Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q15147

- PLCB4_HUMAN

UniProt

Q15147 - PLCB4_HUMAN

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4

Gene

PLCB4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 153 (01 Oct 2014)
      Sequence version 3 (05 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction.

    Catalytic activityi

    1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

    Cofactori

    Calcium.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei328 – 3281PROSITE-ProRule annotation
    Active sitei375 – 3751PROSITE-ProRule annotation

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. phosphatidylinositol phospholipase C activity Source: UniProtKB-EC
    3. phospholipase C activity Source: ProtInc
    4. signal transducer activity Source: UniProtKB-KW

    GO - Biological processi

    1. inositol phosphate metabolic process Source: Reactome
    2. intracellular signal transduction Source: InterPro
    3. lipid catabolic process Source: UniProtKB-KW
    4. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Hydrolase, Transducer

    Keywords - Biological processi

    Lipid degradation, Lipid metabolism

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.
    REACT_15426. PLC beta mediated events.
    REACT_18283. G alpha (q) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC:3.1.4.11)
    Alternative name(s):
    Phosphoinositide phospholipase C-beta-4
    Phospholipase C-beta-4
    Short name:
    PLC-beta-4
    Gene namesi
    Name:PLCB4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:9059. PLCB4.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. dendrite Source: Ensembl
    3. nucleus Source: Ensembl
    4. postsynaptic density Source: Ensembl
    5. smooth endoplasmic reticulum Source: Ensembl

    Pathology & Biotechi

    Involvement in diseasei

    Auriculocondylar syndrome 2 (ARCND2) [MIM:614669]: A craniofacial malformation syndrome characterized by variable mandibular anomalies, including mild to severe micrognathia, temporomandibular joint ankylosis, cleft palate, and a characteristic ear malformation that consists of separation of the lobule from the external ear, giving the appearance of a question mark (question-mark ear). Other frequently described features include prominent cheeks, cupped and posteriorly rotated ears, preauricular tags, and microstomia.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti329 – 3291N → T in ARCND2. 1 Publication
    VAR_068559
    Natural varianti621 – 6211R → C in ARCND2. 1 Publication
    VAR_068560
    Natural varianti621 – 6211R → H in ARCND2. 1 Publication
    VAR_068561
    Natural varianti623 – 6231Y → C in ARCND2. 1 Publication
    VAR_068562
    Natural varianti650 – 6501N → H in ARCND2. 1 Publication
    VAR_068563

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi614669. phenotype.
    Orphaneti137888. Auriculocondylar syndrome.
    PharmGKBiPA33387.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 117511741-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4PRO_0000088495Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication
    Modified residuei886 – 8861Phosphothreonine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ15147.
    PaxDbiQ15147.
    PeptideAtlasiQ5JYT3.
    PRIDEiQ15147.

    PTM databases

    PhosphoSiteiQ15147.

    Expressioni

    Tissue specificityi

    Preferentially expressed in the retina.

    Gene expression databases

    ArrayExpressiQ15147.
    BgeeiQ15147.
    GenevestigatoriQ15147.

    Interactioni

    Protein-protein interaction databases

    BioGridi111348. 1 interaction.
    IntActiQ15147. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ15147.
    SMRiQ15147. Positions 6-855.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini313 – 463151PI-PLC X-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini565 – 681117PI-PLC Y-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini688 – 78699C2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C2 domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG149692.
    HOVERGENiHBG053609.
    KOiK05858.
    OMAiSFTYMVA.
    OrthoDBiEOG7WDN1N.
    PhylomeDBiQ15147.
    TreeFamiTF352235.

    Family and domain databases

    Gene3Di1.10.238.10. 1 hit.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProiIPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR016280. PLC-beta.
    IPR009535. PLC-beta_CS.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view]
    PANTHERiPTHR10336. PTHR10336. 1 hit.
    PfamiPF00168. C2. 1 hit.
    PF06631. DUF1154. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view]
    PIRSFiPIRSF000956. PLC-beta. 1 hit.
    PRINTSiPR00390. PHPHLIPASEC.
    SMARTiSM00239. C2. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 2 hits.
    PROSITEiPS50004. C2. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 2 (identifier: Q15147-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAKPYEFNWQ KEVPSFLQEG AVFDRYEEES FVFEPNCLFK VDEFGFFLTW     50
    RSEGKEGQVL ECSLINSIRS GAIPKDPKIL AALEAVGKSE NDLEGRIVCV 100
    CSGTDLVNIS FTYMVAENPE VTKQWVEGLR SIIHNFRANN VSPMTCLKKH 150
    WMKLAFMTNT NGKIPVRSIT RTFASGKTEK VIFQALKELG LPSGKNDEIE 200
    PTAFSYEKFY ELTQKICPRT DIEDLFKKIN GDKTDYLTVD QLVSFLNEHQ 250
    RDPRLNEILF PFYDAKRAMQ IIEMYEPDED LKKKGLISSD GFCRYLMSDE 300
    NAPVFLDRLE LYQEMDHPLA HYFISSSHNT YLTGRQFGGK SSVEMYRQVL 350
    LAGCRCVELD CWDGKGEDQE PIITHGKAMC TDILFKDVIQ AIKETAFVTS 400
    EYPVILSFEN HCSKYQQYKM SKYCEDLFGD LLLKQALESH PLEPGRALPS 450
    PNDLKRKILI KNKRLKPEVE KKQLEALRSM MEAGESASPA NILEDDNEEE 500
    IESADQEEEA HPEFKFGNEL SADDLGHKEA VANSVKKGLV TVEDEQAWMA 550
    SYKYVGATTN IHPYLSTMIN YAQPVKFQGF HVAEERNIHY NMSSFNESVG 600
    LGYLKTHAIE FVNYNKRQMS RIYPKGGRVD SSNYMPQIFW NAGCQMVSLN 650
    YQTPDLAMQL NQGKFEYNGS CGYLLKPDFM RRPDRTFDPF SETPVDGVIA 700
    ATCSVQVISG QFLSDKKIGT YVEVDMYGLP TDTIRKEFRT RMVMNNGLNP 750
    VYNEESFVFR KVILPDLAVL RIAVYDDNNK LIGQRILPLD GLQAGYRHIS 800
    LRNEGNKPLS LPTIFCNIVL KTYVPDGFGD IVDALSDPKK FLSITEKRAD 850
    QMRAMGIETS DIADVPSDTS KNDKKGKANT AKANVTPQSS SELRPTTTAA 900
    LASGVEAKKG IELIPQVRIE DLKQMKAYLK HLKKQQKELN SLKKKHAKEH 950
    STMQKLHCTQ VDKIVAQYDK EKSTHEKILE KAMKKKGGSN CLEMKKETEI 1000
    KIQTLTSDHK SKVKEIVAQH TKEWSEMINT HSAEEQEIRD LHLSQQCELL 1050
    KKLLINAHEQ QTQQLKLSHD RESKEMRAHQ AKISMENSKA ISQDKSIKNK 1100
    AERERRVREL NSSNTKKFLE ERKRLAMKQS KEMDQLKKVQ LEHLEFLEKQ 1150
    NEQAKEMQQM VKLEAEMDRR PATVV 1175
    Length:1,175
    Mass (Da):134,464
    Last modified:December 5, 2001 - v3
    Checksum:iAB2C8EB99EF57357
    GO
    Isoform 1 (identifier: Q15147-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-153: Missing.
         154-167: LAFMTNTNGKIPVR → MNNNWNVCFFLFCP

    Show »
    Length:1,022
    Mass (Da):117,162
    Checksum:i4A6A14188161A46C
    GO
    Isoform 3 (identifier: Q15147-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN

    Note: No experimental confirmation available.

    Show »
    Length:1,194
    Mass (Da):136,106
    Checksum:iE6A0912E517D182C
    GO
    Isoform 4 (identifier: Q15147-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         535-535: V → VKKASDDLEHENN

    Note: No experimental confirmation available.

