Reviewed,
UniProtKB/Swiss-Prot Q15147 (PLCB4_HUMAN)
Last modified
February 9, 2010.
Version 105.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4 EC=3.1.4.11 Alternative name(s): Phosphoinositide phospholipase C-beta-4 Phospholipase C-beta-4 Short name=PLC-beta-4 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1175 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction. |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. |
| Cofactor | Calcium. |
| Tissue specificity | Preferentially expressed in the retina. |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid degradation |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Calcium |
| Molecular function | Hydrolase Transducer |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | intracellular signaling cascade Inferred from electronic annotation. Source: InterPro lipid catabolic processInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytosol Inferred from Experiment. Source: Reactome |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW phosphoinositide phospholipase C activityInferred from electronic annotation. Source: EC protein bindingInferred from physical interaction. Source: IntAct signal transducer activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 2 (identifier: Q15147-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q15147-2) The sequence of this isoform differs from the canonical sequence as follows: 1-153: Missing. 154-167: LAFMTNTNGKIPVR → MNNNWNVCFFLFCP | ||||||
| Isoform 3 (identifier: Q15147-4) The sequence of this isoform differs from the canonical sequence as follows: 1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.4 | ||||||
| Chain | 2 – 1175 | 1174 | 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4 | PRO_0000088495 | |||||
Regions | |||||||||
| Domain | 313 – 463 | 151 | PI-PLC X-box | ||||||
| Domain | 565 – 681 | 117 | PI-PLC Y-box | ||||||
| Domain | 688 – 786 | 99 | C2 | ||||||
Sites | |||||||||
| Active site | 328 | 1 | By similarity | ||||||
| Active site | 375 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.4 | ||||||
| Modified residue | 620 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 623 | 1 | Phosphotyrosine Ref.5 | ||||||
| Modified residue | 890 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 153 | 153 | Missing in isoform 1. | VSP_004721 | |||||
| Alternative sequence | 154 – 167 | 14 | LAFMT…KIPVR → MNNNWNVCFFLFCP in isoform 1. | VSP_004722 | |||||
| Alternative sequence | 1154 – 1175 | 22 | AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform 3. | VSP_037818 | |||||
| Natural variant | 21 | 1 | A → T: dbSNP rs6077510. Ref.3 | VAR_056694 | |||||
| Natural variant | 710 | 1 | G → S: dbSNP rs6118603. | VAR_056695 | |||||
Experimental info | |||||||||
| Sequence conflict | 447 | 1 | A → P in AAB02027. Ref.1 | ||||||
| Sequence conflict | 757 | 1 | F → L in AAB02027. Ref.1 | ||||||
| Sequence conflict | 787 | 1 | L → P in AAB02027. Ref.1 | ||||||
| Sequence conflict | 840 | 1 | K → T in AAB02027. Ref.1 | ||||||
| Sequence conflict | 902 | 1 | A → P in AAB02027. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA sequence and gene locus of the human retinal phosphoinositide-specific phospholipase-C beta 4 (PLCB4)." Alvarez R.A., Ghalayini A.J., Xu P., Hardcastle A., Bhattacharya S., Rao P.N., Pettenati M.J., Anderson R.E., Baehr W. Genomics 29:53-61(1995) [PubMed: 8530101] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Retina. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-21. Tissue: Brain. |
| [4] | Bienvenut W.V., Lilla S., von Kriegsheim A., Lempens A., Kolch W. Submitted (DEC-2008) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-11; 79-88; 154-163; 181-195; 220-227; 255-266; 366-377; 435-455; 516-528; 577-586; 606-717; 762-780; 786-797; 822-847; 854-871; 883-908; 910-918; 1023-1039 AND 1139-1149, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: Ovarian carcinoma. |
| [5] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-620 AND TYR-623, MASS SPECTROMETRY. Tissue: Epithelium. |
| [6] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-890, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L41349 mRNA. Translation: AAB02027.1. AL031652, AL023805 Genomic DNA. Translation: CAI42213.1. AL023805, AL031652 Genomic DNA. Translation: CAI43087.1. AL031652, AL023805 Genomic DNA. Translation: CAI42218.2. AL023805, AL031652 Genomic DNA. Translation: CAI43092.2. BC117458 mRNA. Translation: AAI17459.1. BC143868 mRNA. Translation: AAI43869.1. |
| IPI | IPI00014897. IPI00783004. IPI00883983. |
| RefSeq | NP_000924.2. NP_877949.1. |
| UniGene | Hs.472101 |
3D structure databases | |
| SMR | Q15147. Positions 12-821. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q15147. 1 interaction. |
| STRING | Q15147. |
PTM databases | |
| PhosphoSite | Q15147. |
Proteomic databases | |
| PeptideAtlas | Q5JYT3. |
| PRIDE | Q15147. |
Genome annotation databases | |
| Ensembl | ENST00000278655; ENSP00000278655; ENSG00000101333; Homo sapiens. [Genome view] ENST00000378493; ENSP00000367754; ENSG00000101333; Homo sapiens. [Genome view] |
| GeneID | 5332. |
| KEGG | hsa:5332. |
| UCSC | uc002wnf.1. human. uc002wnh.1. human. |
Organism-specific databases | |
| CTD | 5332. |
| GeneCards | GC20P009024. |
| H-InvDB | HIX0015635. |
| HGNC | HGNC:9059. PLCB4. |
| MIM | 600810. gene. |
| PharmGKB | PA33387. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG15690. |
| HOVERGEN | Q15147. |
| OMA | FLTWRSE. |
| PhylomeDB | Q15147. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.11. 247. |
| Reactome | REACT_14797. Signaling by GPCR. REACT_15295. Opioid Signalling. |
Gene expression databases | |
| ArrayExpress | Q15147. |
| Bgee | Q15147. |
| Genevestigator | Q15147. |
| GermOnline | ENSG00000101333. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR015359. Phospholipase_C_EF-hand-like. IPR001192. Phospholipase_C_Pinositol-sp_C. IPR001711. Phospholipase_C_Pinositol-sp_Y. IPR016280. PLC-beta. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR000909. PLipase_C_PInositol-sp_X_dom. [Graphical view] |
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 1 hit. G3DSA:3.20.20.190. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF09279. efhand_like. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. [Graphical view] |
| PIRSF | PIRSF000956. PLC-beta. 1 hit. |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| PROSITE | PS50004. C2. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 20648. |
| SOURCE | Search... |
Entry information
| Entry name | PLCB4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15147 Secondary accession number(s): B7ZLK6 Q9UJQ2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


