Reviewed,
UniProtKB/Swiss-Prot Q15131 (CDK10_HUMAN)
Last modified
November 3, 2009.
Version 88.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Cell division protein kinase 10 EC=2.7.11.22 Alternative name(s): Serine/threonine-protein kinase PISSLRE | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 360 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | negative regulation of cell proliferation Ref.1 Traceable author statement. Source: ProtInc protein amino acid phosphorylationInferred from electronic annotation. Source: InterPro traversing start control point of mitotic cell cycle Ref.1Traceable author statement. Source: ProtInc |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW cyclin-dependent protein kinase activity Ref.3Traceable author statement. Source: ProtInc protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15131-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15131-2) The sequence of this isoform differs from the canonical sequence as follows: 1-71: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q15131-3) The sequence of this isoform differs from the canonical sequence as follows: 1-71: Missing. 306-311: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q15131-4) The sequence of this isoform differs from the canonical sequence as follows: 1-71: Missing. 329-360: PCEPELMPTFPHHRNKRAAPATSEGQSKRCKP → RLPISGVCEGCREPG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 360 | 360 | Cell division protein kinase 10 | PRO_0000085809 | |||||
Regions | |||||||||
| Domain | 39 – 323 | 285 | Protein kinase | ||||||
| Nucleotide binding | 45 – 53 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 163 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 68 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 196 | 1 | Phosphothreonine Ref.9 Ref.10 Ref.11 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 71 | 71 | Missing in isoform 2, isoform 3 and isoform 4. | VSP_021642 | |||||
| Alternative sequence | 306 – 311 | 6 | Missing in isoform 3. | VSP_021643 | |||||
| Alternative sequence | 329 – 360 | 32 | PCEPE…KRCKP → RLPISGVCEGCREPG in isoform 4. | VSP_021644 | |||||
| Natural variant | 96 | 1 | P → L | VAR_041983 | |||||
| Natural variant | 168 | 1 | N → S | VAR_041984 | |||||
| Natural variant | 342 | 1 | R → H | VAR_041985 | |||||
| Natural variant | 358 | 1 | C → Y | VAR_041986 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PISSLRE, a human novel CDC2-related protein kinase." Grana X., Claudio P.P., De Luca A., Sang N., Giordano A. Oncogene 9:2097-2103(1994) [PubMed: 8208557] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [2] | Grana X., Claudio P.P., De Luca A., Sang N., Giordano A. Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "Molecular cloning of PISSLRE, a novel putative member of the cdk family of protein serine/threonine kinases." Brambilla R., Draetta G. Oncogene 9:3037-3041(1994) [PubMed: 8084611] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "The PISSLRE gene: structure, exon skipping, and exclusion as tumor suppressor in breast cancer." Crawford J., Ianzano L., Savino M., Whitmore S., Cleton-Jansen A.-M., Settasatiani C., D'Apolito M., Seshadri R., Pronk J.C., Auerbach A.D., Verlander P.C., Mathew C.G., Tipping A.J., Doggett N.A., Zelante L., Callen D.F., Savoia A. Genomics 56:90-97(1999) [PubMed: 10036189] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Colon. |
| [6] | Bechtel S., Schupp I., Duda A., Wellenreuther R., Mehrle A., Ruschke V., Poustka A., Wiemann S. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Colon and Lung. |
| [9] | "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." Wissing J., Jaensch L., Nimtz M., Dieterich G., Hornberger R., Keri G., Wehland J., Daub H. Mol. Cell. Proteomics 6:537-547(2007) [PubMed: 17192257] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, MASS SPECTROMETRY. |
| [10] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, MASS SPECTROMETRY. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, MASS SPECTROMETRY. |
| [12] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed: 17344846] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-96; SER-168; HIS-342 AND TYR-358. |
Cross-references
Sequence databases | |
|---|---|
| L33264 mRNA. Translation: AAA60092.2. X78342 mRNA. Translation: CAA55137.1. AJ010341 AJ010344 Genomic DNA. Translation: CAB37619.1. AM392903 mRNA. Translation: CAL37781.1. AK296631 mRNA. Translation: BAH12406.1. AM393177 mRNA. Translation: CAL38055.1. AM393204 mRNA. Translation: CAL38082.1. CH471184 Genomic DNA. Translation: EAW66704.1. BC017342 mRNA. Translation: AAH17342.1. BC025301 mRNA. Translation: AAH25301.1. | |
| IPI | IPI00014873. IPI00639889. IPI00642595. IPI00788960. |
| PIR | S49330. |
| RefSeq | NP_001092003.2. NP_001153839.1. NP_443713.2. NP_443714.3. |
| UniGene | Hs.699177 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1H00 based on UniProtKB P24941. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q15131. 2 interactions. |
| STRING | Q15131. |
PTM databases | |
| PhosphoSite | Q15131. |
Proteomic databases | |
| PRIDE | Q15131. |
Genome annotation databases | |
| Ensembl | ENST00000331006; ENSP00000329957; ENSG00000185324; Homo sapiens. [Genome view] ENST00000353379; ENSP00000338673; ENSG00000185324; Homo sapiens. [Genome view] ENST00000378277; ENSP00000367526; ENSG00000185324; Homo sapiens. [Genome view] ENST00000393082; ENSP00000376797; ENSG00000185324; Homo sapiens. [Genome view] ENST00000437260; ENSP00000404540; ENSG00000185324; Homo sapiens. [Genome view] |
| GeneID | 8558. |
| KEGG | hsa:8558. |
| UCSC | uc002fod.1. human. uc002fof.1. human. uc002foh.2. human. uc010cio.1. human. |
Organism-specific databases | |
| CTD | 8558. |
| GeneCards | GC16P088280. |
| H-InvDB | HIX0013366. |
| HGNC | HGNC:1770. CDK10. |
| MIM | 603464. gene. |
| PharmGKB | PA26307. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q15131. |
| HOVERGEN | Q15131. |
| OMA | MEYCEQD. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.22. 247. |
Gene expression databases | |
| ArrayExpress | Q15131. |
| Bgee | Q15131. |
| CleanEx | HS_CDK10. |
| Genevestigator | Q15131. |
| GermOnline | ENSG00000185324. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 32077. |
| SOURCE | Search... |
Entry information
| Entry name | CDK10_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15131 Secondary accession number(s): B7Z420 Q6PJC0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


