Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q15131

- CDK10_HUMAN

UniProt

Q15131 - CDK10_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cyclin-dependent kinase 10

Gene

CDK10

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Cyclin-dependent kinase that phosphorylates the transcription factor ETS2 (in vitro) and positively controls its proteasomal degradation (in cells).1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei68 – 681ATPPROSITE-ProRule annotation
Active sitei163 – 1631Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi45 – 539ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. cyclin-dependent protein serine/threonine kinase activity Source: ProtInc

GO - Biological processi

  1. negative regulation of cell proliferation Source: ProtInc
  2. traversing start control point of mitotic cell cycle Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.22. 2681.
SignaLinkiQ15131.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 10 (EC:2.7.11.22)
Alternative name(s):
Cell division protein kinase 10
Serine/threonine-protein kinase PISSLRE
Gene namesi
Name:CDK10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:1770. CDK10.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26307.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 360360Cyclin-dependent kinase 10PRO_0000085809Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei196 – 1961Phosphothreonine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ15131.
PaxDbiQ15131.
PRIDEiQ15131.

PTM databases

PhosphoSiteiQ15131.

Expressioni

Gene expression databases

BgeeiQ15131.
CleanExiHS_CDK10.
ExpressionAtlasiQ15131. baseline and differential.
GenevestigatoriQ15131.

Interactioni

Subunit structurei

Heterodimer with FAM58A/Cyclin-M, the interaction is required for kinase activity. Interacts with ETS2.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ETS2P150362EBI-1646959,EBI-1646991
HSP90AB1P082382EBI-1646959,EBI-352572
PIN1Q135265EBI-1646959,EBI-714158

Protein-protein interaction databases

BioGridi114128. 11 interactions.
IntActiQ15131. 13 interactions.
STRINGi9606.ENSP00000338673.

Structurei

3D structure databases

ProteinModelPortaliQ15131.
SMRiQ15131. Positions 26-329.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini39 – 323285Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00760000119154.
HOVERGENiHBG014652.
InParanoidiQ15131.
KOiK02449.
OMAiPYNNLKN.
PhylomeDBiQ15131.
TreeFamiTF101026.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q15131-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEPDLECEQ IRLKCIRKEG FFTVPPEHRL GRCRSVKEFE KLNRIGEGTY
60 70 80 90 100
GIVYRARDTQ TDEIVALKKV RMDKEKDGIP ISSLREITLL LRLRHPNIVE
110 120 130 140 150
LKEVVVGNHL ESIFLVMGYC EQDLASLLEN MPTPFSEAQV KCIVLQVLRG
160 170 180 190 200
LQYLHRNFII HRDLKVSNLL MTDKGCVKTA DFGLARAYGV PVKPMTPKVV
210 220 230 240 250
TLWYRAPELL LGTTTQTTSI DMWAVGCILA ELLAHRPLLP GTSEIHQIDL
260 270 280 290 300
IVQLLGTPSE NIWPGFSKLP LVGQYSLRKQ PYNNLKHKFP WLSEAGLRLL
310 320 330 340 350
HFLFMYDPKK RATAGDCLES SYFKEKPLPC EPELMPTFPH HRNKRAAPAT
360
SEGQSKRCKP
Length:360
Mass (Da):41,038
Last modified:November 1, 1996 - v1
Checksum:i25B28560961103F4
GO
Isoform 2 (identifier: Q15131-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.

Note: No experimental confirmation available.

Show »
Length:289
Mass (Da):32,731
Checksum:i4C1854D5E1858B32
GO
Isoform 3 (identifier: Q15131-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     306-311: Missing.

Show »
Length:283
Mass (Da):31,944
Checksum:iC6B5F44BF84F9B88
GO
Isoform 4 (identifier: Q15131-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     329-360: PCEPELMPTFPHHRNKRAAPATSEGQSKRCKP → RLPISGVCEGCREPG

Show »
Length:272
Mass (Da):30,702
Checksum:i6F30BB76F69F772D
GO
Isoform 5 (identifier: Q15131-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-54: GTYGIVY → D
     180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW
     195-360: Missing.

Note: No experimental confirmation available.

Show »
Length:188
Mass (Da):21,512
Checksum:i05E92EF153FC1303
GO
Isoform 6 (identifier: Q15131-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     48-54: GTYGIVY → D
     141-160: KCIVLQVLRGLQYLHRNFII → RGRGAWGGGMGFMGPCGAHL
     161-360: Missing.

Note: No experimental confirmation available.

Show »
Length:154
Mass (Da):17,446
Checksum:iADC10B30602C2148
GO
Isoform 7 (identifier: Q15131-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW

Note: No experimental confirmation available.

