Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q15063

- POSTN_HUMAN

UniProt

Q15063 - POSTN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Periostin

Gene

POSTN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Enhances incorporation of BMP1 in the fibronectin matrix of connective tissues, and subsequent proteolytic activation of lysyl oxidase LOX (By similarity). Induces cell attachment and spreading and plays a role in cell adhesion. May play a role in extracellular matrix mineralization.By similarity2 Publications

GO - Molecular functioni

  1. heparin binding Source: UniProtKB

GO - Biological processi

  1. cell adhesion Source: UniProtKB
  2. extracellular matrix organization Source: Ensembl
  3. regulation of Notch signaling pathway Source: Ensembl
  4. skeletal system development Source: ProtInc
  5. tissue development Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Heparin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Periostin
Short name:
PN
Alternative name(s):
Osteoblast-specific factor 2
Short name:
OSF-2
Gene namesi
Name:POSTN
Synonyms:OSF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 13

Organism-specific databases

HGNCiHGNC:16953. POSTN.

Subcellular locationi

Golgi apparatus By similarity. Secretedextracellular spaceextracellular matrix 1 Publication
Note: Colocalizes with BMP1 in the Golgi.By similarity

GO - Cellular componenti

  1. proteinaceous extracellular matrix Source: UniProtKB
  2. trans-Golgi network Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Golgi apparatus, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134900304.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence AnalysisAdd
BLAST
Chaini22 – 836815PeriostinPRO_0000008789Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi44 ↔ 80PROSITE-ProRule annotation
Disulfide bondi60 ↔ 69PROSITE-ProRule annotation
Disulfide bondi79 ↔ 92PROSITE-ProRule annotation
Modified residuei124 – 12414-carboxyglutamateSequence Analysis
Modified residuei125 – 12514-carboxyglutamateSequence Analysis
Modified residuei127 – 12714-carboxyglutamateSequence Analysis
Modified residuei140 – 14014-carboxyglutamateSequence Analysis
Modified residuei154 – 15414-carboxyglutamateSequence Analysis
Modified residuei160 – 16014-carboxyglutamateSequence Analysis
Modified residuei242 – 24214-carboxyglutamateSequence Analysis
Modified residuei244 – 24414-carboxyglutamateSequence Analysis
Modified residuei261 – 26114-carboxyglutamateSequence Analysis
Modified residuei277 – 27714-carboxyglutamateSequence Analysis
Modified residuei280 – 28014-carboxyglutamateSequence Analysis
Modified residuei288 – 28814-carboxyglutamateSequence Analysis
Modified residuei298 – 29814-carboxyglutamateSequence Analysis
Modified residuei313 – 31314-carboxyglutamateSequence Analysis
Modified residuei322 – 32214-carboxyglutamateSequence Analysis
Modified residuei325 – 32514-carboxyglutamateSequence Analysis
Modified residuei496 – 49614-carboxyglutamateSequence Analysis
Modified residuei501 – 50114-carboxyglutamateSequence Analysis
Modified residuei517 – 51714-carboxyglutamateSequence Analysis
Modified residuei523 – 52314-carboxyglutamateSequence Analysis
Modified residuei547 – 54714-carboxyglutamateSequence Analysis
Modified residuei548 – 54814-carboxyglutamateSequence Analysis
Modified residuei550 – 55014-carboxyglutamateSequence Analysis
Modified residuei578 – 57814-carboxyglutamateSequence Analysis
Glycosylationi599 – 5991N-linked (GlcNAc...)2 Publications

Post-translational modificationi

Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.1 Publication

Keywords - PTMi

Disulfide bond, Gamma-carboxyglutamic acid, Glycoprotein

Proteomic databases

MaxQBiQ15063.
PaxDbiQ15063.
PRIDEiQ15063.

PTM databases

PhosphoSiteiQ15063.

Expressioni

Tissue specificityi

Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus, thyroid tissue and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers.4 Publications

Gene expression databases

BgeeiQ15063.
CleanExiHS_POSTN.
ExpressionAtlasiQ15063. baseline and differential.
GenevestigatoriQ15063.

Organism-specific databases

HPAiHPA012306.

Interactioni

Subunit structurei

Interacts with BMP1 and fibronectin.By similarity

Protein-protein interaction databases

IntActiQ15063. 2 interactions.
MINTiMINT-4533078.
STRINGi9606.ENSP00000369071.

Structurei

3D structure databases

ProteinModelPortaliQ15063.
SMRiQ15063. Positions 236-367, 503-630.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini40 – 9455EMIPROSITE-ProRule annotationAdd
BLAST
Domaini97 – 230134FAS1 1CuratedPROSITE-ProRule annotationAdd
BLAST
Domaini234 – 365132FAS1 2CuratedPROSITE-ProRule annotationAdd
BLAST
Domaini368 – 492125FAS1 3CuratedPROSITE-ProRule annotationAdd
BLAST
Domaini496 – 628133FAS1 4CuratedPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 EMI domain.PROSITE-ProRule annotation
Contains 4 FAS1 domains.CuratedPROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiCOG2335.
GeneTreeiENSGT00530000063860.
HOGENOMiHOG000220865.
HOVERGENiHBG000715.
InParanoidiQ15063.
OMAiHGEPIIK.
PhylomeDBiQ15063.
TreeFamiTF316269.

Family and domain databases

Gene3Di2.30.180.10. 4 hits.
InterProiIPR011489. EMI_domain.
IPR000782. FAS1_domain.
IPR016666. TGFb-ind_bIGH3/osteoblast_fac2.
[Graphical view]
PfamiPF02469. Fasciclin. 4 hits.
[Graphical view]
PIRSFiPIRSF016553. BIGH3_OSF2. 1 hit.
SMARTiSM00554. FAS1. 4 hits.
[Graphical view]
SUPFAMiSSF82153. SSF82153. 4 hits.
PROSITEiPS51041. EMI. 1 hit.
PS50213. FAS1. 4 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q15063-1) [UniParc]FASTAAdd to Basket

Also known as: OSF-2OS1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIPFLPMFSL LLLLIVNPIN ANNHYDKILA HSRIRGRDQG PNVCALQQIL
60 70 80 90 100
GTKKKYFSTC KNWYKKSICG QKTTVLYECC PGYMRMEGMK GCPAVLPIDH
110 120 130 140 150
VYGTLGIVGA TTTQRYSDAS KLREEIEGKG SFTYFAPSNE AWDNLDSDIR
160 170 180 190 200
RGLESNVNVE LLNALHSHMI NKRMLTKDLK NGMIIPSMYN NLGLFINHYP
210 220 230 240 250
NGVVTVNCAR IIHGNQIATN GVVHVIDRVL TQIGTSIQDF IEAEDDLSSF
260 270 280 290 300
RAAAITSDIL EALGRDGHFT LFAPTNEAFE KLPRGVLERI MGDKVASEAL
310 320 330 340 350
MKYHILNTLQ CSESIMGGAV FETLEGNTIE IGCDGDSITV NGIKMVNKKD
360 370 380 390 400
IVTNNGVIHL IDQVLIPDSA KQVIELAGKQ QTTFTDLVAQ LGLASALRPD
410 420 430 440 450
GEYTLLAPVN NAFSDDTLSM DQRLLKLILQ NHILKVKVGL NELYNGQILE
460 470 480 490 500
TIGGKQLRVF VYRTAVCIEN SCMEKGSKQG RNGAIHIFRE IIKPAEKSLH
510 520 530 540 550
EKLKQDKRFS TFLSLLEAAD LKELLTQPGD WTLFVPTNDA FKGMTSEEKE
560 570 580 590 600
ILIRDKNALQ NIILYHLTPG VFIGKGFEPG VTNILKTTQG SKIFLKEVND
610 620 630 640 650
TLLVNELKSK ESDIMTTNGV IHVVDKLLYP ADTPVGNDQL LEILNKLIKY
660 670 680 690 700
IQIKFVRGST FKEIPVTVYT TKIITKVVEP KIKVIEGSLQ PIIKTEGPTL
710 720 730 740 750
TKVKIEGEPE FRLIKEGETI TEVIHGEPII KKYTKIIDGV PVEITEKETR
760 770 780 790 800
EERIITGPEI KYTRISTGGG ETEETLKKLL QEEVTKVTKF IEGGDGHLFE
810 820 830
DEEIKRLLQG DTPVRKLQAN KKVQGSRRRL REGRSQ
Length:836
Mass (Da):93,314
Last modified:March 7, 2006 - v2
Checksum:i55E7B82D094824FD
GO
Isoform 21 Publication (identifier: Q15063-2) [UniParc]FASTAAdd to Basket

Also known as: OSF-2p1

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K

Show »
Length:779
Mass (Da):87,021
Checksum:iC6936F32A42B8366
GO
Isoform 31 Publication (identifier: Q15063-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R
     783-810: Missing.

Show »
Length:781
Mass (Da):87,254
Checksum:iD082BC8F86ABAC37
GO
Isoform 4 (identifier: Q15063-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K
     783-810: Missing.

Show »
Length:751
Mass (Da):83,850
Checksum:i7241170E4CDC18D3
GO
Isoform 5 (identifier: Q15063-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R

Show »
Length:809
Mass (Da):90,424
Checksum:i43DECD94CB76B07A
GO
Isoform 6 (identifier: Q15063-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-757: TTKIITKVVE...ETREERIITG → S

Show »
Length:749
Mass (Da):83,527
Checksum:i13F23F62B1C1AAE9
GO
Isoform 7 (identifier: Q15063-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-757: TTKIITKVVE...ETREERIITG → S
     783-810: Missing.

