Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Periostin

Gene

POSTN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Induces cell attachment and spreading and plays a role in cell adhesion (PubMed:12235007). Enhances incorporation of BMP1 in the fibronectin matrix of connective tissues, and subsequent proteolytic activation of lysyl oxidase LOX (By similarity).By similarity1 Publication

GO - Molecular functioni

  • heparin binding Source: UniProtKB
  • metal ion binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionHeparin-binding
Biological processCell adhesion

Enzyme and pathway databases

SIGNORiQ15063

Names & Taxonomyi

Protein namesi
Recommended name:
Periostin
Short name:
PN
Alternative name(s):
Osteoblast-specific factor 2
Short name:
OSF-2
Gene namesi
Name:POSTN
Synonyms:OSF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000133110.14
HGNCiHGNC:16953 POSTN
MIMi608777 gene
neXtProtiNX_Q15063

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Golgi apparatus, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi10631
OpenTargetsiENSG00000133110
PharmGKBiPA134900304

Polymorphism and mutation databases

BioMutaiPOSTN
DMDMi93138709

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000000878922 – 836PeriostinAdd BLAST815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi44 ↔ 80PROSITE-ProRule annotation
Disulfide bondi60 ↔ 69PROSITE-ProRule annotation
Disulfide bondi79 ↔ 92PROSITE-ProRule annotation
Glycosylationi599N-linked (GlcNAc...) asparagine2 Publications1

Post-translational modificationi

Gamma-carboxylation is controversial. Gamma-carboxyglutamated; gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation; this may be required for calcium binding (PubMed:18450759). According to a more recent report, does not contain vitamin K-dependent gamma-carboxyglutamate residues (PubMed:26273833).2 Publications

Keywords - PTMi

Disulfide bond, Gamma-carboxyglutamic acid, Glycoprotein

Proteomic databases

MaxQBiQ15063
PaxDbiQ15063
PeptideAtlasiQ15063
PRIDEiQ15063
ProteomicsDBi60417
60418 [Q15063-2]
60419 [Q15063-3]
60420 [Q15063-4]

PTM databases

iPTMnetiQ15063
PhosphoSitePlusiQ15063

Expressioni

Tissue specificityi

Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus, thyroid tissue and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers.4 Publications

Gene expression databases

BgeeiENSG00000133110
CleanExiHS_POSTN
ExpressionAtlasiQ15063 baseline and differential
GenevisibleiQ15063 HS

Organism-specific databases

HPAiHPA012306

Interactioni

Subunit structurei

Interacts with BMP1 and fibronectin.By similarity

Protein-protein interaction databases

BioGridi115875, 5 interactors
IntActiQ15063, 3 interactors
MINTiQ15063
STRINGi9606.ENSP00000369071

Structurei

Secondary structure

1836
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi499 – 505Combined sources7
Helixi507 – 509Combined sources3
Helixi510 – 518Combined sources9
Turni522 – 526Combined sources5
Beta strandi527 – 529Combined sources3
Beta strandi531 – 536Combined sources6
Helixi538 – 541Combined sources4
Helixi546 – 553Combined sources8
Helixi556 – 563Combined sources8
Turni564 – 566Combined sources3
Beta strandi568 – 570Combined sources3
Beta strandi583 – 586Combined sources4
Beta strandi590 – 598Combined sources9
Beta strandi601 – 604Combined sources4
Beta strandi610 – 615Combined sources6
Beta strandi617 – 626Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5WT7NMR-A496-632[»]
ProteinModelPortaliQ15063
SMRiQ15063
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 94EMIPROSITE-ProRule annotationAdd BLAST55
Domaini97 – 230FAS1 1PROSITE-ProRule annotationCuratedAdd BLAST134
Domaini234 – 365FAS1 2PROSITE-ProRule annotationCuratedAdd BLAST132
Domaini368 – 492FAS1 3PROSITE-ProRule annotationCuratedAdd BLAST125
Domaini496 – 628FAS1 4PROSITE-ProRule annotationCuratedAdd BLAST133

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiKOG1437 Eukaryota
COG2335 LUCA
GeneTreeiENSGT00530000063860
HOGENOMiHOG000220865
HOVERGENiHBG000715
InParanoidiQ15063
OMAiNELYNGQ
OrthoDBiEOG091G020T
PhylomeDBiQ15063
TreeFamiTF316269

