Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 10

Gene

CDK10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cyclin-dependent kinase that phosphorylates the transcription factor ETS2 (in vitro) and positively controls its proteasomal degradation (in cells).1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei68ATPPROSITE-ProRule annotation1
Active sitei163Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi45 – 53ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • cyclin-dependent protein serine/threonine kinase activity Source: ProtInc

GO - Biological processi

  • negative regulation of cell proliferation Source: ProtInc
  • positive regulation of MAPK cascade Source: Ensembl
  • traversing start control point of mitotic cell cycle Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS02463-MONOMER.
BRENDAi2.7.11.22. 2681.
SignaLinkiQ15131.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 10 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 10
Serine/threonine-protein kinase PISSLRE
Gene namesi
Name:CDK10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:1770. CDK10.

Pathology & Biotechi

Organism-specific databases

DisGeNETi8558.
OpenTargetsiENSG00000185324.
PharmGKBiPA26307.

Chemistry databases

ChEMBLiCHEMBL1795191.

Polymorphism and mutation databases

BioMutaiCDK10.
DMDMi6226784.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000858091 – 360Cyclin-dependent kinase 10Add BLAST360

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei196PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ15131.
MaxQBiQ15131.
PaxDbiQ15131.
PeptideAtlasiQ15131.
PRIDEiQ15131.

PTM databases

iPTMnetiQ15131.
PhosphoSitePlusiQ15131.

Expressioni

Gene expression databases

BgeeiENSG00000185324.
CleanExiHS_CDK10.
ExpressionAtlasiQ15131. baseline and differential.
GenevisibleiQ15131. HS.

Organism-specific databases

HPAiHPA059634.
HPA067060.

Interactioni

Subunit structurei

Heterodimer with FAM58A/Cyclin-M, the interaction is required for kinase activity. Interacts with ETS2.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ETS2P150363EBI-11507283,EBI-1646991
FAM58AQ8N1B35EBI-11507283,EBI-3925043
HSP90AB1P082382EBI-1646959,EBI-352572
PIN1Q135265EBI-1646959,EBI-714158

Protein-protein interaction databases

BioGridi114128. 15 interactors.
IntActiQ15131. 16 interactors.
STRINGi9606.ENSP00000338673.

Structurei

3D structure databases

ProteinModelPortaliQ15131.
SMRiQ15131.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini39 – 323Protein kinasePROSITE-ProRule annotationAdd BLAST285

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0663. Eukaryota.
ENOG410XQ50. LUCA.
GeneTreeiENSGT00830000128256.
HOVERGENiHBG014652.
InParanoidiQ15131.
KOiK02449.
OMAiILKRCQH.
OrthoDBiEOG091G048P.
PhylomeDBiQ15131.
TreeFamiTF101026.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15131-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEPDLECEQ IRLKCIRKEG FFTVPPEHRL GRCRSVKEFE KLNRIGEGTY
60 70 80 90 100
GIVYRARDTQ TDEIVALKKV RMDKEKDGIP ISSLREITLL LRLRHPNIVE
110 120 130 140 150
LKEVVVGNHL ESIFLVMGYC EQDLASLLEN MPTPFSEAQV KCIVLQVLRG
160 170 180 190 200
LQYLHRNFII HRDLKVSNLL MTDKGCVKTA DFGLARAYGV PVKPMTPKVV
210 220 230 240 250
TLWYRAPELL LGTTTQTTSI DMWAVGCILA ELLAHRPLLP GTSEIHQIDL
260 270 280 290 300
IVQLLGTPSE NIWPGFSKLP LVGQYSLRKQ PYNNLKHKFP WLSEAGLRLL
310 320 330 340 350
HFLFMYDPKK RATAGDCLES SYFKEKPLPC EPELMPTFPH HRNKRAAPAT
360
SEGQSKRCKP
Length:360
Mass (Da):41,038
Last modified:November 1, 1996 - v1
Checksum:i25B28560961103F4
GO
Isoform 2 (identifier: Q15131-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.

Note: No experimental confirmation available.
Show »
Length:289
Mass (Da):32,731
Checksum:i4C1854D5E1858B32
GO
Isoform 3 (identifier: Q15131-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     306-311: Missing.

Show »
Length:283
Mass (Da):31,944
Checksum:iC6B5F44BF84F9B88
GO
Isoform 4 (identifier: Q15131-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     329-360: PCEPELMPTFPHHRNKRAAPATSEGQSKRCKP → RLPISGVCEGCREPG

Show »
Length:272
Mass (Da):30,702
Checksum:i6F30BB76F69F772D
GO
Isoform 5 (identifier: Q15131-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-54: GTYGIVY → D
     180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW
     195-360: Missing.