    Show »
    Length:1,187
    Mass (Da):135,845
    Checksum:i8EC5C7445E1052AA
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti447 – 4471A → P in AAB02027. (PubMed:8530101)Curated
    Sequence conflicti757 – 7571F → L in AAB02027. (PubMed:8530101)Curated
    Sequence conflicti787 – 7871L → P in AAB02027. (PubMed:8530101)Curated
    Sequence conflicti840 – 8401K → T in AAB02027. (PubMed:8530101)Curated
    Sequence conflicti902 – 9021A → P in AAB02027. (PubMed:8530101)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti21 – 211A → T.1 Publication
    Corresponds to variant rs6077510 [ dbSNP | Ensembl ].
    VAR_056694
    Natural varianti329 – 3291N → T in ARCND2. 1 Publication
    VAR_068559
    Natural varianti621 – 6211R → C in ARCND2. 1 Publication
    VAR_068560
    Natural varianti621 – 6211R → H in ARCND2. 1 Publication
    VAR_068561
    Natural varianti623 – 6231Y → C in ARCND2. 1 Publication
    VAR_068562
    Natural varianti650 – 6501N → H in ARCND2. 1 Publication
    VAR_068563
    Natural varianti710 – 7101G → S.
    Corresponds to variant rs6118603 [ dbSNP | Ensembl ].
    VAR_056695

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 153153Missing in isoform 1. 1 PublicationVSP_004721Add
    BLAST
    Alternative sequencei154 – 16714LAFMT…KIPVR → MNNNWNVCFFLFCP in isoform 1. 1 PublicationVSP_004722Add
    BLAST
    Alternative sequencei535 – 5351V → VKKASDDLEHENN in isoform 4. CuratedVSP_055182
    Alternative sequencei1154 – 117522AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform 3. CuratedVSP_037818Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L41349 mRNA. Translation: AAB02027.1.
    AL121898 Genomic DNA. No translation available.
    AL121909 Genomic DNA. No translation available.
    AL031652, AL023805 Genomic DNA. Translation: CAI42213.1.
    AL023805, AL031652 Genomic DNA. Translation: CAI43087.1.
    AL031652, AL023805 Genomic DNA. Translation: CAI42218.2.
    AL023805, AL031652 Genomic DNA. Translation: CAI43092.2.
    BC117458 mRNA. Translation: AAI17459.1.
    BC143868 mRNA. Translation: AAI43869.1.
    CCDSiCCDS13104.1. [Q15147-4]
    CCDS13105.1. [Q15147-1]
    CCDS54447.1. [Q15147-5]
    RefSeqiNP_000924.3. NM_000933.3. [Q15147-4]
    NP_001166117.1. NM_001172646.1.
    NP_877949.2. NM_182797.2. [Q15147-1]
    XP_006723633.1. XM_006723570.1. [Q15147-4]
    XP_006723634.1. XM_006723571.1.
    XP_006723635.1. XM_006723572.1. [Q15147-1]
    UniGeneiHs.472101.

    Genome annotation databases

    EnsembliENST00000278655; ENSP00000278655; ENSG00000101333. [Q15147-1]
    ENST00000378473; ENSP00000367734; ENSG00000101333. [Q15147-5]
    ENST00000378493; ENSP00000367754; ENSG00000101333. [Q15147-1]
    ENST00000378501; ENSP00000367762; ENSG00000101333. [Q15147-4]
    ENST00000414679; ENSP00000390616; ENSG00000101333. [Q15147-5]
    GeneIDi5332.
    KEGGihsa:5332.
    UCSCiuc002wnh.3. human. [Q15147-2]
    uc010gbw.1. human. [Q15147-1]
    uc010gbx.3. human.
    uc021wam.1. human. [Q15147-4]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L41349 mRNA. Translation: AAB02027.1 .
    AL121898 Genomic DNA. No translation available.
    AL121909 Genomic DNA. No translation available.
    AL031652 , AL023805 Genomic DNA. Translation: CAI42213.1 .
    AL023805 , AL031652 Genomic DNA. Translation: CAI43087.1 .
    AL031652 , AL023805 Genomic DNA. Translation: CAI42218.2 .
    AL023805 , AL031652 Genomic DNA. Translation: CAI43092.2 .
    BC117458 mRNA. Translation: AAI17459.1 .
    BC143868 mRNA. Translation: AAI43869.1 .
    CCDSi CCDS13104.1. [Q15147-4 ]
    CCDS13105.1. [Q15147-1 ]
    CCDS54447.1. [Q15147-5 ]
    RefSeqi NP_000924.3. NM_000933.3. [Q15147-4 ]
    NP_001166117.1. NM_001172646.1.
    NP_877949.2. NM_182797.2. [Q15147-1 ]
    XP_006723633.1. XM_006723570.1. [Q15147-4 ]
    XP_006723634.1. XM_006723571.1.
    XP_006723635.1. XM_006723572.1. [Q15147-1 ]
    UniGenei Hs.472101.

    3D structure databases

    ProteinModelPortali Q15147.
    SMRi Q15147. Positions 6-855.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111348. 1 interaction.
    IntActi Q15147. 1 interaction.

    PTM databases

    PhosphoSitei Q15147.

    Proteomic databases

    MaxQBi Q15147.
    PaxDbi Q15147.
    PeptideAtlasi Q5JYT3.
    PRIDEi Q15147.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000278655 ; ENSP00000278655 ; ENSG00000101333 . [Q15147-1 ]
    ENST00000378473 ; ENSP00000367734 ; ENSG00000101333 . [Q15147-5 ]
    ENST00000378493 ; ENSP00000367754 ; ENSG00000101333 . [Q15147-1 ]
    ENST00000378501 ; ENSP00000367762 ; ENSG00000101333 . [Q15147-4 ]
    ENST00000414679 ; ENSP00000390616 ; ENSG00000101333 . [Q15147-5 ]
    GeneIDi 5332.
    KEGGi hsa:5332.
    UCSCi uc002wnh.3. human. [Q15147-2 ]
    uc010gbw.1. human. [Q15147-1 ]
    uc010gbx.3. human.
    uc021wam.1. human. [Q15147-4 ]

    Organism-specific databases

    CTDi 5332.
    GeneCardsi GC20P009024.
    HGNCi HGNC:9059. PLCB4.
    MIMi 600810. gene.
    614669. phenotype.
    neXtProti NX_Q15147.
    Orphaneti 137888. Auriculocondylar syndrome.
    PharmGKBi PA33387.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG149692.
    HOVERGENi HBG053609.
    KOi K05858.
    OMAi SFTYMVA.
    OrthoDBi EOG7WDN1N.
    PhylomeDBi Q15147.
    TreeFami TF352235.

    Enzyme and pathway databases

    Reactomei REACT_150312. Synthesis of IP3 and IP4 in the cytosol.
    REACT_15426. PLC beta mediated events.
    REACT_18283. G alpha (q) signalling events.

    Miscellaneous databases

    ChiTaRSi PLCB4. human.
    GeneWikii PLCB4.
    GenomeRNAii 5332.
    NextBioi 20648.
    PROi Q15147.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q15147.
    Bgeei Q15147.
    Genevestigatori Q15147.

    Family and domain databases

    Gene3Di 1.10.238.10. 1 hit.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProi IPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR016280. PLC-beta.
    IPR009535. PLC-beta_CS.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view ]
    PANTHERi PTHR10336. PTHR10336. 1 hit.
    Pfami PF00168. C2. 1 hit.
    PF06631. DUF1154. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF000956. PLC-beta. 1 hit.
    PRINTSi PR00390. PHPHLIPASEC.
    SMARTi SM00239. C2. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 2 hits.
    PROSITEi PS50004. C2. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "cDNA sequence and gene locus of the human retinal phosphoinositide-specific phospholipase-C beta 4 (PLCB4)."
      Alvarez R.A., Ghalayini A.J., Xu P., Hardcastle A., Bhattacharya S., Rao P.N., Pettenati M.J., Anderson R.E., Baehr W.
      Genomics 29:53-61(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Retina.
    2. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-21.
      Tissue: Brain.
    4. Bienvenut W.V., Lilla S., von Kriegsheim A., Lempens A., Kolch W.
      Submitted (DEC-2008) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 2-11; 79-88; 154-163; 181-195; 220-227; 255-266; 366-377; 435-455; 516-528; 577-586; 606-717; 762-780; 786-797; 822-847; 854-871; 883-908; 910-918; 1023-1039 AND 1139-1149, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Ovarian carcinoma.
    5. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-886, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    6. Cited for: VARIANTS ARCND2 THR-329; HIS-621; CYS-621; CYS-623 AND HIS-650.

    Entry informationi

    Entry nameiPLCB4_HUMAN
    AccessioniPrimary (citable) accession number: Q15147
    Secondary accession number(s): B7ZLK6
    , E2QRH8, Q17R56, Q5JYS8, Q5JYS9, Q5JYT0, Q5JYT3, Q5JYT4, Q9BQW5, Q9BQW6, Q9BQW8, Q9UJQ2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: December 5, 2001
    Last modified: October 1, 2014
    This is version 153 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3