Family and domain databases

Gene3Di2.30.180.10, 4 hits
InterProiView protein in InterPro
IPR011489 EMI_domain
IPR036378 FAS1_dom_sf
IPR000782 FAS1_domain
IPR016666 TGFBI/POSTN
PfamiView protein in Pfam
PF02469 Fasciclin, 4 hits
PIRSFiPIRSF016553 BIGH3_OSF2, 1 hit
SMARTiView protein in SMART
SM00554 FAS1, 4 hits
SUPFAMiSSF82153 SSF82153, 4 hits
PROSITEiView protein in PROSITE
PS51041 EMI, 1 hit
PS50213 FAS1, 4 hits

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q15063-1) [UniParc]FASTAAdd to basket
Also known as: OSF-2OS1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIPFLPMFSL LLLLIVNPIN ANNHYDKILA HSRIRGRDQG PNVCALQQIL
60 70 80 90 100
GTKKKYFSTC KNWYKKSICG QKTTVLYECC PGYMRMEGMK GCPAVLPIDH
110 120 130 140 150
VYGTLGIVGA TTTQRYSDAS KLREEIEGKG SFTYFAPSNE AWDNLDSDIR
160 170 180 190 200
RGLESNVNVE LLNALHSHMI NKRMLTKDLK NGMIIPSMYN NLGLFINHYP
210 220 230 240 250
NGVVTVNCAR IIHGNQIATN GVVHVIDRVL TQIGTSIQDF IEAEDDLSSF
260 270 280 290 300
RAAAITSDIL EALGRDGHFT LFAPTNEAFE KLPRGVLERI MGDKVASEAL
310 320 330 340 350
MKYHILNTLQ CSESIMGGAV FETLEGNTIE IGCDGDSITV NGIKMVNKKD
360 370 380 390 400
IVTNNGVIHL IDQVLIPDSA KQVIELAGKQ QTTFTDLVAQ LGLASALRPD
410 420 430 440 450
GEYTLLAPVN NAFSDDTLSM DQRLLKLILQ NHILKVKVGL NELYNGQILE
460 470 480 490 500
TIGGKQLRVF VYRTAVCIEN SCMEKGSKQG RNGAIHIFRE IIKPAEKSLH
510 520 530 540 550
EKLKQDKRFS TFLSLLEAAD LKELLTQPGD WTLFVPTNDA FKGMTSEEKE
560 570 580 590 600
ILIRDKNALQ NIILYHLTPG VFIGKGFEPG VTNILKTTQG SKIFLKEVND
610 620 630 640 650
TLLVNELKSK ESDIMTTNGV IHVVDKLLYP ADTPVGNDQL LEILNKLIKY
660 670 680 690 700
IQIKFVRGST FKEIPVTVYT TKIITKVVEP KIKVIEGSLQ PIIKTEGPTL
710 720 730 740 750
TKVKIEGEPE FRLIKEGETI TEVIHGEPII KKYTKIIDGV PVEITEKETR
760 770 780 790 800
EERIITGPEI KYTRISTGGG ETEETLKKLL QEEVTKVTKF IEGGDGHLFE
810 820 830
DEEIKRLLQG DTPVRKLQAN KKVQGSRRRL REGRSQ
Length:836
Mass (Da):93,314
Last modified:March 7, 2006 - v2
Checksum:i55E7B82D094824FD
GO
Isoform 21 Publication (identifier: Q15063-2) [UniParc]FASTAAdd to basket
Also known as: OSF-2p1

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K

Show »
Length:779
Mass (Da):87,021
Checksum:iC6936F32A42B8366
GO
Isoform 31 Publication (identifier: Q15063-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R
     783-810: Missing.

Show »
Length:781
Mass (Da):87,254
Checksum:iD082BC8F86ABAC37
GO
Isoform 4 (identifier: Q15063-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K
     783-810: Missing.

Show »
Length:751
Mass (Da):83,850
Checksum:i7241170E4CDC18D3
GO
Isoform 5 (identifier: Q15063-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R

Show »
Length:809
Mass (Da):90,424
Checksum:i43DECD94CB76B07A
GO
Isoform 6 (identifier: Q15063-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-757: TTKIITKVVE...ETREERIITG → S

Show »
Length:749
Mass (Da):83,527
Checksum:i13F23F62B1C1AAE9
GO
Isoform 7 (identifier: Q15063-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-757: TTKIITKVVE...ETREERIITG → S
     783-810: Missing.

Show »
Length:721
Mass (Da):80,357
Checksum:iCE5CEFA7E156957B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti290I → F in BAA02836 (PubMed:8363580).Curated1
Sequence conflicti290I → F in BAA02837 (PubMed:8363580).Curated1
Sequence conflicti290I → F in ABY86630 (PubMed:23946676).Curated1
Sequence conflicti290I → F in ABY86631 (PubMed:23946676).Curated1
Sequence conflicti290I → F in ABY86633 (PubMed:23946676).Curated1
Sequence conflicti290I → F in AAY15840 (Ref. 4) Curated1
Sequence conflicti421D → V in BAA02836 (PubMed:8363580).Curated1
Sequence conflicti421D → V in BAA02837 (PubMed:8363580).Curated1
Sequence conflicti421D → V in ABY86630 (PubMed:23946676).Curated1
Sequence conflicti421D → V in ABY86631 (PubMed:23946676).Curated1
Sequence conflicti421D → V in ABY86633 (PubMed:23946676).Curated1
Sequence conflicti421D → V in AAY15840 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049115339T → I. Corresponds to variant dbSNP:rs9594223Ensembl.1
Natural variantiVAR_049116814V → M. Corresponds to variant dbSNP:rs9547952Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055183670 – 757TTKII…RIITG → S in isoform 6 and isoform 7. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_050005670 – 727TTKII…VIHGE → K in isoform 2 and isoform 4. 3 PublicationsAdd BLAST58
Alternative sequenceiVSP_050669670 – 697TTKII…IKTEG → R in isoform 3 and isoform 5. 3 PublicationsAdd BLAST28
Alternative sequenceiVSP_050670783 – 810Missing in isoform 3, isoform 4 and isoform 7. 3 PublicationsAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13665 mRNA Translation: BAA02836.1
D13666 mRNA Translation: BAA02837.1
AY140646 mRNA Translation: AAN17733.1
EU262883 mRNA Translation: ABY86630.1
EU262884 mRNA Translation: ABY86631.1
EU262886 mRNA Translation: ABY86633.1
AY918092 mRNA Translation: AAY15840.1
AL138679 Genomic DNA No translation available.
AL646087 Genomic DNA No translation available.
CH471075 Genomic DNA Translation: EAX08590.1
BC106709 mRNA Translation: AAI06710.1
BC106710 mRNA Translation: AAI06711.1
GU354210 mRNA Translation: ADA79517.1
CCDSiCCDS45034.1 [Q15063-2]
CCDS53864.1 [Q15063-3]
CCDS66530.1 [Q15063-6]
CCDS66531.1 [Q15063-5]
CCDS9364.1 [Q15063-1]
PIRiS36110
S36111
RefSeqiNP_001129406.1, NM_001135934.1 [Q15063-2]
NP_001129407.1, NM_001135935.1 [Q15063-3]
NP_001129408.1, NM_001135936.1 [Q15063-4]
NP_001273594.1, NM_001286665.1 [Q15063-5]
NP_001273595.1, NM_001286666.1 [Q15063-6]
NP_001273596.1, NM_001286667.1 [Q15063-7]
NP_001317446.1, NM_001330517.1
NP_006466.2, NM_006475.2 [Q15063-1]
UniGeneiHs.136348
Hs.721018

Genome annotation databases

EnsembliENST00000379742; ENSP00000369066; ENSG00000133110 [Q15063-2]
ENST00000379743; ENSP00000369067; ENSG00000133110 [Q15063-5]
ENST00000379747; ENSP00000369071; ENSG00000133110 [Q15063-1]
ENST00000541179; ENSP00000437959; ENSG00000133110 [Q15063-3]
ENST00000541481; ENSP00000437953; ENSG00000133110 [Q15063-6]
GeneIDi10631
KEGGihsa:10631
UCSCiuc001uwo.5 human [Q15063-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiPOSTN_HUMAN
AccessioniPrimary (citable) accession number: Q15063
Secondary accession number(s): B1ALD8
, C0IMJ1, C0IMJ2, C0IMJ4, D2KRH7, F5H628, Q15064, Q29XZ0, Q3KPJ5, Q5VSY5, Q8IZF9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: March 7, 2006
Last modified: June 20, 2018
This is version 162 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health