Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4

Gene

PLCB4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction.

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei328 – 3281PROSITE-ProRule annotation
Active sitei375 – 3751PROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BRENDAi3.1.4.11. 2681.
ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.
REACT_15426. PLC beta mediated events.
REACT_18283. G alpha (q) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-beta-4
Phospholipase C-beta-4
Short name:
PLC-beta-4
Gene namesi
Name:PLCB4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:9059. PLCB4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Involvement in diseasei

Auriculocondylar syndrome 2 (ARCND2)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA craniofacial malformation syndrome characterized by variable mandibular anomalies, including mild to severe micrognathia, temporomandibular joint ankylosis, cleft palate, and a characteristic ear malformation that consists of separation of the lobule from the external ear, giving the appearance of a question mark (question-mark ear). Other frequently described features include prominent cheeks, cupped and posteriorly rotated ears, preauricular tags, and microstomia.

See also OMIM:614669
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti329 – 3291N → T in ARCND2. 1 Publication
VAR_068559
Natural varianti621 – 6211R → C in ARCND2. 1 Publication
VAR_068560
Natural varianti621 – 6211R → H in ARCND2. 1 Publication
VAR_068561
Natural varianti623 – 6231Y → C in ARCND2. 1 Publication
VAR_068562
Natural varianti650 – 6501N → H in ARCND2. 1 Publication
VAR_068563

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi614669. phenotype.
Orphaneti137888. Auriculocondylar syndrome.
PharmGKBiPA33387.

Polymorphism and mutation databases

BioMutaiPLCB4.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 117511741-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4PRO_0000088495Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication
Modified residuei886 – 8861Phosphothreonine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ15147.
PaxDbiQ15147.
PeptideAtlasiQ5JYT3.
PRIDEiQ15147.

PTM databases

PhosphoSiteiQ15147.

Expressioni

Tissue specificityi

Preferentially expressed in the retina.

Gene expression databases

BgeeiQ15147.
ExpressionAtlasiQ15147. baseline and differential.
GenevisibleiQ15147. HS.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
RELQ048643EBI-998637,EBI-307352

Protein-protein interaction databases

BioGridi111348. 1 interaction.
IntActiQ15147. 2 interactions.
STRINGi9606.ENSP00000334105.

Structurei

3D structure databases

ProteinModelPortaliQ15147.
SMRiQ15147. Positions 6-855.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini313 – 463151PI-PLC X-boxPROSITE-ProRule annotationAdd
BLAST
Domaini565 – 681117PI-PLC Y-boxPROSITE-ProRule annotationAdd
BLAST
Domaini688 – 78699C2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00760000118936.
HOGENOMiHOG000232046.
HOVERGENiHBG053609.
InParanoidiQ15147.
KOiK05858.
OMAiSFTYMVA.
OrthoDBiEOG7WDN1N.
PhylomeDBiQ15147.
TreeFamiTF352235.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR011993. PH-like_dom.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PfamiPF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform 2 (identifier: Q15147-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKPYEFNWQ KEVPSFLQEG AVFDRYEEES FVFEPNCLFK VDEFGFFLTW
60 70 80 90 100
RSEGKEGQVL ECSLINSIRS GAIPKDPKIL AALEAVGKSE NDLEGRIVCV
110 120 130 140 150
CSGTDLVNIS FTYMVAENPE VTKQWVEGLR SIIHNFRANN VSPMTCLKKH
160 170 180 190 200
WMKLAFMTNT NGKIPVRSIT RTFASGKTEK VIFQALKELG LPSGKNDEIE
210 220 230 240 250
PTAFSYEKFY ELTQKICPRT DIEDLFKKIN GDKTDYLTVD QLVSFLNEHQ
260 270 280 290 300
RDPRLNEILF PFYDAKRAMQ IIEMYEPDED LKKKGLISSD GFCRYLMSDE
310 320 330 340 350
NAPVFLDRLE LYQEMDHPLA HYFISSSHNT YLTGRQFGGK SSVEMYRQVL
360 370 380 390 400
LAGCRCVELD CWDGKGEDQE PIITHGKAMC TDILFKDVIQ AIKETAFVTS
410 420 430 440 450
EYPVILSFEN HCSKYQQYKM SKYCEDLFGD LLLKQALESH PLEPGRALPS
460 470 480 490 500
PNDLKRKILI KNKRLKPEVE KKQLEALRSM MEAGESASPA NILEDDNEEE
510 520 530 540 550
IESADQEEEA HPEFKFGNEL SADDLGHKEA VANSVKKGLV TVEDEQAWMA
560 570 580 590 600
SYKYVGATTN IHPYLSTMIN YAQPVKFQGF HVAEERNIHY NMSSFNESVG
610 620 630 640 650
LGYLKTHAIE FVNYNKRQMS RIYPKGGRVD SSNYMPQIFW NAGCQMVSLN
660 670 680 690 700
YQTPDLAMQL NQGKFEYNGS CGYLLKPDFM RRPDRTFDPF SETPVDGVIA
710 720 730 740 750
ATCSVQVISG QFLSDKKIGT YVEVDMYGLP TDTIRKEFRT RMVMNNGLNP
760 770 780 790 800
VYNEESFVFR KVILPDLAVL RIAVYDDNNK LIGQRILPLD GLQAGYRHIS
810 820 830 840 850
LRNEGNKPLS LPTIFCNIVL KTYVPDGFGD IVDALSDPKK FLSITEKRAD
860 870 880 890 900
QMRAMGIETS DIADVPSDTS KNDKKGKANT AKANVTPQSS SELRPTTTAA
910 920 930 940 950
LASGVEAKKG IELIPQVRIE DLKQMKAYLK HLKKQQKELN SLKKKHAKEH
960 970 980 990 1000
STMQKLHCTQ VDKIVAQYDK EKSTHEKILE KAMKKKGGSN CLEMKKETEI
1010 1020 1030 1040 1050
KIQTLTSDHK SKVKEIVAQH TKEWSEMINT HSAEEQEIRD LHLSQQCELL
1060 1070 1080 1090 1100
KKLLINAHEQ QTQQLKLSHD RESKEMRAHQ AKISMENSKA ISQDKSIKNK
1110 1120 1130 1140 1150
AERERRVREL NSSNTKKFLE ERKRLAMKQS KEMDQLKKVQ LEHLEFLEKQ
1160 1170
NEQAKEMQQM VKLEAEMDRR PATVV
Length:1,175
Mass (Da):134,464
Last modified:December 5, 2001 - v3
Checksum:iAB2C8EB99EF57357
GO
Isoform 1 (identifier: Q15147-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-153: Missing.
     154-167: LAFMTNTNGKIPVR → MNNNWNVCFFLFCP

Show »
Length:1,022
Mass (Da):117,162
Checksum:i4A6A14188161A46C
GO
Isoform 3 (identifier: Q15147-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN

Note: No experimental confirmation available.
Show »
Length:1,194
Mass (Da):136,106
Checksum:iE6A0912E517D182C
GO
Isoform 4 (identifier: Q15147-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-535: V → VKKASDDLEHENN

Note: No experimental confirmation available.
Show »
Length:1,187
Mass (Da):135,845
Checksum:i8EC5C7445E1052AA
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti447 – 4471A → P in AAB02027 (PubMed:8530101).Curated
Sequence conflicti757 – 7571F → L in AAB02027 (PubMed:8530101).Curated
Sequence conflicti787 – 7871L → P in AAB02027 (PubMed:8530101).Curated
Sequence conflicti840 – 8401K → T in AAB02027 (PubMed:8530101).Curated
Sequence conflicti902 – 9021A → P in AAB02027 (PubMed:8530101).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti21 – 211A → T.1 Publication
Corresponds to variant rs6077510 [ dbSNP | Ensembl ].
VAR_056694
Natural varianti329 – 3291N → T in ARCND2. 1 Publication
VAR_068559
Natural varianti621 – 6211R → C in ARCND2. 1 Publication
VAR_068560
Natural varianti621 – 6211R → H in ARCND2. 1 Publication
VAR_068561
Natural varianti623 – 6231Y → C in ARCND2. 1 Publication
VAR_068562
Natural varianti650 – 6501N → H in ARCND2. 1 Publication
VAR_068563
Natural varianti710 – 7101G → S.
Corresponds to variant rs6118603 [ dbSNP | Ensembl ].
VAR_056695

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 153153Missing in isoform 1. 1 PublicationVSP_004721Add
BLAST
Alternative sequencei154 – 16714LAFMT…KIPVR → MNNNWNVCFFLFCP in isoform 1. 1 PublicationVSP_004722Add
BLAST
Alternative sequencei535 – 5351V → VKKASDDLEHENN in isoform 4. CuratedVSP_055182
Alternative sequencei1154 – 117522AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform 3. CuratedVSP_037818Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L41349 mRNA. Translation: AAB02027.1.
AL121898 Genomic DNA. No translation available.
AL121909 Genomic DNA. No translation available.
AL031652, AL023805 Genomic DNA. Translation: CAI42213.1.
AL023805, AL031652 Genomic DNA. Translation: CAI43087.1.
AL031652, AL023805 Genomic DNA. Translation: CAI42218.2.
AL023805, AL031652 Genomic DNA. Translation: CAI43092.2.
BC117458 mRNA. Translation: AAI17459.1.
BC143868 mRNA. Translation: AAI43869.1.
CCDSiCCDS13104.1. [Q15147-4]
CCDS13105.1. [Q15147-1]
CCDS54447.1. [Q15147-5]
RefSeqiNP_000924.3. NM_000933.3. [Q15147-4]
NP_001166117.1. NM_001172646.1. [Q15147-5]
NP_877949.2. NM_182797.2. [Q15147-1]
XP_011527554.1. XM_011529252.1. [Q15147-4]
UniGeneiHs.472101.

Genome annotation databases

EnsembliENST00000278655; ENSP00000278655; ENSG00000101333.
ENST00000378473; ENSP00000367734; ENSG00000101333. [Q15147-5]
ENST00000378493; ENSP00000367754; ENSG00000101333.
ENST00000378501; ENSP00000367762; ENSG00000101333. [Q15147-4]
ENST00000414679; ENSP00000390616; ENSG00000101333. [Q15147-5]
GeneIDi5332.
KEGGihsa:5332.
UCSCiuc002wnh.3. human. [Q15147-2]
uc010gbw.1. human. [Q15147-1]
uc010gbx.3. human.
uc021wam.1. human. [Q15147-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L41349 mRNA. Translation: AAB02027.1.
AL121898 Genomic DNA. No translation available.
AL121909 Genomic DNA. No translation available.
AL031652, AL023805 Genomic DNA. Translation: CAI42213.1.
AL023805, AL031652 Genomic DNA. Translation: CAI43087.1.
AL031652, AL023805 Genomic DNA. Translation: CAI42218.2.
AL023805, AL031652 Genomic DNA. Translation: CAI43092.2.
BC117458 mRNA. Translation: AAI17459.1.
BC143868 mRNA. Translation: AAI43869.1.
CCDSiCCDS13104.1. [Q15147-4]
CCDS13105.1. [Q15147-1]
CCDS54447.1. [Q15147-5]
RefSeqiNP_000924.3. NM_000933.3. [Q15147-4]
NP_001166117.1. NM_001172646.1. [Q15147-5]
NP_877949.2. NM_182797.2. [Q15147-1]
XP_011527554.1. XM_011529252.1. [Q15147-4]
UniGeneiHs.472101.

3D structure databases

ProteinModelPortaliQ15147.
SMRiQ15147. Positions 6-855.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111348. 1 interaction.
IntActiQ15147. 2 interactions.
STRINGi9606.ENSP00000334105.

PTM databases

PhosphoSiteiQ15147.

Polymorphism and mutation databases

BioMutaiPLCB4.

Proteomic databases

MaxQBiQ15147.
PaxDbiQ15147.
PeptideAtlasiQ5JYT3.
PRIDEiQ15147.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000278655; ENSP00000278655; ENSG00000101333.
ENST00000378473; ENSP00000367734; ENSG00000101333. [Q15147-5]
ENST00000378493; ENSP00000367754; ENSG00000101333.
ENST00000378501; ENSP00000367762; ENSG00000101333. [Q15147-4]
ENST00000414679; ENSP00000390616; ENSG00000101333. [Q15147-5]
GeneIDi5332.
KEGGihsa:5332.
UCSCiuc002wnh.3. human. [Q15147-2]
uc010gbw.1. human. [Q15147-1]
uc010gbx.3. human.
uc021wam.1. human. [Q15147-4]

Organism-specific databases

CTDi5332.
GeneCardsiGC20P009024.
HGNCiHGNC:9059. PLCB4.
MIMi600810. gene.
614669. phenotype.
neXtProtiNX_Q15147.
Orphaneti137888. Auriculocondylar syndrome.
PharmGKBiPA33387.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00760000118936.
HOGENOMiHOG000232046.
HOVERGENiHBG053609.
InParanoidiQ15147.
KOiK05858.
OMAiSFTYMVA.
OrthoDBiEOG7WDN1N.
PhylomeDBiQ15147.
TreeFamiTF352235.

Enzyme and pathway databases

BRENDAi3.1.4.11. 2681.
ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.
REACT_15426. PLC beta mediated events.
REACT_18283. G alpha (q) signalling events.

Miscellaneous databases

ChiTaRSiPLCB4. human.
GeneWikiiPLCB4.
GenomeRNAii5332.
NextBioi20648.
PROiQ15147.
SOURCEiSearch...

Gene expression databases

BgeeiQ15147.
ExpressionAtlasiQ15147. baseline and differential.
GenevisibleiQ15147. HS.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR011993. PH-like_dom.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PfamiPF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA sequence and gene locus of the human retinal phosphoinositide-specific phospholipase-C beta 4 (PLCB4)."
    Alvarez R.A., Ghalayini A.J., Xu P., Hardcastle A., Bhattacharya S., Rao P.N., Pettenati M.J., Anderson R.E., Baehr W.
    Genomics 29:53-61(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Retina.
  2. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-21.
    Tissue: Brain.
  4. Bienvenut W.V., Lilla S., von Kriegsheim A., Lempens A., Kolch W.
    Submitted (DEC-2008) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-11; 79-88; 154-163; 181-195; 220-227; 255-266; 366-377; 435-455; 516-528; 577-586; 606-717; 762-780; 786-797; 822-847; 854-871; 883-908; 910-918; 1023-1039 AND 1139-1149, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Ovarian carcinoma.
  5. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-886, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. Cited for: VARIANTS ARCND2 THR-329; HIS-621; CYS-621; CYS-623 AND HIS-650.

Entry informationi

Entry nameiPLCB4_HUMAN
AccessioniPrimary (citable) accession number: Q15147
Secondary accession number(s): B7ZLK6
, E2QRH8, Q17R56, Q5JYS8, Q5JYS9, Q5JYT0, Q5JYT3, Q5JYT4, Q9BQW5, Q9BQW6, Q9BQW8, Q9UJQ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: December 5, 2001
Last modified: July 22, 2015
This is version 161 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.