Show »
Length:289
Mass (Da):32,662
Checksum:i30C4754ACDF5A8EE
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti96 – 961P → L.1 Publication
Corresponds to variant rs55819627 [ dbSNP | Ensembl ].
VAR_041983
Natural varianti168 – 1681N → S.1 Publication
Corresponds to variant rs56340740 [ dbSNP | Ensembl ].
VAR_041984
Natural varianti342 – 3421R → H.1 Publication
Corresponds to variant rs55757604 [ dbSNP | Ensembl ].
VAR_041985
Natural varianti358 – 3581C → Y.1 Publication
Corresponds to variant rs56242003 [ dbSNP | Ensembl ].
VAR_041986

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7171Missing in isoform 2, isoform 3, isoform 4 and isoform 7. 4 PublicationsVSP_021642Add
BLAST
Alternative sequencei48 – 547GTYGIVY → D in isoform 5 and isoform 6. 1 PublicationVSP_054969
Alternative sequencei141 – 16020KCIVL…RNFII → RGRGAWGGGMGFMGPCGAHL in isoform 6. 1 PublicationVSP_054970Add
BLAST
Alternative sequencei161 – 360200Missing in isoform 6. 1 PublicationVSP_054971Add
BLAST
Alternative sequencei180 – 19415ADFGL…VPVKP → GGCNLGQALSLDGTW in isoform 5 and isoform 7. 1 PublicationVSP_054972Add
BLAST
Alternative sequencei195 – 360166Missing in isoform 5. 1 PublicationVSP_054973Add
BLAST
Alternative sequencei306 – 3116Missing in isoform 3. 2 PublicationsVSP_021643
Alternative sequencei329 – 36032PCEPE…KRCKP → RLPISGVCEGCREPG in isoform 4. 2 PublicationsVSP_021644Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L33264 mRNA. Translation: AAA60092.2.
X78342 mRNA. Translation: CAA55137.1.
AJ010341
, AJ010342, AJ010343, AJ010344 Genomic DNA. Translation: CAB37619.1.
AM392903 mRNA. Translation: CAL37781.1.
AK075036 mRNA. Translation: BAG52055.1.
AK290485 mRNA. Translation: BAF83174.1.
AK292351 mRNA. Translation: BAF85040.1.
AK296631 mRNA. Translation: BAH12406.1.
AM393177 mRNA. Translation: CAL38055.1.
AM393204 mRNA. Translation: CAL38082.1.
AC010538 Genomic DNA. No translation available.
CH471184 Genomic DNA. Translation: EAW66701.1.
CH471184 Genomic DNA. Translation: EAW66703.1.
CH471184 Genomic DNA. Translation: EAW66704.1.
CH471184 Genomic DNA. Translation: EAW66705.1.
CH471184 Genomic DNA. Translation: EAW66706.1.
CH471184 Genomic DNA. Translation: EAW66707.1.
CH471184 Genomic DNA. Translation: EAW66708.1.
CH471184 Genomic DNA. Translation: EAW66710.1.
BC017342 mRNA. Translation: AAH17342.1.
BC025301 mRNA. Translation: AAH25301.1.
CCDSiCCDS10984.2. [Q15131-1]
CCDS32514.2. [Q15131-4]
PIRiS49330.
RefSeqiNP_001092003.2. NM_001098533.2. [Q15131-3]
NP_001153839.1. NM_001160367.1. [Q15131-2]
NP_443713.2. NM_052987.3. [Q15131-4]
NP_443714.3. NM_052988.4. [Q15131-1]
XP_006721376.1. XM_006721313.1. [Q15131-2]
XP_006721377.1. XM_006721314.1. [Q15131-2]
XP_006721378.1. XM_006721315.1. [Q15131-2]
XP_006721379.1. XM_006721316.1. [Q15131-2]
XP_006721380.1. XM_006721317.1. [Q15131-2]
XP_006721381.1. XM_006721318.1. [Q15131-2]
UniGeneiHs.699177.

Genome annotation databases

EnsembliENST00000353379; ENSP00000338673; ENSG00000185324. [Q15131-1]
ENST00000505473; ENSP00000424415; ENSG00000185324. [Q15131-4]
ENST00000617879; ENSP00000484357; ENSG00000185324. [Q15131-4]
GeneIDi8558.
KEGGihsa:8558.
UCSCiuc002foa.2. human.
uc002fod.3. human. [Q15131-4]
uc002foe.3. human. [Q15131-1]
uc002fof.3. human. [Q15131-3]

Polymorphism databases

DMDMi6226784.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L33264 mRNA. Translation: AAA60092.2 .
X78342 mRNA. Translation: CAA55137.1 .
AJ010341
, AJ010342 , AJ010343 , AJ010344 Genomic DNA. Translation: CAB37619.1 .
AM392903 mRNA. Translation: CAL37781.1 .
AK075036 mRNA. Translation: BAG52055.1 .
AK290485 mRNA. Translation: BAF83174.1 .
AK292351 mRNA. Translation: BAF85040.1 .
AK296631 mRNA. Translation: BAH12406.1 .
AM393177 mRNA. Translation: CAL38055.1 .
AM393204 mRNA. Translation: CAL38082.1 .
AC010538 Genomic DNA. No translation available.
CH471184 Genomic DNA. Translation: EAW66701.1 .
CH471184 Genomic DNA. Translation: EAW66703.1 .
CH471184 Genomic DNA. Translation: EAW66704.1 .
CH471184 Genomic DNA. Translation: EAW66705.1 .
CH471184 Genomic DNA. Translation: EAW66706.1 .
CH471184 Genomic DNA. Translation: EAW66707.1 .
CH471184 Genomic DNA. Translation: EAW66708.1 .
CH471184 Genomic DNA. Translation: EAW66710.1 .
BC017342 mRNA. Translation: AAH17342.1 .
BC025301 mRNA. Translation: AAH25301.1 .
CCDSi CCDS10984.2. [Q15131-1 ]
CCDS32514.2. [Q15131-4 ]
PIRi S49330.
RefSeqi NP_001092003.2. NM_001098533.2. [Q15131-3 ]
NP_001153839.1. NM_001160367.1. [Q15131-2 ]
NP_443713.2. NM_052987.3. [Q15131-4 ]
NP_443714.3. NM_052988.4. [Q15131-1 ]
XP_006721376.1. XM_006721313.1. [Q15131-2 ]
XP_006721377.1. XM_006721314.1. [Q15131-2 ]
XP_006721378.1. XM_006721315.1. [Q15131-2 ]
XP_006721379.1. XM_006721316.1. [Q15131-2 ]
XP_006721380.1. XM_006721317.1. [Q15131-2 ]
XP_006721381.1. XM_006721318.1. [Q15131-2 ]
UniGenei Hs.699177.

3D structure databases

ProteinModelPortali Q15131.
SMRi Q15131. Positions 26-329.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114128. 11 interactions.
IntActi Q15131. 13 interactions.
STRINGi 9606.ENSP00000338673.

Chemistry

ChEMBLi CHEMBL1795191.

PTM databases

PhosphoSitei Q15131.

Polymorphism databases

DMDMi 6226784.

Proteomic databases

MaxQBi Q15131.
PaxDbi Q15131.
PRIDEi Q15131.

Protocols and materials databases

DNASUi 8558.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000353379 ; ENSP00000338673 ; ENSG00000185324 . [Q15131-1 ]
ENST00000505473 ; ENSP00000424415 ; ENSG00000185324 . [Q15131-4 ]
ENST00000617879 ; ENSP00000484357 ; ENSG00000185324 . [Q15131-4 ]
GeneIDi 8558.
KEGGi hsa:8558.
UCSCi uc002foa.2. human.
uc002fod.3. human. [Q15131-4 ]
uc002foe.3. human. [Q15131-1 ]
uc002fof.3. human. [Q15131-3 ]

Organism-specific databases

CTDi 8558.
GeneCardsi GC16P089753.
HGNCi HGNC:1770. CDK10.
MIMi 603464. gene.
neXtProti NX_Q15131.
PharmGKBi PA26307.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00760000119154.
HOVERGENi HBG014652.
InParanoidi Q15131.
KOi K02449.
OMAi PYNNLKN.
PhylomeDBi Q15131.
TreeFami TF101026.

Enzyme and pathway databases

BRENDAi 2.7.11.22. 2681.
SignaLinki Q15131.

Miscellaneous databases

GeneWikii Cyclin-dependent_kinase_10.
GenomeRNAii 8558.
NextBioi 32077.
PROi Q15131.
SOURCEi Search...

Gene expression databases

Bgeei Q15131.
CleanExi HS_CDK10.
ExpressionAtlasi Q15131. baseline and differential.
Genevestigatori Q15131.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "PISSLRE, a human novel CDC2-related protein kinase."
    Grana X., Claudio P.P., De Luca A., Sang N., Giordano A.
    Oncogene 9:2097-2103(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  2. Grana X., Claudio P.P., De Luca A., Sang N., Giordano A.
    Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION.
  3. "Molecular cloning of PISSLRE, a novel putative member of the cdk family of protein serine/threonine kinases."
    Brambilla R., Draetta G.
    Oncogene 9:3037-3041(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6 AND 7).
    Tissue: Brain, Colon, Ovary and Testis.
  6. Bechtel S., Schupp I., Duda A., Wellenreuther R., Mehrle A., Ruschke V., Poustka A., Wiemann S.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  7. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Colon and Lung.
  10. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome."
    Guen V.J., Gamble C., Flajolet M., Unger S., Thollet A., Ferandin Y., Superti-Furga A., Cohen P.A., Meijer L., Colas P.
    Proc. Natl. Acad. Sci. U.S.A. 110:19525-19530(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH FAM58A.
  13. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-96; SER-168; HIS-342 AND TYR-358.

Entry informationi

Entry nameiCDK10_HUMAN
AccessioniPrimary (citable) accession number: Q15131
Secondary accession number(s): A8K370
, A8K8I6, A8MXU6, B3KQJ3, B7Z420, D3DX82, D3DX83, Q0VGZ7, Q15130, Q6PJC0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1996
Last modified: October 29, 2014
This is version 135 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3