Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q15063

- POSTN_HUMAN

UniProt

Q15063 - POSTN_HUMAN

Protein

Periostin

Gene

POSTN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 126 (01 Oct 2014)
      Sequence version 2 (07 Mar 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Enhances incorporation of BMP1 in the fibronectin matrix of connective tissues, and subsequent proteolytic activation of lysyl oxidase LOX By similarity. Induces cell attachment and spreading and plays a role in cell adhesion. May play a role in extracellular matrix mineralization.By similarity2 Publications

    GO - Molecular functioni

    1. heparin binding Source: UniProtKB
    2. protein binding Source: BHF-UCL

    GO - Biological processi

    1. cell adhesion Source: UniProtKB
    2. extracellular matrix organization Source: Ensembl
    3. regulation of Notch signaling pathway Source: Ensembl
    4. skeletal system development Source: ProtInc
    5. tissue development Source: Ensembl

    Keywords - Biological processi

    Cell adhesion

    Keywords - Ligandi

    Heparin-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Periostin
    Short name:
    PN
    Alternative name(s):
    Osteoblast-specific factor 2
    Short name:
    OSF-2
    Gene namesi
    Name:POSTN
    Synonyms:OSF2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 13

    Organism-specific databases

    HGNCiHGNC:16953. POSTN.

    Subcellular locationi

    Golgi apparatus By similarity. Secretedextracellular spaceextracellular matrix 1 Publication
    Note: Colocalizes with BMP1 in the Golgi.By similarity

    GO - Cellular componenti

    1. proteinaceous extracellular matrix Source: UniProtKB
    2. trans-Golgi network Source: BHF-UCL

    Keywords - Cellular componenti

    Extracellular matrix, Golgi apparatus, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134900304.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2121Sequence AnalysisAdd
    BLAST
    Chaini22 – 836815PeriostinPRO_0000008789Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi44 ↔ 80PROSITE-ProRule annotation
    Disulfide bondi60 ↔ 69PROSITE-ProRule annotation
    Disulfide bondi79 ↔ 92PROSITE-ProRule annotation
    Modified residuei124 – 12414-carboxyglutamateSequence Analysis
    Modified residuei125 – 12514-carboxyglutamateSequence Analysis
    Modified residuei127 – 12714-carboxyglutamateSequence Analysis
    Modified residuei140 – 14014-carboxyglutamateSequence Analysis
    Modified residuei154 – 15414-carboxyglutamateSequence Analysis
    Modified residuei160 – 16014-carboxyglutamateSequence Analysis
    Modified residuei242 – 24214-carboxyglutamateSequence Analysis
    Modified residuei244 – 24414-carboxyglutamateSequence Analysis
    Modified residuei261 – 26114-carboxyglutamateSequence Analysis
    Modified residuei277 – 27714-carboxyglutamateSequence Analysis
    Modified residuei280 – 28014-carboxyglutamateSequence Analysis
    Modified residuei288 – 28814-carboxyglutamateSequence Analysis
    Modified residuei298 – 29814-carboxyglutamateSequence Analysis
    Modified residuei313 – 31314-carboxyglutamateSequence Analysis
    Modified residuei322 – 32214-carboxyglutamateSequence Analysis
    Modified residuei325 – 32514-carboxyglutamateSequence Analysis
    Modified residuei496 – 49614-carboxyglutamateSequence Analysis
    Modified residuei501 – 50114-carboxyglutamateSequence Analysis
    Modified residuei517 – 51714-carboxyglutamateSequence Analysis
    Modified residuei523 – 52314-carboxyglutamateSequence Analysis
    Modified residuei547 – 54714-carboxyglutamateSequence Analysis
    Modified residuei548 – 54814-carboxyglutamateSequence Analysis
    Modified residuei550 – 55014-carboxyglutamateSequence Analysis
    Modified residuei578 – 57814-carboxyglutamateSequence Analysis
    Glycosylationi599 – 5991N-linked (GlcNAc...)2 Publications

    Post-translational modificationi

    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.1 Publication

    Keywords - PTMi

    Disulfide bond, Gamma-carboxyglutamic acid, Glycoprotein

    Proteomic databases

    MaxQBiQ15063.
    PaxDbiQ15063.
    PRIDEiQ15063.

    PTM databases

    PhosphoSiteiQ15063.

    Expressioni

    Tissue specificityi

    Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus, thyroid tissue and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers.4 Publications

    Gene expression databases

    ArrayExpressiQ15063.
    BgeeiQ15063.
    CleanExiHS_POSTN.
    GenevestigatoriQ15063.

    Organism-specific databases

    HPAiHPA012306.

    Interactioni

    Subunit structurei

    Interacts with BMP1 and fibronectin.By similarity

    Protein-protein interaction databases

    IntActiQ15063. 2 interactions.
    MINTiMINT-4533078.
    STRINGi9606.ENSP00000369071.

    Structurei

    3D structure databases

    ProteinModelPortaliQ15063.
    SMRiQ15063. Positions 236-367, 503-630.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini40 – 9455EMIPROSITE-ProRule annotationAdd
    BLAST
    Domaini97 – 230134FAS1 1CuratedPROSITE-ProRule annotationAdd
    BLAST
    Domaini234 – 365132FAS1 2CuratedPROSITE-ProRule annotationAdd
    BLAST
    Domaini368 – 492125FAS1 3CuratedPROSITE-ProRule annotationAdd
    BLAST
    Domaini496 – 628133FAS1 4CuratedPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 EMI domain.PROSITE-ProRule annotation
    Contains 4 FAS1 domains.CuratedPROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal

    Phylogenomic databases

    eggNOGiCOG2335.
    HOGENOMiHOG000220865.
    HOVERGENiHBG000715.
    InParanoidiQ15063.
    OMAiHGEPIIK.
    PhylomeDBiQ15063.
    TreeFamiTF316269.

    Family and domain databases

    Gene3Di2.30.180.10. 4 hits.
    InterProiIPR011489. EMI_domain.
    IPR000782. FAS1_domain.
    IPR016666. TGFb-ind_bIGH3/osteoblast_fac2.
    [Graphical view]
    PfamiPF02469. Fasciclin. 4 hits.
    [Graphical view]
    PIRSFiPIRSF016553. BIGH3_OSF2. 1 hit.
    SMARTiSM00554. FAS1. 4 hits.
    [Graphical view]
    SUPFAMiSSF82153. SSF82153. 4 hits.
    PROSITEiPS51041. EMI. 1 hit.
    PS50213. FAS1. 4 hits.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q15063-1) [UniParc]FASTAAdd to Basket

    Also known as: OSF-2OS1 Publication

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIPFLPMFSL LLLLIVNPIN ANNHYDKILA HSRIRGRDQG PNVCALQQIL    50
    GTKKKYFSTC KNWYKKSICG QKTTVLYECC PGYMRMEGMK GCPAVLPIDH 100
    VYGTLGIVGA TTTQRYSDAS KLREEIEGKG SFTYFAPSNE AWDNLDSDIR 150
    RGLESNVNVE LLNALHSHMI NKRMLTKDLK NGMIIPSMYN NLGLFINHYP 200
    NGVVTVNCAR IIHGNQIATN GVVHVIDRVL TQIGTSIQDF IEAEDDLSSF 250
    RAAAITSDIL EALGRDGHFT LFAPTNEAFE KLPRGVLERI MGDKVASEAL 300
    MKYHILNTLQ CSESIMGGAV FETLEGNTIE IGCDGDSITV NGIKMVNKKD 350
    IVTNNGVIHL IDQVLIPDSA KQVIELAGKQ QTTFTDLVAQ LGLASALRPD 400
    GEYTLLAPVN NAFSDDTLSM DQRLLKLILQ NHILKVKVGL NELYNGQILE 450
    TIGGKQLRVF VYRTAVCIEN SCMEKGSKQG RNGAIHIFRE IIKPAEKSLH 500
    EKLKQDKRFS TFLSLLEAAD LKELLTQPGD WTLFVPTNDA FKGMTSEEKE 550
    ILIRDKNALQ NIILYHLTPG VFIGKGFEPG VTNILKTTQG SKIFLKEVND 600
    TLLVNELKSK ESDIMTTNGV IHVVDKLLYP ADTPVGNDQL LEILNKLIKY 650
    IQIKFVRGST FKEIPVTVYT TKIITKVVEP KIKVIEGSLQ PIIKTEGPTL 700
    TKVKIEGEPE FRLIKEGETI TEVIHGEPII KKYTKIIDGV PVEITEKETR 750
    EERIITGPEI KYTRISTGGG ETEETLKKLL QEEVTKVTKF IEGGDGHLFE 800
    DEEIKRLLQG DTPVRKLQAN KKVQGSRRRL REGRSQ 836
    Length:836
    Mass (Da):93,314
    Last modified:March 7, 2006 - v2
    Checksum:i55E7B82D094824FD
    GO
    Isoform 21 Publication (identifier: Q15063-2) [UniParc]FASTAAdd to Basket

    Also known as: OSF-2p1

    The sequence of this isoform differs from the canonical sequence as follows:
         670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K

    Show »
    Length:779
    Mass (Da):87,021
    Checksum:iC6936F32A42B8366
    GO
    Isoform 31 Publication (identifier: Q15063-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R
         783-810: Missing.

    Show »
    Length:781
    Mass (Da):87,254
    Checksum:iD082BC8F86ABAC37
    GO
    Isoform 4 (identifier: Q15063-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K
         783-810: Missing.

    Show »
    Length:751
    Mass (Da):83,850
    Checksum:i7241170E4CDC18D3
    GO
    Isoform 5 (identifier: Q15063-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R

    Show »
    Length:809
    Mass (Da):90,424
    Checksum:i43DECD94CB76B07A
    GO
    Isoform 6 (identifier: Q15063-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         670-757: TTKIITKVVE...ETREERIITG → S

    Show »
    Length:749
    Mass (Da):83,527
    Checksum:i13F23F62B1C1AAE9
    GO
    Isoform 7 (identifier: Q15063-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         670-757: TTKIITKVVE...ETREERIITG → S
         783-810: Missing.

    Show »
    Length:721
    Mass (Da):80,357
    Checksum:iCE5CEFA7E156957B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti290 – 2901I → F in BAA02836. (PubMed:8363580)Curated
    Sequence conflicti290 – 2901I → F in BAA02837. (PubMed:8363580)Curated
    Sequence conflicti290 – 2901I → F in ABY86630. (PubMed:23946676)Curated
    Sequence conflicti290 – 2901I → F in ABY86631. (PubMed:23946676)Curated
    Sequence conflicti290 – 2901I → F in ABY86633. (PubMed:23946676)Curated
    Sequence conflicti290 – 2901I → F in AAY15840. 1 PublicationCurated
    Sequence conflicti421 – 4211D → V in BAA02836. (PubMed:8363580)Curated
    Sequence conflicti421 – 4211D → V in BAA02837. (PubMed:8363580)Curated
    Sequence conflicti421 – 4211D → V in ABY86630. (PubMed:23946676)Curated
    Sequence conflicti421 – 4211D → V in ABY86631. (PubMed:23946676)Curated
    Sequence conflicti421 – 4211D → V in ABY86633. (PubMed:23946676)Curated
    Sequence conflicti421 – 4211D → V in AAY15840. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti339 – 3391T → I.
    Corresponds to variant rs9594223 [ dbSNP | Ensembl ].
    VAR_049115
    Natural varianti814 – 8141V → M.
    Corresponds to variant rs9547952 [ dbSNP | Ensembl ].
    VAR_049116

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei670 – 75788TTKII…RIITG → S in isoform 6 and isoform 7. 1 PublicationVSP_055183Add
    BLAST
    Alternative sequencei670 – 72758TTKII…VIHGE → K in isoform 2 and isoform 4. 3 PublicationsVSP_050005Add
    BLAST
    Alternative sequencei670 – 69728TTKII…IKTEG → R in isoform 3 and isoform 5. 3 PublicationsVSP_050669Add
    BLAST
    Alternative sequencei783 – 81028Missing in isoform 3, isoform 4 and isoform 7. 3 PublicationsVSP_050670Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D13665 mRNA. Translation: BAA02836.1.
    D13666 mRNA. Translation: BAA02837.1.
    AY140646 mRNA. Translation: AAN17733.1.
    EU262883 mRNA. Translation: ABY86630.1.
    EU262884 mRNA. Translation: ABY86631.1.
    EU262886 mRNA. Translation: ABY86633.1.
    AY918092 mRNA. Translation: AAY15840.1.
    AL138679, AL646087 Genomic DNA. Translation: CAH70107.1.
    AL646087, AL138679 Genomic DNA. Translation: CAH73568.1.
    AL138679, AL646087 Genomic DNA. Translation: CAH70104.1.
    AL646087, AL138679 Genomic DNA. Translation: CAH73569.1.
    CH471075 Genomic DNA. Translation: EAX08590.1.
    BC106709 mRNA. Translation: AAI06710.1.
    BC106710 mRNA. Translation: AAI06711.1.
    GU354210 mRNA. Translation: ADA79517.1.
    CCDSiCCDS45034.1. [Q15063-2]
    CCDS53864.1. [Q15063-3]
    CCDS66530.1. [Q15063-6]
    CCDS66531.1. [Q15063-5]
    CCDS9364.1. [Q15063-1]
    PIRiS36110.
    S36111.
    RefSeqiNP_001129406.1. NM_001135934.1. [Q15063-2]
    NP_001129407.1. NM_001135935.1. [Q15063-3]
    NP_001129408.1. NM_001135936.1. [Q15063-4]
    NP_001273594.1. NM_001286665.1.
    NP_001273595.1. NM_001286666.1.
    NP_001273596.1. NM_001286667.1.
    NP_006466.2. NM_006475.2. [Q15063-1]
    UniGeneiHs.136348.
    Hs.721018.

    Genome annotation databases

    EnsembliENST00000379742; ENSP00000369066; ENSG00000133110. [Q15063-2]
    ENST00000379743; ENSP00000369067; ENSG00000133110. [Q15063-5]
    ENST00000379747; ENSP00000369071; ENSG00000133110. [Q15063-1]
    ENST00000541179; ENSP00000437959; ENSG00000133110. [Q15063-3]
    ENST00000541481; ENSP00000437953; ENSG00000133110. [Q15063-6]
    GeneIDi10631.
    KEGGihsa:10631.
    UCSCiuc001uwo.4. human. [Q15063-1]
    uc001uwp.4. human. [Q15063-2]
    uc001uwq.3. human. [Q15063-4]
    uc001uwr.3. human. [Q15063-3]

    Polymorphism databases

    DMDMi93138709.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D13665 mRNA. Translation: BAA02836.1 .
    D13666 mRNA. Translation: BAA02837.1 .
    AY140646 mRNA. Translation: AAN17733.1 .
    EU262883 mRNA. Translation: ABY86630.1 .
    EU262884 mRNA. Translation: ABY86631.1 .
    EU262886 mRNA. Translation: ABY86633.1 .
    AY918092 mRNA. Translation: AAY15840.1 .
    AL138679 , AL646087 Genomic DNA. Translation: CAH70107.1 .
    AL646087 , AL138679 Genomic DNA. Translation: CAH73568.1 .
    AL138679 , AL646087 Genomic DNA. Translation: CAH70104.1 .
    AL646087 , AL138679 Genomic DNA. Translation: CAH73569.1 .
    CH471075 Genomic DNA. Translation: EAX08590.1 .
    BC106709 mRNA. Translation: AAI06710.1 .
    BC106710 mRNA. Translation: AAI06711.1 .
    GU354210 mRNA. Translation: ADA79517.1 .
    CCDSi CCDS45034.1. [Q15063-2 ]
    CCDS53864.1. [Q15063-3 ]
    CCDS66530.1. [Q15063-6 ]
    CCDS66531.1. [Q15063-5 ]
    CCDS9364.1. [Q15063-1 ]
    PIRi S36110.
    S36111.
    RefSeqi NP_001129406.1. NM_001135934.1. [Q15063-2 ]
    NP_001129407.1. NM_001135935.1. [Q15063-3 ]
    NP_001129408.1. NM_001135936.1. [Q15063-4 ]
    NP_001273594.1. NM_001286665.1.
    NP_001273595.1. NM_001286666.1.
    NP_001273596.1. NM_001286667.1.
    NP_006466.2. NM_006475.2. [Q15063-1 ]
    UniGenei Hs.136348.
    Hs.721018.

    3D structure databases

    ProteinModelPortali Q15063.
    SMRi Q15063. Positions 236-367, 503-630.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q15063. 2 interactions.
    MINTi MINT-4533078.
    STRINGi 9606.ENSP00000369071.

    PTM databases

    PhosphoSitei Q15063.

    Polymorphism databases

    DMDMi 93138709.

    Proteomic databases

    MaxQBi Q15063.
    PaxDbi Q15063.
    PRIDEi Q15063.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000379742 ; ENSP00000369066 ; ENSG00000133110 . [Q15063-2 ]
    ENST00000379743 ; ENSP00000369067 ; ENSG00000133110 . [Q15063-5 ]
    ENST00000379747 ; ENSP00000369071 ; ENSG00000133110 . [Q15063-1 ]
    ENST00000541179 ; ENSP00000437959 ; ENSG00000133110 . [Q15063-3 ]
    ENST00000541481 ; ENSP00000437953 ; ENSG00000133110 . [Q15063-6 ]
    GeneIDi 10631.
    KEGGi hsa:10631.
    UCSCi uc001uwo.4. human. [Q15063-1 ]
    uc001uwp.4. human. [Q15063-2 ]
    uc001uwq.3. human. [Q15063-4 ]
    uc001uwr.3. human. [Q15063-3 ]

    Organism-specific databases

    CTDi 10631.
    GeneCardsi GC13M038136.
    HGNCi HGNC:16953. POSTN.
    HPAi HPA012306.
    MIMi 608777. gene.
    neXtProti NX_Q15063.
    PharmGKBi PA134900304.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2335.
    HOGENOMi HOG000220865.
    HOVERGENi HBG000715.
    InParanoidi Q15063.
    OMAi HGEPIIK.
    PhylomeDBi Q15063.
    TreeFami TF316269.

    Miscellaneous databases

    ChiTaRSi POSTN. human.
    GeneWikii Periostin.
    POSTN.
    GenomeRNAii 10631.
    NextBioi 35466661.
    PROi Q15063.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q15063.
    Bgeei Q15063.
    CleanExi HS_POSTN.
    Genevestigatori Q15063.

    Family and domain databases

    Gene3Di 2.30.180.10. 4 hits.
    InterProi IPR011489. EMI_domain.
    IPR000782. FAS1_domain.
    IPR016666. TGFb-ind_bIGH3/osteoblast_fac2.
    [Graphical view ]
    Pfami PF02469. Fasciclin. 4 hits.
    [Graphical view ]
    PIRSFi PIRSF016553. BIGH3_OSF2. 1 hit.
    SMARTi SM00554. FAS1. 4 hits.
    [Graphical view ]
    SUPFAMi SSF82153. SSF82153. 4 hits.
    PROSITEi PS51041. EMI. 1 hit.
    PS50213. FAS1. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Osteoblast-specific factor 2: cloning of a putative bone adhesion protein with homology with the insect protein fasciclin I."
      Takeshita S., Kikuno R., Tezuka K., Amann E.
      Biochem. J. 294:271-278(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Tissue: Osteosarcoma1 Publication and Placenta1 Publication.
    2. "Periostin secreted by epithelial ovarian carcinoma is a ligand for alpha(V)beta(3) and alpha(V)beta(5) integrins and promotes cell motility."
      Gillan L., Matei D., Fishman D.A., Gerbin C.S., Karlan B.Y., Chang D.D.
      Cancer Res. 62:5358-5364(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    3. "Novel isoforms of periostin expressed in the human thyroid."
      Bai Y., Nakamura M., Zhou G., Li Y., Liu Z., Ozaki T., Mori I., Kakudo K.
      Jpn. Clin. Med. 1:13-20(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5; 6; 7), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    4. "Identification and characterization of a novel periodontal ligament-specific periostin isoform."
      Yamada S., Maeda K., Matsubara K., Murakami S.
      Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Periodontal ligament.
    5. "The DNA sequence and analysis of human chromosome 13."
      Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
      Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    8. "OSF-2 expression in head and neck squamous cell carcinomas."
      Habtemichael N., Schweitzer A., Knauer S., Stauber R.H.
      Submitted (NOV-2009) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-798 (ISOFORM 5).
    9. "Serum level of the periostin, a homologue of an insect cell adhesion molecule, as a prognostic marker in nonsmall cell lung carcinomas."
      Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y., Fujii Y., Chen L.B.
      Cancer 92:843-848(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    10. "Acquired expression of periostin by human breast cancers promotes tumor angiogenesis through up-regulation of vascular endothelial growth factor receptor 2 expression."
      Shao R., Bao S., Bai X., Blanchette C., Anderson R.M., Dang T., Gishizky M.L., Marks J.R., Wang X.-F.
      Mol. Cell. Biol. 24:3992-4003(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    11. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
      Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
      J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599.
      Tissue: Plasma.
    12. "Periostin, a member of a novel family of vitamin K-dependent proteins, is expressed by mesenchymal stromal cells."
      Coutu D.L., Wu J.H., Monette A., Rivard G.-E., Blostein M.D., Galipeau J.
      J. Biol. Chem. 283:17991-18001(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, GAMMA-CARBOXYGLUTAMATION.
    13. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599.
      Tissue: Liver.

    Entry informationi

    Entry nameiPOSTN_HUMAN
    AccessioniPrimary (citable) accession number: Q15063
    Secondary accession number(s): B1ALD8
    , C0IMJ1, C0IMJ2, C0IMJ4, D2KRH7, F5H628, Q15064, Q29XZ0, Q3KPJ5, Q5VSY5, Q8IZF9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 26, 2004
    Last sequence update: March 7, 2006
    Last modified: October 1, 2014
    This is version 126 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 13
      Human chromosome 13: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3