Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q15131 (CDK10_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 129. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cyclin-dependent kinase 10

EC=2.7.11.22
Alternative name(s):
Cell division protein kinase 10
Serine/threonine-protein kinase PISSLRE
Gene names
Name:CDK10
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length360 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Catalytic activity

ATP + a protein = ADP + a phosphoprotein.

Sequence similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

Contains 1 protein kinase domain.

Binary interactions

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q15131-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q15131-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q15131-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     306-311: Missing.
Isoform 4 (identifier: Q15131-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.
     329-360: PCEPELMPTFPHHRNKRAAPATSEGQSKRCKP → RLPISGVCEGCREPG

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 360360Cyclin-dependent kinase 10
PRO_0000085809

Regions

Domain39 – 323285Protein kinase
Nucleotide binding45 – 539ATP By similarity

Sites

Active site1631Proton acceptor By similarity
Binding site681ATP By similarity

Amino acid modifications

Modified residue1961Phosphothreonine Ref.10 Ref.11

Natural variations

Alternative sequence1 – 7171Missing in isoform 2, isoform 3 and isoform 4.
VSP_021642
Alternative sequence306 – 3116Missing in isoform 3.
VSP_021643
Alternative sequence329 – 36032PCEPE…KRCKP → RLPISGVCEGCREPG in isoform 4.
VSP_021644
Natural variant961P → L. Ref.12
Corresponds to variant rs55819627 [ dbSNP | Ensembl ].
VAR_041983
Natural variant1681N → S. Ref.12
Corresponds to variant rs56340740 [ dbSNP | Ensembl ].
VAR_041984
Natural variant3421R → H. Ref.12
Corresponds to variant rs55757604 [ dbSNP | Ensembl ].
VAR_041985
Natural variant3581C → Y. Ref.12
Corresponds to variant rs56242003 [ dbSNP | Ensembl ].
VAR_041986

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 25B28560961103F4

FASTA36041,038
        10         20         30         40         50         60 
MAEPDLECEQ IRLKCIRKEG FFTVPPEHRL GRCRSVKEFE KLNRIGEGTY GIVYRARDTQ 

        70         80         90        100        110        120 
TDEIVALKKV RMDKEKDGIP ISSLREITLL LRLRHPNIVE LKEVVVGNHL ESIFLVMGYC 

       130        140        150        160        170        180 
EQDLASLLEN MPTPFSEAQV KCIVLQVLRG LQYLHRNFII HRDLKVSNLL MTDKGCVKTA 

       190        200        210        220        230        240 
DFGLARAYGV PVKPMTPKVV TLWYRAPELL LGTTTQTTSI DMWAVGCILA ELLAHRPLLP 

       250        260        270        280        290        300 
GTSEIHQIDL IVQLLGTPSE NIWPGFSKLP LVGQYSLRKQ PYNNLKHKFP WLSEAGLRLL 

       310        320        330        340        350        360 
HFLFMYDPKK RATAGDCLES SYFKEKPLPC EPELMPTFPH HRNKRAAPAT SEGQSKRCKP 

« Hide

Isoform 2 [UniParc].

Checksum: 4C1854D5E1858B32
Show »

FASTA28932,731
Isoform 3 [UniParc].

Checksum: C6B5F44BF84F9B88
Show »

FASTA28331,944
Isoform 4 [UniParc].

Checksum: 6F30BB76F69F772D
Show »

FASTA27230,702

References

« Hide 'large scale' references
[1]"PISSLRE, a human novel CDC2-related protein kinase."
Grana X., Claudio P.P., De Luca A., Sang N., Giordano A.
Oncogene 9:2097-2103(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
[2]Grana X., Claudio P.P., De Luca A., Sang N., Giordano A.
Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION.
[3]"Molecular cloning of PISSLRE, a novel putative member of the cdk family of protein serine/threonine kinases."
Brambilla R., Draetta G.
Oncogene 9:3037-3041(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[4]"The PISSLRE gene: structure, exon skipping, and exclusion as tumor suppressor in breast cancer."
Crawford J., Ianzano L., Savino M., Whitmore S., Cleton-Jansen A.-M., Settasatiani C., D'Apolito M., Seshadri R., Pronk J.C., Auerbach A.D., Verlander P.C., Mathew C.G., Tipping A.J., Doggett N.A., Zelante L., Callen D.F., Savoia A.
Genomics 56:90-97(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Colon.
[6]Bechtel S., Schupp I., Duda A., Wellenreuther R., Mehrle A., Ruschke V., Poustka A., Wiemann S.
Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[7]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
Tissue: Colon and Lung.
[10]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[11]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"Patterns of somatic mutation in human cancer genomes."
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. expand/collapse author list , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-96; SER-168; HIS-342 AND TYR-358.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L33264 mRNA. Translation: AAA60092.2.
X78342 mRNA. Translation: CAA55137.1.
AJ010341 expand/collapse EMBL AC list , AJ010342, AJ010343, AJ010344 Genomic DNA. Translation: CAB37619.1.
AM392903 mRNA. Translation: CAL37781.1.
AK296631 mRNA. Translation: BAH12406.1.
AM393177 mRNA. Translation: CAL38055.1.
AM393204 mRNA. Translation: CAL38082.1.
AC010538 Genomic DNA. No translation available.
CH471184 Genomic DNA. Translation: EAW66701.1.
CH471184 Genomic DNA. Translation: EAW66703.1.
CH471184 Genomic DNA. Translation: EAW66704.1.
CH471184 Genomic DNA. Translation: EAW66706.1.
CH471184 Genomic DNA. Translation: EAW66707.1.
CH471184 Genomic DNA. Translation: EAW66708.1.
BC017342 mRNA. Translation: AAH17342.1.
BC025301 mRNA. Translation: AAH25301.1.
PIRS49330.
RefSeqNP_001092003.2. NM_001098533.2.
NP_001153839.1. NM_001160367.1.
NP_443713.2. NM_052987.3.
NP_443714.3. NM_052988.4.
UniGeneHs.699177.

3D structure databases

ProteinModelPortalQ15131.
SMRQ15131. Positions 35-329.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114128. 8 interactions.
IntActQ15131. 5 interactions.
STRING9606.ENSP00000338673.

Chemistry

ChEMBLCHEMBL1795191.

PTM databases

PhosphoSiteQ15131.

Polymorphism databases

DMDM6226784.

Proteomic databases

PaxDbQ15131.
PRIDEQ15131.

Protocols and materials databases

DNASU8558.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000353379; ENSP00000338673; ENSG00000185324. [Q15131-1]
ENST00000505473; ENSP00000424415; ENSG00000185324. [Q15131-4]
GeneID8558.
KEGGhsa:8558.
UCSCuc002fod.3. human. [Q15131-4]
uc002foe.3. human. [Q15131-1]
uc002fof.3. human. [Q15131-3]

Organism-specific databases

CTD8558.
GeneCardsGC16P089753.
HGNCHGNC:1770. CDK10.
MIM603464. gene.
neXtProtNX_Q15131.
PharmGKBPA26307.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0515.
HOVERGENHBG014652.
InParanoidQ15131.
KOK02449.
OMACLQSSYF.
PhylomeDBQ15131.
TreeFamTF101026.

Enzyme and pathway databases

BRENDA2.7.11.22. 2681.
SignaLinkQ15131.

Gene expression databases

ArrayExpressQ15131.
BgeeQ15131.
CleanExHS_CDK10.
GenevestigatorQ15131.

Family and domain databases

InterProIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMSSF56112. SSF56112. 1 hit.
PROSITEPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiCyclin-dependent_kinase_10.
GenomeRNAi8558.
NextBio32077.
PROQ15131.
SOURCESearch...

Entry information

Entry nameCDK10_HUMAN
AccessionPrimary (citable) accession number: Q15131
Secondary accession number(s): A8MXU6 expand/collapse secondary AC list , B7Z420, D3DX82, D3DX83, Q0VGZ7, Q15130, Q6PJC0
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: November 1, 1996
Last modified: March 19, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM