Q15063 (POSTN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Periostin Short name=PN Alternative name(s): Osteoblast-specific factor 2 Short name=OSF-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 836 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Enhances incorporation of BMP1 in the fibronectin matrix of connective tissues, and subsequent proteolytic activation of lysyl oxidase LOX By similarity. Induces cell attachment and spreading and plays a role in cell adhesion. May play a role in extracellular matrix mineralization. Ref.2 Ref.11 |
| Subunit structure | Interacts with BMP1 and fibronectin By similarity. |
| Subcellular location | Golgi apparatus By similarity. Secreted › extracellular space › extracellular matrix. Note: Co-localizes with BMP1 in the Golgi By similarity. Ref.2 |
| Tissue specificity | Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers. Ref.2 Ref.7 Ref.9 |
| Post-translational modification | Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium. |
| Sequence similarities | Contains 1 EMI domain. Contains 4 FAS1 domains. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q15063-1) Also known as: OSF-2OS; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.1 (identifier: Q15063-2) Also known as: OSF-2p1; The sequence of this isoform differs from the canonical sequence as follows: 670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K | ||||||
| Isoform 3 Ref.2 (identifier: Q15063-3) The sequence of this isoform differs from the canonical sequence as follows: 670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R 783-810: Missing. | ||||||
| Isoform 4 (identifier: Q15063-4) The sequence of this isoform differs from the canonical sequence as follows: 670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K 783-810: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | ||||||||
| Chain | 22 – 836 | 815 | Periostin | PRO_0000008789 | |||||||
Regions | |||||||||||
| Domain | 40 – 94 | 55 | EMI | ||||||||
| Domain | 97 – 230 | 134 | FAS1 1 | ||||||||
| Domain | 234 – 365 | 132 | FAS1 2 | ||||||||
| Domain | 368 – 492 | 125 | FAS1 3 | ||||||||
| Domain | 496 – 628 | 133 | FAS1 4 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 124 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 125 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 127 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 140 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 154 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 160 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 242 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 244 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 261 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 277 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 280 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 288 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 298 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 313 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 322 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 325 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 496 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 501 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 517 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 523 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 547 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 548 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 550 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 578 | 1 | 4-carboxyglutamate Potential | ||||||||
| Glycosylation | 599 | 1 | N-linked (GlcNAc...) Ref.1 Ref.10 Ref.12 | ||||||||
| Disulfide bond | 44 ↔ 80 | By similarity | |||||||||
| Disulfide bond | 60 ↔ 69 | By similarity | |||||||||
| Disulfide bond | 79 ↔ 92 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 670 – 727 | 58 | TTKII…VIHGE → K in isoform 2 and isoform 4. Ref.1 | VSP_050005 | |||||||
| Alternative sequence | 670 – 697 | 28 | TTKII…IKTEG → R in isoform 3. Ref.2 | VSP_050669 | |||||||
| Alternative sequence | 783 – 810 | 28 | Missing in isoform 3 and isoform 4. | VSP_050670 | |||||||
| Natural variant | 339 | 1 | T → I. Corresponds to variant rs9594223 [ dbSNP | Ensembl ]. | VAR_049115 | |||||||
| Natural variant | 814 | 1 | V → M. Corresponds to variant rs9547952 [ dbSNP | Ensembl ]. | VAR_049116 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 290 | 1 | I → F in BAA02836. Ref.1 | ||||||||
| Sequence conflict | 290 | 1 | I → F in BAA02837. Ref.1 | ||||||||
| Sequence conflict | 290 | 1 | I → F in AAY15840. Ref.3 | ||||||||
| Sequence conflict | 421 | 1 | D → V in BAA02836. Ref.1 | ||||||||
| Sequence conflict | 421 | 1 | D → V in BAA02837. Ref.1 | ||||||||
| Sequence conflict | 421 | 1 | D → V in AAY15840. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Osteoblast-specific factor 2: cloning of a putative bone adhesion protein with homology with the insect protein fasciclin I." Takeshita S., Kikuno R., Tezuka K., Amann E. Biochem. J. 294:271-278(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Osteosarcoma and Placenta. |
| [2] | "Periostin secreted by epithelial ovarian carcinoma is a ligand for alpha(V)beta(3) and alpha(V)beta(5) integrins and promotes cell motility." Gillan L., Matei D., Fishman D.A., Gerbin C.S., Karlan B.Y., Chang D.D. Cancer Res. 62:5358-5364(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "Identification and characterization of a novel periodontal ligament-specific periostin isoform." Yamada S., Maeda K., Matsubara K., Murakami S. Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Periodontal ligament. |
| [4] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [7] | "Serum level of the periostin, a homologue of an insect cell adhesion molecule, as a prognostic marker in nonsmall cell lung carcinomas." Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y., Fujii Y., Chen L.B. Cancer 92:843-848(2001) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | Erratum Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y., Fujii Y., Chen L.B. Cancer 95:2580-2580(2002) |
| [9] | "Acquired expression of periostin by human breast cancers promotes tumor angiogenesis through up-regulation of vascular endothelial growth factor receptor 2 expression." Shao R., Bao S., Bai X., Blanchette C., Anderson R.M., Dang T., Gishizky M.L., Marks J.R., Wang X.-F. Mol. Cell. Biol. 24:3992-4003(2004) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599, MASS SPECTROMETRY. Tissue: Plasma. |
| [11] | "Periostin, a member of a novel family of vitamin K-dependent proteins, is expressed by mesenchymal stromal cells." Coutu D.L., Wu J.H., Monette A., Rivard G.-E., Blostein M.D., Galipeau J. J. Biol. Chem. 283:17991-18001(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, GAMMA-CARBOXYGLUTAMATION. |
| [12] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D13665 mRNA. Translation: BAA02836.1. D13666 mRNA. Translation: BAA02837.1. AY140646 mRNA. Translation: AAN17733.1. AY918092 mRNA. Translation: AAY15840.1. AL138679, AL646087 Genomic DNA. Translation: CAH70107.1. AL646087, AL138679 Genomic DNA. Translation: CAH73568.1. AL138679, AL646087 Genomic DNA. Translation: CAH70104.1. AL646087, AL138679 Genomic DNA. Translation: CAH73569.1. CH471075 Genomic DNA. Translation: EAX08590.1. BC106709 mRNA. Translation: AAI06710.1. BC106710 mRNA. Translation: AAI06711.1. |
| IPI | IPI00007960. IPI00218585. IPI00910262. IPI01009588. |
| PIR | S36110. S36111. |
| RefSeq | NP_001129406.1. NM_001135934.1. NP_001129407.1. NM_001135935.1. NP_001129408.1. NM_001135936.1. NP_006466.2. NM_006475.2. |
| UniGene | Hs.136348. Hs.721018. |
3D structure databases | |
| ProteinModelPortal | Q15063. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000369071. |
PTM databases | |
| PhosphoSite | Q15063. |
Polymorphism databases | |
| DMDM | 93138709. |
Proteomic databases | |
| PaxDb | Q15063. |
| PRIDE | Q15063. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000379742; ENSP00000369066; ENSG00000133110. ENST00000379747; ENSP00000369071; ENSG00000133110. ENST00000541179; ENSP00000437959; ENSG00000133110. |
| GeneID | 10631. |
| KEGG | hsa:10631. |
| UCSC | uc001uwo.4. human. uc001uwp.4. human. uc001uwq.3. human. uc001uwr.3. human. |
Organism-specific databases | |
| CTD | 10631. |
| GeneCards | GC13M038136. |
| HGNC | HGNC:16953. POSTN. |
| HPA | HPA012306. |
| MIM | 608777. gene. |
| neXtProt | NX_Q15063. |
| PharmGKB | PA134900304. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2335. |
| HOGENOM | HOG000220865. |
| HOVERGEN | HBG000715. |
| InParanoid | Q15063. |
| OMA | IHGEPII. |
| PhylomeDB | Q15063. |
Gene expression databases | |
| ArrayExpress | Q15063. |
| Bgee | Q15063. |
| CleanEx | HS_POSTN. |
| Genevestigator | Q15063. |
| GermOnline | ENSG00000133110. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.30.180.10. 4 hits. |
| InterPro | IPR011489. EMI_domain. IPR000782. FAS1_domain. IPR016666. TGFb-ind_bIGH3/osteoblast_fac2. [Graphical view] |
| Pfam | PF02469. Fasciclin. 4 hits. [Graphical view] |
| PIRSF | PIRSF016553. BIGH3_OSF2. 1 hit. |
| SMART | SM00554. FAS1. 4 hits. [Graphical view] |
| SUPFAM | SSF82153. BIgH3_FAS1. 4 hits. |
| PROSITE | PS51041. EMI. 1 hit. PS50213. FAS1. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | POSTN. human. |
| GenomeRNAi | 10631. |
| NextBio | 40399. |
| SOURCE | Search... |
Entry information
| Entry name | POSTN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15063 Secondary accession number(s): Q15064 Q8IZF9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
