Q15131 (CDK10_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclin-dependent kinase 10 EC=2.7.11.22 Alternative name(s): Cell division protein kinase 10 Serine/threonine-protein kinase PISSLRE | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 360 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | negative regulation of cell proliferation Traceable author statement Ref.1. Source: ProtInc traversing start control point of mitotic cell cycleTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW cyclin-dependent protein serine/threonine kinase activityTraceable author statement Ref.3. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ETS2 | P15036 | 2 | EBI-1646959,EBI-1646991 | |
| HSP90AB1 | P08238 | 2 | EBI-1646959,EBI-352572 | |
| PIN1 | Q13526 | 5 | EBI-1646959,EBI-714158 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15131-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15131-2) The sequence of this isoform differs from the canonical sequence as follows: 1-71: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q15131-3) The sequence of this isoform differs from the canonical sequence as follows: 1-71: Missing. 306-311: Missing. | ||||||
| Isoform 4 (identifier: Q15131-4) The sequence of this isoform differs from the canonical sequence as follows: 1-71: Missing. 329-360: PCEPELMPTFPHHRNKRAAPATSEGQSKRCKP → RLPISGVCEGCREPG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 360 | 360 | Cyclin-dependent kinase 10 | PRO_0000085809 | |||||
Regions | |||||||||
| Domain | 39 – 323 | 285 | Protein kinase | ||||||
| Nucleotide binding | 45 – 53 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 163 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 68 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 196 | 1 | Phosphothreonine Ref.10 Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 71 | 71 | Missing in isoform 2, isoform 3 and isoform 4. | VSP_021642 | |||||
| Alternative sequence | 306 – 311 | 6 | Missing in isoform 3. | VSP_021643 | |||||
| Alternative sequence | 329 – 360 | 32 | PCEPE…KRCKP → RLPISGVCEGCREPG in isoform 4. | VSP_021644 | |||||
| Natural variant | 96 | 1 | P → L. Ref.12 | VAR_041983 | |||||
| Natural variant | 168 | 1 | N → S. Ref.12 Corresponds to variant rs56340740 [ dbSNP | Ensembl ]. | VAR_041984 | |||||
| Natural variant | 342 | 1 | R → H. Ref.12 Corresponds to variant rs55757604 [ dbSNP | Ensembl ]. | VAR_041985 | |||||
| Natural variant | 358 | 1 | C → Y. Ref.12 Corresponds to variant rs56242003 [ dbSNP | Ensembl ]. | VAR_041986 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PISSLRE, a human novel CDC2-related protein kinase." Grana X., Claudio P.P., De Luca A., Sang N., Giordano A. Oncogene 9:2097-2103(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [2] | Grana X., Claudio P.P., De Luca A., Sang N., Giordano A. Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "Molecular cloning of PISSLRE, a novel putative member of the cdk family of protein serine/threonine kinases." Brambilla R., Draetta G. Oncogene 9:3037-3041(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "The PISSLRE gene: structure, exon skipping, and exclusion as tumor suppressor in breast cancer." Crawford J., Ianzano L., Savino M., Whitmore S., Cleton-Jansen A.-M., Settasatiani C., D'Apolito M., Seshadri R., Pronk J.C., Auerbach A.D., Verlander P.C., Mathew C.G., Tipping A.J., Doggett N.A., Zelante L., Callen D.F., Savoia A. Genomics 56:90-97(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon. |
| [6] | Bechtel S., Schupp I., Duda A., Wellenreuther R., Mehrle A., Ruschke V., Poustka A., Wiemann S. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [7] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Colon and Lung. |
| [10] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-96; SER-168; HIS-342 AND TYR-358. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L33264 mRNA. Translation: AAA60092.2. X78342 mRNA. Translation: CAA55137.1. AJ010341 AJ010344 Genomic DNA. Translation: CAB37619.1.AM392903 mRNA. Translation: CAL37781.1. AK296631 mRNA. Translation: BAH12406.1. AM393177 mRNA. Translation: CAL38055.1. AM393204 mRNA. Translation: CAL38082.1. AC010538 Genomic DNA. No translation available. CH471184 Genomic DNA. Translation: EAW66701.1. CH471184 Genomic DNA. Translation: EAW66703.1. CH471184 Genomic DNA. Translation: EAW66704.1. CH471184 Genomic DNA. Translation: EAW66706.1. CH471184 Genomic DNA. Translation: EAW66707.1. CH471184 Genomic DNA. Translation: EAW66708.1. BC017342 mRNA. Translation: AAH17342.1. BC025301 mRNA. Translation: AAH25301.1. |
| IPI | IPI00014873. IPI00642595. IPI00788960. IPI01015440. |
| PIR | S49330. |
| RefSeq | NP_001092003.2. NM_001098533.2. NP_001153839.1. NM_001160367.1. NP_443713.2. NM_052987.3. NP_443714.3. NM_052988.4. |
| UniGene | Hs.699177. |
3D structure databases | |
| ProteinModelPortal | Q15131. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q15131. 4 interactions. |
| STRING | 9606.ENSP00000338673. |
PTM databases | |
| PhosphoSite | Q15131. |
Polymorphism databases | |
| DMDM | 6226784. |
Proteomic databases | |
| PaxDb | Q15131. |
| PRIDE | Q15131. |
Protocols and materials databases | |
| DNASU | 8558. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000353379; ENSP00000338673; ENSG00000185324. ENST00000505473; ENSP00000424415; ENSG00000185324. |
| GeneID | 8558. |
| KEGG | hsa:8558. |
| UCSC | uc002fod.3. human. uc002foe.3. human. uc002fof.3. human. |
Organism-specific databases | |
| CTD | 8558. |
| GeneCards | GC16P089753. |
| HGNC | HGNC:1770. CDK10. |
| MIM | 603464. gene. |
| neXtProt | NX_Q15131. |
| PharmGKB | PA26307. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG014652. |
| InParanoid | Q15131. |
| KO | K02449. |
| OMA | MEYCEQD. |
| OrthoDB | EOG4WSW9V. |
| PhylomeDB | Q15131. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.22. 2681. |
Gene expression databases | |
| ArrayExpress | Q15131. |
| Bgee | Q15131. |
| CleanEx | HS_CDK10. |
| Genevestigator | Q15131. |
| GermOnline | ENSG00000185324. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL1795191. |
| GenomeRNAi | 8558. |
| NextBio | 32077. |
| SOURCE | Search... |
Entry information
| Entry name | CDK10_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15131 Secondary accession number(s): A8MXU6 Q6PJC0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