Note: No experimental confirmation available.
Show »
Length:188
Mass (Da):21,512
Checksum:i05E92EF153FC1303
GO
Isoform 6 (identifier: Q15131-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-54: GTYGIVY → D
     141-160: KCIVLQVLRGLQYLHRNFII → RGRGAWGGGMGFMGPCGAHL
     161-360: Missing.

Note: No experimental confirmation available.
Show »
Length:154
Mass (Da):17,446
Checksum:iADC10B30602C2148
GO
Isoform 7 (identifier: Q15131-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW

Note: No experimental confirmation available.
Show »
Length:289
Mass (Da):32,662
Checksum:i30C4754ACDF5A8EE
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04198396P → L.1 PublicationCorresponds to variant rs55819627dbSNPEnsembl.1
Natural variantiVAR_041984168N → S.1 PublicationCorresponds to variant rs56340740dbSNPEnsembl.1
Natural variantiVAR_041985342R → H.1 PublicationCorresponds to variant rs55757604dbSNPEnsembl.1
Natural variantiVAR_041986358C → Y.1 PublicationCorresponds to variant rs56242003dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0216421 – 71Missing in isoform 2, isoform 3, isoform 4 and isoform 7. 4 PublicationsAdd BLAST71
Alternative sequenceiVSP_05496948 – 54GTYGIVY → D in isoform 5 and isoform 6. 1 Publication7
Alternative sequenceiVSP_054970141 – 160KCIVL…RNFII → RGRGAWGGGMGFMGPCGAHL in isoform 6. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_054971161 – 360Missing in isoform 6. 1 PublicationAdd BLAST200
Alternative sequenceiVSP_054972180 – 194ADFGL…VPVKP → GGCNLGQALSLDGTW in isoform 5 and isoform 7. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_054973195 – 360Missing in isoform 5. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_021643306 – 311Missing in isoform 3. 2 Publications6
Alternative sequenceiVSP_021644329 – 360PCEPE…KRCKP → RLPISGVCEGCREPG in isoform 4. 2 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L33264 mRNA. Translation: AAA60092.2.
X78342 mRNA. Translation: CAA55137.1.
AJ010341
, AJ010342, AJ010343, AJ010344 Genomic DNA. Translation: CAB37619.1.
AM392903 mRNA. Translation: CAL37781.1.
AK075036 mRNA. Translation: BAG52055.1.
AK290485 mRNA. Translation: BAF83174.1.
AK292351 mRNA. Translation: BAF85040.1.
AK296631 mRNA. Translation: BAH12406.1.
AM393177 mRNA. Translation: CAL38055.1.
AM393204 mRNA. Translation: CAL38082.1.
AC010538 Genomic DNA. No translation available.
CH471184 Genomic DNA. Translation: EAW66701.1.
CH471184 Genomic DNA. Translation: EAW66703.1.
CH471184 Genomic DNA. Translation: EAW66704.1.
CH471184 Genomic DNA. Translation: EAW66705.1.
CH471184 Genomic DNA. Translation: EAW66706.1.
CH471184 Genomic DNA. Translation: EAW66707.1.
CH471184 Genomic DNA. Translation: EAW66708.1.
CH471184 Genomic DNA. Translation: EAW66710.1.
BC017342 mRNA. Translation: AAH17342.1.
BC025301 mRNA. Translation: AAH25301.1.
CCDSiCCDS10984.2. [Q15131-1]
CCDS32514.2. [Q15131-4]
PIRiS49330.
RefSeqiNP_001092003.2. NM_001098533.2. [Q15131-3]
NP_001153839.1. NM_001160367.1. [Q15131-2]
NP_443713.2. NM_052987.3. [Q15131-4]
NP_443714.3. NM_052988.4. [Q15131-1]
XP_016879297.1. XM_017023808.1. [Q15131-2]
XP_016879298.1. XM_017023809.1. [Q15131-3]
XP_016879299.1. XM_017023810.1. [Q15131-4]
UniGeneiHs.699177.

Genome annotation databases

EnsembliENST00000353379; ENSP00000338673; ENSG00000185324. [Q15131-1]
ENST00000505473; ENSP00000424415; ENSG00000185324. [Q15131-4]
ENST00000617879; ENSP00000484357; ENSG00000185324. [Q15131-4]
GeneIDi8558.
KEGGihsa:8558.
UCSCiuc002fod.4. human. [Q15131-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L33264 mRNA. Translation: AAA60092.2.
X78342 mRNA. Translation: CAA55137.1.
AJ010341
, AJ010342, AJ010343, AJ010344 Genomic DNA. Translation: CAB37619.1.
AM392903 mRNA. Translation: CAL37781.1.
AK075036 mRNA. Translation: BAG52055.1.
AK290485 mRNA. Translation: BAF83174.1.
AK292351 mRNA. Translation: BAF85040.1.
AK296631 mRNA. Translation: BAH12406.1.
AM393177 mRNA. Translation: CAL38055.1.
AM393204 mRNA. Translation: CAL38082.1.
AC010538 Genomic DNA. No translation available.
CH471184 Genomic DNA. Translation: EAW66701.1.
CH471184 Genomic DNA. Translation: EAW66703.1.
CH471184 Genomic DNA. Translation: EAW66704.1.
CH471184 Genomic DNA. Translation: EAW66705.1.
CH471184 Genomic DNA. Translation: EAW66706.1.
CH471184 Genomic DNA. Translation: EAW66707.1.
CH471184 Genomic DNA. Translation: EAW66708.1.
CH471184 Genomic DNA. Translation: EAW66710.1.
BC017342 mRNA. Translation: AAH17342.1.
BC025301 mRNA. Translation: AAH25301.1.
CCDSiCCDS10984.2. [Q15131-1]
CCDS32514.2. [Q15131-4]
PIRiS49330.
RefSeqiNP_001092003.2. NM_001098533.2. [Q15131-3]
NP_001153839.1. NM_001160367.1. [Q15131-2]
NP_443713.2. NM_052987.3. [Q15131-4]
NP_443714.3. NM_052988.4. [Q15131-1]
XP_016879297.1. XM_017023808.1. [Q15131-2]
XP_016879298.1. XM_017023809.1. [Q15131-3]
XP_016879299.1. XM_017023810.1. [Q15131-4]
UniGeneiHs.699177.

3D structure databases

ProteinModelPortaliQ15131.
SMRiQ15131.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114128. 15 interactors.
IntActiQ15131. 16 interactors.
STRINGi9606.ENSP00000338673.

Chemistry databases

ChEMBLiCHEMBL1795191.

PTM databases

iPTMnetiQ15131.
PhosphoSitePlusiQ15131.

Polymorphism and mutation databases

BioMutaiCDK10.
DMDMi6226784.

Proteomic databases

EPDiQ15131.
MaxQBiQ15131.
PaxDbiQ15131.
PeptideAtlasiQ15131.
PRIDEiQ15131.

Protocols and materials databases

DNASUi8558.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000353379; ENSP00000338673; ENSG00000185324. [Q15131-1]
ENST00000505473; ENSP00000424415; ENSG00000185324. [Q15131-4]
ENST00000617879; ENSP00000484357; ENSG00000185324. [Q15131-4]
GeneIDi8558.
KEGGihsa:8558.
UCSCiuc002fod.4. human. [Q15131-1]

Organism-specific databases

CTDi8558.
DisGeNETi8558.
GeneCardsiCDK10.
HGNCiHGNC:1770. CDK10.
HPAiHPA059634.
HPA067060.
MIMi603464. gene.
neXtProtiNX_Q15131.
OpenTargetsiENSG00000185324.
PharmGKBiPA26307.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0663. Eukaryota.
ENOG410XQ50. LUCA.
GeneTreeiENSGT00830000128256.
HOVERGENiHBG014652.
InParanoidiQ15131.
KOiK02449.
OMAiILKRCQH.
OrthoDBiEOG091G048P.
PhylomeDBiQ15131.
TreeFamiTF101026.

Enzyme and pathway databases

BioCyciZFISH:HS02463-MONOMER.
BRENDAi2.7.11.22. 2681.
SignaLinkiQ15131.

Miscellaneous databases

ChiTaRSiCDK10. human.
GeneWikiiCyclin-dependent_kinase_10.
GenomeRNAii8558.
PROiQ15131.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185324.
CleanExiHS_CDK10.
ExpressionAtlasiQ15131. baseline and differential.
GenevisibleiQ15131. HS.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCDK10_HUMAN
AccessioniPrimary (citable) accession number: Q15131
Secondary accession number(s): A8K370
, A8K8I6, A8MXU6, B3KQJ3, B7Z420, D3DX82, D3DX83, Q0VGZ7, Q15130, Q6PJC0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1996
Last modified: November 30, 2016
This is version 157 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.