zab.2. human. [Q15149-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Plectin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z54367 Genomic DNA. Translation: CAA91196.1.
U53204 mRNA. Translation: AAB05427.1.
U63610, U63609 Genomic DNA. Translation: AAB05428.1.
X97053 mRNA. Translation: CAA65765.1.
AY480044 mRNA. Translation: AAR95677.1.
AY480045 mRNA. Translation: AAR95678.1.
AY480046 mRNA. Translation: AAR95679.1.
AY480047 mRNA. Translation: AAR95680.1.
AY480048 mRNA. Translation: AAR95681.1.
AY480049 mRNA. Translation: AAR95682.1.
AY480050 mRNA. Translation: AAR95683.1.
AY480051 mRNA. Translation: AAR95684.1.
AC109322 Genomic DNA. No translation available.
CCDSiCCDS43769.1. [Q15149-2]
CCDS43770.1. [Q15149-9]
CCDS43771.1. [Q15149-8]
CCDS43772.1. [Q15149-1]
CCDS43773.1. [Q15149-5]
CCDS43774.1. [Q15149-6]
CCDS43775.1. [Q15149-4]
CCDS47936.1. [Q15149-7]
PIRiC59404. A59404.
G02520.
RefSeqiNP_000436.2. NM_000445.4. [Q15149-2]
NP_958780.1. NM_201378.3. [Q15149-9]
NP_958781.1. NM_201379.2. [Q15149-8]
NP_958782.1. NM_201380.3. [Q15149-1]
NP_958783.1. NM_201381.2. [Q15149-7]
NP_958784.1. NM_201382.3. [Q15149-5]
NP_958785.1. NM_201383.2. [Q15149-6]
NP_958786.1. NM_201384.2. [Q15149-4]
UniGeneiHs.434248.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1MB8X-ray2.15A175-258[»]
A260-403[»]
2N03NMR-A4403-4606[»]
2ODUX-ray2.30A410-640[»]
2ODVX-ray2.05A410-640[»]
3F7PX-ray2.75A/B175-403[»]
3PDYX-ray2.22A/B653-858[»]
3PE0X-ray2.95A/B750-1028[»]
4GDOX-ray1.70A/B/C/D/E/F1492-1530[»]
4Q58X-ray4.00A/B175-400[»]
4Q59X-ray2.30A/B175-400[»]
5J1FX-ray3.00A/B860-928[»]
A/B999-1116[»]
5J1GX-ray1.80A/B1114-1343[»]
5J1HX-ray2.80A/B860-928[»]
A/B999-1116[»]
5J1IX-ray2.80A/B1114-1482[»]
ProteinModelPortaliQ15149.
SMRiQ15149.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111355. 97 interactors.
IntActiQ15149. 50 interactors.
MINTiMINT-257064.
STRINGi9606.ENSP00000323856.

Chemistry databases

BindingDBiQ15149.
ChEMBLiCHEMBL1293240.

PTM databases

iPTMnetiQ15149.
PhosphoSitePlusiQ15149.
SwissPalmiQ15149.

Polymorphism and mutation databases

BioMutaiPLEC.
DMDMi209572726.

Proteomic databases

EPDiQ15149.
MaxQBiQ15149.
PaxDbiQ15149.
PeptideAtlasiQ15149.
PRIDEiQ15149.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000322810; ENSP00000323856; ENSG00000178209. [Q15149-1]
ENST00000345136; ENSP00000344848; ENSG00000178209. [Q15149-4]
ENST00000354589; ENSP00000346602; ENSG00000178209. [Q15149-5]
ENST00000354958; ENSP00000347044; ENSG00000178209. [Q15149-8]
ENST00000356346; ENSP00000348702; ENSG00000178209. [Q15149-9]
ENST00000357649; ENSP00000350277; ENSG00000178209. [Q15149-6]
ENST00000398774; ENSP00000381756; ENSG00000178209. [Q15149-7]
ENST00000436759; ENSP00000388180; ENSG00000178209. [Q15149-2]
ENST00000527096; ENSP00000434583; ENSG00000178209. [Q15149-3]
GeneIDi5339.
KEGGihsa:5339.
UCSCiuc003zab.2. human. [Q15149-1]

Organism-specific databases

CTDi5339.
DisGeNETi5339.
GeneCardsiPLEC.
GeneReviewsiPLEC.
H-InvDBHIX0168901.
HGNCiHGNC:9069. PLEC.
HPAiCAB003847.
HPA025967.
HPA029906.
MalaCardsiPLEC.
MIMi131950. phenotype.
226670. phenotype.
601282. gene.
612138. phenotype.
613723. phenotype.
616487. phenotype.
neXtProtiNX_Q15149.
OpenTargetsiENSG00000178209.
Orphaneti254361. Autosomal recessive limb-girdle muscular dystrophy type 2Q.
257. Epidermolysis bullosa simplex with muscular dystrophy.
158684. Epidermolysis bullosa simplex with pyloric atresia.
79401. Epidermolysis bullosa simplex, Ogna type.
PharmGKBiPA33399.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0516. Eukaryota.
KOG3344. Eukaryota.
COG5045. LUCA.
COG5069. LUCA.
GeneTreeiENSGT00760000119163.
HOVERGENiHBG053616.
InParanoidiQ15149.
KOiK10388.
OMAiYLNKDTH.
OrthoDBiEOG091G0012.
PhylomeDBiQ15149.
TreeFamiTF335163.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000178209-MONOMER.
ReactomeiR-HSA-2022090. Assembly of collagen fibrils and other multimeric structures.
R-HSA-264870. Caspase-mediated cleavage of cytoskeletal proteins.
R-HSA-446107. Type I hemidesmosome assembly.
SIGNORiQ15149.

Miscellaneous databases

ChiTaRSiPLEC. human.
EvolutionaryTraceiQ15149.
GeneWikiiPlectin.
GenomeRNAii5339.
PROiQ15149.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000178209.
CleanExiHS_PLEC1.
ExpressionAtlasiQ15149. baseline and differential.
GenevisibleiQ15149. HS.

Family and domain databases

CDDicd00014. CH. 2 hits.
Gene3Di1.10.418.10. 2 hits.
3.90.1290.10. 7 hits.
InterProiIPR001589. Actinin_actin-bd_CS.
IPR001715. CH-domain.
IPR030269. Plectin.
IPR001101. Plectin_repeat.
IPR005326. S10_plectin_N.
IPR018159. Spectrin/alpha-actinin.
[Graphical view]
PANTHERiPTHR11915:SF247. PTHR11915:SF247. 4 hits.
PfamiPF00307. CH. 2 hits.
PF00681. Plectin. 18 hits.
PF03501. S10_plectin. 1 hit.
[Graphical view]
SMARTiSM00033. CH. 2 hits.
SM00250. PLEC. 32 hits.
SM00150. SPEC. 7 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF75399. SSF75399. 8 hits.
PROSITEiPS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPLEC_HUMAN
AccessioniPrimary (citable) accession number: Q15149
Secondary accession number(s): Q15148
, Q16640, Q6S376, Q6S377, Q6S378, Q6S379, Q6S380, Q6S381, Q6S382, Q6S383
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: October 14, 2008
Last modified: November 30, 2016
This is version 195 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutation