Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q15131

- CDK10_HUMAN

UniProt

Q15131 - CDK10_HUMAN

Protein

Cyclin-dependent kinase 10

Gene

CDK10

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 134 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cyclin-dependent kinase that phosphorylates the transcription factor ETS2 (in vitro) and positively controls its proteasomal degradation (in cells).1 Publication

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei68 – 681ATPPROSITE-ProRule annotation
    Active sitei163 – 1631Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi45 – 539ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. cyclin-dependent protein serine/threonine kinase activity Source: ProtInc
    3. protein binding Source: IntAct

    GO - Biological processi

    1. negative regulation of cell proliferation Source: ProtInc
    2. traversing start control point of mitotic cell cycle Source: ProtInc

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.11.22. 2681.
    SignaLinkiQ15131.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-dependent kinase 10 (EC:2.7.11.22)
    Alternative name(s):
    Cell division protein kinase 10
    Serine/threonine-protein kinase PISSLRE
    Gene namesi
    Name:CDK10
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:1770. CDK10.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26307.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 360360Cyclin-dependent kinase 10PRO_0000085809Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei196 – 1961Phosphothreonine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ15131.
    PaxDbiQ15131.
    PRIDEiQ15131.

    PTM databases

    PhosphoSiteiQ15131.

    Expressioni

    Gene expression databases

    ArrayExpressiQ15131.
    BgeeiQ15131.
    CleanExiHS_CDK10.
    GenevestigatoriQ15131.

    Interactioni

    Subunit structurei

    Heterodimer with FAM58A/Cyclin-M, the interaction is required for kinase activity. Interacts with ETS2.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ETS2P150362EBI-1646959,EBI-1646991
    HSP90AB1P082382EBI-1646959,EBI-352572
    PIN1Q135265EBI-1646959,EBI-714158

    Protein-protein interaction databases

    BioGridi114128. 8 interactions.
    IntActiQ15131. 13 interactions.
    STRINGi9606.ENSP00000338673.

    Structurei

    3D structure databases

    ProteinModelPortaliQ15131.
    SMRiQ15131. Positions 35-329.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini39 – 323285Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOVERGENiHBG014652.
    InParanoidiQ15131.
    KOiK02449.
    OMAiPYNNLKN.
    PhylomeDBiQ15131.
    TreeFamiTF101026.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q15131-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAEPDLECEQ IRLKCIRKEG FFTVPPEHRL GRCRSVKEFE KLNRIGEGTY    50
    GIVYRARDTQ TDEIVALKKV RMDKEKDGIP ISSLREITLL LRLRHPNIVE 100
    LKEVVVGNHL ESIFLVMGYC EQDLASLLEN MPTPFSEAQV KCIVLQVLRG 150
    LQYLHRNFII HRDLKVSNLL MTDKGCVKTA DFGLARAYGV PVKPMTPKVV 200
    TLWYRAPELL LGTTTQTTSI DMWAVGCILA ELLAHRPLLP GTSEIHQIDL 250
    IVQLLGTPSE NIWPGFSKLP LVGQYSLRKQ PYNNLKHKFP WLSEAGLRLL 300
    HFLFMYDPKK RATAGDCLES SYFKEKPLPC EPELMPTFPH HRNKRAAPAT 350
    SEGQSKRCKP 360
    Length:360
    Mass (Da):41,038
    Last modified:November 1, 1996 - v1
    Checksum:i25B28560961103F4
    GO
    Isoform 2 (identifier: Q15131-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-71: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:289
    Mass (Da):32,731
    Checksum:i4C1854D5E1858B32
    GO
    Isoform 3 (identifier: Q15131-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-71: Missing.
         306-311: Missing.

    Show »
    Length:283
    Mass (Da):31,944
    Checksum:iC6B5F44BF84F9B88
    GO
    Isoform 4 (identifier: Q15131-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-71: Missing.
         329-360: PCEPELMPTFPHHRNKRAAPATSEGQSKRCKP → RLPISGVCEGCREPG

    Show »
    Length:272
    Mass (Da):30,702
    Checksum:i6F30BB76F69F772D
    GO
    Isoform 5 (identifier: Q15131-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         48-54: GTYGIVY → D
         180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW
         195-360: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:188
    Mass (Da):21,512
    Checksum:i05E92EF153FC1303
    GO
    Isoform 6 (identifier: Q15131-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         48-54: GTYGIVY → D
         141-160: KCIVLQVLRGLQYLHRNFII → RGRGAWGGGMGFMGPCGAHL
         161-360: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:154
    Mass (Da):17,446
    Checksum:iADC10B30602C2148
    GO
    Isoform 7 (identifier: Q15131-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-71: Missing.
         180-194: ADFGLARAYGVPVKP → GGCNLGQALSLDGTW

    Note: No experimental confirmation available.

    Show »
    Length:289
    Mass (Da):32,662
    Checksum:i30C4754ACDF5A8EE
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti96 – 961P → L.1 Publication
    Corresponds to variant rs55819627 [ dbSNP | Ensembl ].
    VAR_041983
    Natural varianti168 – 1681N → S.1 Publication
    Corresponds to variant rs56340740 [ dbSNP | Ensembl ].
    VAR_041984
    Natural varianti342 – 3421R → H.1 Publication
    Corresponds to variant rs55757604 [ dbSNP | Ensembl ].
    VAR_041985
    Natural varianti358 – 3581C → Y.1 Publication
    Corresponds to variant rs56242003 [ dbSNP | Ensembl ].
    VAR_041986

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7171Missing in isoform 2, isoform 3, isoform 4 and isoform 7. 4 PublicationsVSP_021642Add
    BLAST
    Alternative sequencei48 – 547GTYGIVY → D in isoform 5 and isoform 6. 1 PublicationVSP_054969
    Alternative sequencei141 – 16020KCIVL…RNFII → RGRGAWGGGMGFMGPCGAHL in isoform 6. 1 PublicationVSP_054970Add
    BLAST
    Alternative sequencei161 – 360200Missing in isoform 6. 1 PublicationVSP_054971Add
    BLAST
    Alternative sequencei180 – 19415ADFGL…VPVKP → GGCNLGQALSLDGTW in isoform 5 and isoform 7. 1 PublicationVSP_054972Add
    BLAST
    Alternative sequencei195 – 360166Missing in isoform 5. 1 PublicationVSP_054973Add
    BLAST
    Alternative sequencei306 – 3116Missing in isoform 3. 2 PublicationsVSP_021643
    Alternative sequencei329 – 36032PCEPE…KRCKP → RLPISGVCEGCREPG in isoform 4. 2 PublicationsVSP_021644Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L33264 mRNA. Translation: AAA60092.2.
    X78342 mRNA. Translation: CAA55137.1.
    AJ010341
    , AJ010342, AJ010343, AJ010344 Genomic DNA. Translation: CAB37619.1.
    AM392903 mRNA. Translation: CAL37781.1.
    AK075036 mRNA. Translation: BAG52055.1.
    AK290485 mRNA. Translation: BAF83174.1.
    AK292351 mRNA. Translation: BAF85040.1.
    AK296631 mRNA. Translation: BAH12406.1.
    AM393177 mRNA. Translation: CAL38055.1.
    AM393204 mRNA. Translation: CAL38082.1.
    AC010538 Genomic DNA. No translation available.
    CH471184 Genomic DNA. Translation: EAW66701.1.
    CH471184 Genomic DNA. Translation: EAW66703.1.
    CH471184 Genomic DNA. Translation: EAW66704.1.
    CH471184 Genomic DNA. Translation: EAW66705.1.
    CH471184 Genomic DNA. Translation: EAW66706.1.
    CH471184 Genomic DNA. Translation: EAW66707.1.
    CH471184 Genomic DNA. Translation: EAW66708.1.
    CH471184 Genomic DNA. Translation: EAW66710.1.
    BC017342 mRNA. Translation: AAH17342.1.
    BC025301 mRNA. Translation: AAH25301.1.
    CCDSiCCDS10984.2. [Q15131-1]
    CCDS32514.2. [Q15131-4]
    PIRiS49330.
    RefSeqiNP_001092003.2. NM_001098533.2. [Q15131-3]
    NP_001153839.1. NM_001160367.1. [Q15131-2]
    NP_443713.2. NM_052987.3. [Q15131-4]
    NP_443714.3. NM_052988.4. [Q15131-1]
    XP_006721376.1. XM_006721313.1. [Q15131-2]
    XP_006721377.1. XM_006721314.1. [Q15131-2]
    XP_006721378.1. XM_006721315.1. [Q15131-2]
    XP_006721379.1. XM_006721316.1. [Q15131-2]
    XP_006721380.1. XM_006721317.1. [Q15131-2]
    XP_006721381.1. XM_006721318.1. [Q15131-2]
    UniGeneiHs.699177.

    Genome annotation databases

    EnsembliENST00000353379; ENSP00000338673; ENSG00000185324. [Q15131-1]
    ENST00000505473; ENSP00000424415; ENSG00000185324. [Q15131-4]
    GeneIDi8558.
    KEGGihsa:8558.
    UCSCiuc002fod.3. human. [Q15131-4]
    uc002foe.3. human. [Q15131-1]
    uc002fof.3. human. [Q15131-3]

    Polymorphism databases

    DMDMi6226784.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L33264 mRNA. Translation: AAA60092.2 .
    X78342 mRNA. Translation: CAA55137.1 .
    AJ010341
    , AJ010342 , AJ010343 , AJ010344 Genomic DNA. Translation: CAB37619.1 .
    AM392903 mRNA. Translation: CAL37781.1 .
    AK075036 mRNA. Translation: BAG52055.1 .
    AK290485 mRNA. Translation: BAF83174.1 .
    AK292351 mRNA. Translation: BAF85040.1 .
    AK296631 mRNA. Translation: BAH12406.1 .
    AM393177 mRNA. Translation: CAL38055.1 .
    AM393204 mRNA. Translation: CAL38082.1 .
    AC010538 Genomic DNA. No translation available.
    CH471184 Genomic DNA. Translation: EAW66701.1 .
    CH471184 Genomic DNA. Translation: EAW66703.1 .
    CH471184 Genomic DNA. Translation: EAW66704.1 .
    CH471184 Genomic DNA. Translation: EAW66705.1 .
    CH471184 Genomic DNA. Translation: EAW66706.1 .
    CH471184 Genomic DNA. Translation: EAW66707.1 .
    CH471184 Genomic DNA. Translation: EAW66708.1 .
    CH471184 Genomic DNA. Translation: EAW66710.1 .
    BC017342 mRNA. Translation: AAH17342.1 .
    BC025301 mRNA. Translation: AAH25301.1 .
    CCDSi CCDS10984.2. [Q15131-1 ]
    CCDS32514.2. [Q15131-4 ]
    PIRi S49330.
    RefSeqi NP_001092003.2. NM_001098533.2. [Q15131-3 ]
    NP_001153839.1. NM_001160367.1. [Q15131-2 ]
    NP_443713.2. NM_052987.3. [Q15131-4 ]
    NP_443714.3. NM_052988.4. [Q15131-1 ]
    XP_006721376.1. XM_006721313.1. [Q15131-2 ]
    XP_006721377.1. XM_006721314.1. [Q15131-2 ]
    XP_006721378.1. XM_006721315.1. [Q15131-2 ]
    XP_006721379.1. XM_006721316.1. [Q15131-2 ]
    XP_006721380.1. XM_006721317.1. [Q15131-2 ]
    XP_006721381.1. XM_006721318.1. [Q15131-2 ]
    UniGenei Hs.699177.

    3D structure databases

    ProteinModelPortali Q15131.
    SMRi Q15131. Positions 35-329.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114128. 8 interactions.
    IntActi Q15131. 13 interactions.
    STRINGi 9606.ENSP00000338673.

    Chemistry

    ChEMBLi CHEMBL1795191.

    PTM databases

    PhosphoSitei Q15131.

    Polymorphism databases

    DMDMi 6226784.

    Proteomic databases

    MaxQBi Q15131.
    PaxDbi Q15131.
    PRIDEi Q15131.

    Protocols and materials databases

    DNASUi 8558.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000353379 ; ENSP00000338673 ; ENSG00000185324 . [Q15131-1 ]
    ENST00000505473 ; ENSP00000424415 ; ENSG00000185324 . [Q15131-4 ]
    GeneIDi 8558.
    KEGGi hsa:8558.
    UCSCi uc002fod.3. human. [Q15131-4 ]
    uc002foe.3. human. [Q15131-1 ]
    uc002fof.3. human. [Q15131-3 ]

    Organism-specific databases

    CTDi 8558.
    GeneCardsi GC16P089753.
    HGNCi HGNC:1770. CDK10.
    MIMi 603464. gene.
    neXtProti NX_Q15131.
    PharmGKBi PA26307.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOVERGENi HBG014652.
    InParanoidi Q15131.
    KOi K02449.
    OMAi PYNNLKN.
    PhylomeDBi Q15131.
    TreeFami TF101026.

    Enzyme and pathway databases

    BRENDAi 2.7.11.22. 2681.
    SignaLinki Q15131.

    Miscellaneous databases

    GeneWikii Cyclin-dependent_kinase_10.
    GenomeRNAii 8558.
    NextBioi 32077.
    PROi Q15131.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q15131.
    Bgeei Q15131.
    CleanExi HS_CDK10.
    Genevestigatori Q15131.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "PISSLRE, a human novel CDC2-related protein kinase."
      Grana X., Claudio P.P., De Luca A., Sang N., Giordano A.
      Oncogene 9:2097-2103(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    2. Grana X., Claudio P.P., De Luca A., Sang N., Giordano A.
      Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION.
    3. "Molecular cloning of PISSLRE, a novel putative member of the cdk family of protein serine/threonine kinases."
      Brambilla R., Draetta G.
      Oncogene 9:3037-3041(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6 AND 7).
      Tissue: Brain, Colon, Ovary and Testis.
    6. Bechtel S., Schupp I., Duda A., Wellenreuther R., Mehrle A., Ruschke V., Poustka A., Wiemann S.
      Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    7. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Tissue: Colon and Lung.
    10. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-196, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome."
      Guen V.J., Gamble C., Flajolet M., Unger S., Thollet A., Ferandin Y., Superti-Furga A., Cohen P.A., Meijer L., Colas P.
      Proc. Natl. Acad. Sci. U.S.A. 110:19525-19530(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH FAM58A.
    13. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] LEU-96; SER-168; HIS-342 AND TYR-358.

    Entry informationi

    Entry nameiCDK10_HUMAN
    AccessioniPrimary (citable) accession number: Q15131
    Secondary accession number(s): A8K370
    , A8K8I6, A8MXU6, B3KQJ3, B7Z420, D3DX82, D3DX83, Q0VGZ7, Q15130, Q6PJC0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 134 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3