Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q15063 (POSTN_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 121. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Periostin

Short name=PN
Alternative name(s):
Osteoblast-specific factor 2
Short name=OSF-2
Gene names
Name:POSTN
Synonyms:OSF2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length836 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Enhances incorporation of BMP1 in the fibronectin matrix of connective tissues, and subsequent proteolytic activation of lysyl oxidase LOX By similarity. Induces cell attachment and spreading and plays a role in cell adhesion. May play a role in extracellular matrix mineralization. Ref.2 Ref.11

Subunit structure

Interacts with BMP1 and fibronectin By similarity.

Subcellular location

Golgi apparatus By similarity. Secretedextracellular spaceextracellular matrix. Note: Colocalizes with BMP1 in the Golgi By similarity. Ref.2

Tissue specificity

Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers. Ref.2 Ref.7 Ref.9

Post-translational modification

Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.

Sequence similarities

Contains 1 EMI domain.

Contains 4 FAS1 domains.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 Ref.1 (identifier: Q15063-1)

Also known as: OSF-2OS;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 Ref.1 (identifier: Q15063-2)

Also known as: OSF-2p1;

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K
Isoform 3 Ref.2 (identifier: Q15063-3)

The sequence of this isoform differs from the canonical sequence as follows:
     670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R
     783-810: Missing.
Isoform 4 (identifier: Q15063-4)

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K
     783-810: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2121 Potential
Chain22 – 836815Periostin
PRO_0000008789

Regions

Domain40 – 9455EMI
Domain97 – 230134FAS1 1
Domain234 – 365132FAS1 2
Domain368 – 492125FAS1 3
Domain496 – 628133FAS1 4

Amino acid modifications

Modified residue12414-carboxyglutamate Potential
Modified residue12514-carboxyglutamate Potential
Modified residue12714-carboxyglutamate Potential
Modified residue14014-carboxyglutamate Potential
Modified residue15414-carboxyglutamate Potential
Modified residue16014-carboxyglutamate Potential
Modified residue24214-carboxyglutamate Potential
Modified residue24414-carboxyglutamate Potential
Modified residue26114-carboxyglutamate Potential
Modified residue27714-carboxyglutamate Potential
Modified residue28014-carboxyglutamate Potential
Modified residue28814-carboxyglutamate Potential
Modified residue29814-carboxyglutamate Potential
Modified residue31314-carboxyglutamate Potential
Modified residue32214-carboxyglutamate Potential
Modified residue32514-carboxyglutamate Potential
Modified residue49614-carboxyglutamate Potential
Modified residue50114-carboxyglutamate Potential
Modified residue51714-carboxyglutamate Potential
Modified residue52314-carboxyglutamate Potential
Modified residue54714-carboxyglutamate Potential
Modified residue54814-carboxyglutamate Potential
Modified residue55014-carboxyglutamate Potential
Modified residue57814-carboxyglutamate Potential
Glycosylation5991N-linked (GlcNAc...) Ref.1 Ref.10 Ref.12
Disulfide bond44 ↔ 80 By similarity
Disulfide bond60 ↔ 69 By similarity
Disulfide bond79 ↔ 92 By similarity

Natural variations

Alternative sequence670 – 72758TTKII…VIHGE → K in isoform 2 and isoform 4. Ref.1
VSP_050005
Alternative sequence670 – 69728TTKII…IKTEG → R in isoform 3. Ref.2
VSP_050669
Alternative sequence783 – 81028Missing in isoform 3 and isoform 4.
VSP_050670
Natural variant3391T → I.
Corresponds to variant rs9594223 [ dbSNP | Ensembl ].
VAR_049115
Natural variant8141V → M.
Corresponds to variant rs9547952 [ dbSNP | Ensembl ].
VAR_049116

Experimental info

Sequence conflict2901I → F in BAA02836. Ref.1
Sequence conflict2901I → F in BAA02837. Ref.1
Sequence conflict2901I → F in AAY15840. Ref.3
Sequence conflict4211D → V in BAA02836. Ref.1
Sequence conflict4211D → V in BAA02837. Ref.1
Sequence conflict4211D → V in AAY15840. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (OSF-2OS) [UniParc].

Last modified March 7, 2006. Version 2.
Checksum: 55E7B82D094824FD

FASTA83693,314
        10         20         30         40         50         60 
MIPFLPMFSL LLLLIVNPIN ANNHYDKILA HSRIRGRDQG PNVCALQQIL GTKKKYFSTC 

        70         80         90        100        110        120 
KNWYKKSICG QKTTVLYECC PGYMRMEGMK GCPAVLPIDH VYGTLGIVGA TTTQRYSDAS 

       130        140        150        160        170        180 
KLREEIEGKG SFTYFAPSNE AWDNLDSDIR RGLESNVNVE LLNALHSHMI NKRMLTKDLK 

       190        200        210        220        230        240 
NGMIIPSMYN NLGLFINHYP NGVVTVNCAR IIHGNQIATN GVVHVIDRVL TQIGTSIQDF 

       250        260        270        280        290        300 
IEAEDDLSSF RAAAITSDIL EALGRDGHFT LFAPTNEAFE KLPRGVLERI MGDKVASEAL 

       310        320        330        340        350        360 
MKYHILNTLQ CSESIMGGAV FETLEGNTIE IGCDGDSITV NGIKMVNKKD IVTNNGVIHL 

       370        380        390        400        410        420 
IDQVLIPDSA KQVIELAGKQ QTTFTDLVAQ LGLASALRPD GEYTLLAPVN NAFSDDTLSM 

       430        440        450        460        470        480 
DQRLLKLILQ NHILKVKVGL NELYNGQILE TIGGKQLRVF VYRTAVCIEN SCMEKGSKQG 

       490        500        510        520        530        540 
RNGAIHIFRE IIKPAEKSLH EKLKQDKRFS TFLSLLEAAD LKELLTQPGD WTLFVPTNDA 

       550        560        570        580        590        600 
FKGMTSEEKE ILIRDKNALQ NIILYHLTPG VFIGKGFEPG VTNILKTTQG SKIFLKEVND 

       610        620        630        640        650        660 
TLLVNELKSK ESDIMTTNGV IHVVDKLLYP ADTPVGNDQL LEILNKLIKY IQIKFVRGST 

       670        680        690        700        710        720 
FKEIPVTVYT TKIITKVVEP KIKVIEGSLQ PIIKTEGPTL TKVKIEGEPE FRLIKEGETI 

       730        740        750        760        770        780 
TEVIHGEPII KKYTKIIDGV PVEITEKETR EERIITGPEI KYTRISTGGG ETEETLKKLL 

       790        800        810        820        830 
QEEVTKVTKF IEGGDGHLFE DEEIKRLLQG DTPVRKLQAN KKVQGSRRRL REGRSQ 

« Hide

Isoform 2 (OSF-2p1) [UniParc].

Checksum: C6936F32A42B8366
Show »

FASTA77987,021
Isoform 3 [UniParc].

Checksum: D082BC8F86ABAC37
Show »

FASTA78187,254
Isoform 4 [UniParc].

Checksum: 7241170E4CDC18D3
Show »

FASTA75183,850

References

« Hide 'large scale' references
[1]"Osteoblast-specific factor 2: cloning of a putative bone adhesion protein with homology with the insect protein fasciclin I."
Takeshita S., Kikuno R., Tezuka K., Amann E.
Biochem. J. 294:271-278(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Tissue: Osteosarcoma and Placenta.
[2]"Periostin secreted by epithelial ovarian carcinoma is a ligand for alpha(V)beta(3) and alpha(V)beta(5) integrins and promotes cell motility."
Gillan L., Matei D., Fishman D.A., Gerbin C.S., Karlan B.Y., Chang D.D.
Cancer Res. 62:5358-5364(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[3]"Identification and characterization of a novel periodontal ligament-specific periostin isoform."
Yamada S., Maeda K., Matsubara K., Murakami S.
Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
Tissue: Periodontal ligament.
[4]"The DNA sequence and analysis of human chromosome 13."
Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[7]"Serum level of the periostin, a homologue of an insect cell adhesion molecule, as a prognostic marker in nonsmall cell lung carcinomas."
Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y., Fujii Y., Chen L.B.
Cancer 92:843-848(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[8]Erratum
Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y., Fujii Y., Chen L.B.
Cancer 95:2580-2580(2002)
[9]"Acquired expression of periostin by human breast cancers promotes tumor angiogenesis through up-regulation of vascular endothelial growth factor receptor 2 expression."
Shao R., Bao S., Bai X., Blanchette C., Anderson R.M., Dang T., Gishizky M.L., Marks J.R., Wang X.-F.
Mol. Cell. Biol. 24:3992-4003(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[10]"Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599.
Tissue: Plasma.
[11]"Periostin, a member of a novel family of vitamin K-dependent proteins, is expressed by mesenchymal stromal cells."
Coutu D.L., Wu J.H., Monette A., Rivard G.-E., Blostein M.D., Galipeau J.
J. Biol. Chem. 283:17991-18001(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, GAMMA-CARBOXYGLUTAMATION.
[12]"Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599.
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D13665 mRNA. Translation: BAA02836.1.
D13666 mRNA. Translation: BAA02837.1.
AY140646 mRNA. Translation: AAN17733.1.
AY918092 mRNA. Translation: AAY15840.1.
AL138679, AL646087 Genomic DNA. Translation: CAH70107.1.
AL646087, AL138679 Genomic DNA. Translation: CAH73568.1.
AL138679, AL646087 Genomic DNA. Translation: CAH70104.1.
AL646087, AL138679 Genomic DNA. Translation: CAH73569.1.
CH471075 Genomic DNA. Translation: EAX08590.1.
BC106709 mRNA. Translation: AAI06710.1.
BC106710 mRNA. Translation: AAI06711.1.
PIRS36110.
S36111.
RefSeqNP_001129406.1. NM_001135934.1.
NP_001129407.1. NM_001135935.1.
NP_001129408.1. NM_001135936.1.
NP_001273594.1. NM_001286665.1.
NP_001273595.1. NM_001286666.1.
NP_001273596.1. NM_001286667.1.
NP_006466.2. NM_006475.2.
UniGeneHs.136348.
Hs.721018.

3D structure databases

ProteinModelPortalQ15063.
SMRQ15063. Positions 99-230, 236-367, 378-496, 503-628.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ15063. 2 interactions.
MINTMINT-4533078.
STRING9606.ENSP00000369071.

PTM databases

PhosphoSiteQ15063.

Polymorphism databases

DMDM93138709.

Proteomic databases

PaxDbQ15063.
PRIDEQ15063.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000379742; ENSP00000369066; ENSG00000133110. [Q15063-2]
ENST00000379747; ENSP00000369071; ENSG00000133110. [Q15063-1]
ENST00000541179; ENSP00000437959; ENSG00000133110. [Q15063-3]
GeneID10631.
KEGGhsa:10631.
UCSCuc001uwo.4. human. [Q15063-1]
uc001uwp.4. human. [Q15063-2]
uc001uwq.3. human. [Q15063-4]
uc001uwr.3. human. [Q15063-3]

Organism-specific databases

CTD10631.
GeneCardsGC13M038136.
HGNCHGNC:16953. POSTN.
HPAHPA012306.
MIM608777. gene.
neXtProtNX_Q15063.
PharmGKBPA134900304.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2335.
HOGENOMHOG000220865.
HOVERGENHBG000715.
InParanoidQ15063.
OMAHGEPIIK.
PhylomeDBQ15063.
TreeFamTF316269.

Gene expression databases

ArrayExpressQ15063.
BgeeQ15063.
CleanExHS_POSTN.
GenevestigatorQ15063.

Family and domain databases

Gene3D2.30.180.10. 4 hits.
InterProIPR011489. EMI_domain.
IPR000782. FAS1_domain.
IPR016666. TGFb-ind_bIGH3/osteoblast_fac2.
[Graphical view]
PfamPF02469. Fasciclin. 4 hits.
[Graphical view]
PIRSFPIRSF016553. BIGH3_OSF2. 1 hit.
SMARTSM00554. FAS1. 4 hits.
[Graphical view]
SUPFAMSSF82153. SSF82153. 4 hits.
PROSITEPS51041. EMI. 1 hit.
PS50213. FAS1. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPOSTN. human.
GeneWikiPeriostin.
POSTN.
GenomeRNAi10631.
NextBio40399.
PROQ15063.
SOURCESearch...

Entry information

Entry namePOSTN_HUMAN
AccessionPrimary (citable) accession number: Q15063
Secondary accession number(s): Q15064 expand/collapse secondary AC list , Q29XZ0, Q3KPJ5, Q5VSY5, Q8IZF9
Entry history
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: March 7, 2006
Last modified: March 19, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 13

Human chromosome 13: entries, gene names and cross-references to MIM