Show »
Length:721
Mass (Da):80,357
Checksum:iCE5CEFA7E156957B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti290 – 2901I → F in BAA02836. (PubMed:8363580)Curated
Sequence conflicti290 – 2901I → F in BAA02837. (PubMed:8363580)Curated
Sequence conflicti290 – 2901I → F in ABY86630. (PubMed:23946676)Curated
Sequence conflicti290 – 2901I → F in ABY86631. (PubMed:23946676)Curated
Sequence conflicti290 – 2901I → F in ABY86633. (PubMed:23946676)Curated
Sequence conflicti290 – 2901I → F in AAY15840. 1 PublicationCurated
Sequence conflicti421 – 4211D → V in BAA02836. (PubMed:8363580)Curated
Sequence conflicti421 – 4211D → V in BAA02837. (PubMed:8363580)Curated
Sequence conflicti421 – 4211D → V in ABY86630. (PubMed:23946676)Curated
Sequence conflicti421 – 4211D → V in ABY86631. (PubMed:23946676)Curated
Sequence conflicti421 – 4211D → V in ABY86633. (PubMed:23946676)Curated
Sequence conflicti421 – 4211D → V in AAY15840. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti339 – 3391T → I.
Corresponds to variant rs9594223 [ dbSNP | Ensembl ].
VAR_049115
Natural varianti814 – 8141V → M.
Corresponds to variant rs9547952 [ dbSNP | Ensembl ].
VAR_049116

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei670 – 75788TTKII…RIITG → S in isoform 6 and isoform 7. 1 PublicationVSP_055183Add
BLAST
Alternative sequencei670 – 72758TTKII…VIHGE → K in isoform 2 and isoform 4. 3 PublicationsVSP_050005Add
BLAST
Alternative sequencei670 – 69728TTKII…IKTEG → R in isoform 3 and isoform 5. 3 PublicationsVSP_050669Add
BLAST
Alternative sequencei783 – 81028Missing in isoform 3, isoform 4 and isoform 7. 3 PublicationsVSP_050670Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13665 mRNA. Translation: BAA02836.1.
D13666 mRNA. Translation: BAA02837.1.
AY140646 mRNA. Translation: AAN17733.1.
EU262883 mRNA. Translation: ABY86630.1.
EU262884 mRNA. Translation: ABY86631.1.
EU262886 mRNA. Translation: ABY86633.1.
AY918092 mRNA. Translation: AAY15840.1.
AL138679, AL646087 Genomic DNA. Translation: CAH70107.1.
AL646087, AL138679 Genomic DNA. Translation: CAH73568.1.
AL138679, AL646087 Genomic DNA. Translation: CAH70104.1.
AL646087, AL138679 Genomic DNA. Translation: CAH73569.1.
CH471075 Genomic DNA. Translation: EAX08590.1.
BC106709 mRNA. Translation: AAI06710.1.
BC106710 mRNA. Translation: AAI06711.1.
GU354210 mRNA. Translation: ADA79517.1.
CCDSiCCDS45034.1. [Q15063-2]
CCDS53864.1. [Q15063-3]
CCDS66530.1. [Q15063-6]
CCDS66531.1. [Q15063-5]
CCDS9364.1. [Q15063-1]
PIRiS36110.
S36111.
RefSeqiNP_001129406.1. NM_001135934.1. [Q15063-2]
NP_001129407.1. NM_001135935.1. [Q15063-3]
NP_001129408.1. NM_001135936.1. [Q15063-4]
NP_001273594.1. NM_001286665.1. [Q15063-5]
NP_001273595.1. NM_001286666.1. [Q15063-6]
NP_001273596.1. NM_001286667.1. [Q15063-7]
NP_006466.2. NM_006475.2. [Q15063-1]
UniGeneiHs.136348.
Hs.721018.

Genome annotation databases

EnsembliENST00000379742; ENSP00000369066; ENSG00000133110. [Q15063-2]
ENST00000379743; ENSP00000369067; ENSG00000133110. [Q15063-5]
ENST00000379747; ENSP00000369071; ENSG00000133110. [Q15063-1]
ENST00000541179; ENSP00000437959; ENSG00000133110. [Q15063-3]
ENST00000541481; ENSP00000437953; ENSG00000133110. [Q15063-6]
GeneIDi10631.
KEGGihsa:10631.
UCSCiuc001uwo.4. human. [Q15063-1]
uc001uwp.4. human. [Q15063-2]
uc001uwq.3. human. [Q15063-4]
uc001uwr.3. human. [Q15063-3]

Polymorphism databases

DMDMi93138709.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13665 mRNA. Translation: BAA02836.1 .
D13666 mRNA. Translation: BAA02837.1 .
AY140646 mRNA. Translation: AAN17733.1 .
EU262883 mRNA. Translation: ABY86630.1 .
EU262884 mRNA. Translation: ABY86631.1 .
EU262886 mRNA. Translation: ABY86633.1 .
AY918092 mRNA. Translation: AAY15840.1 .
AL138679 , AL646087 Genomic DNA. Translation: CAH70107.1 .
AL646087 , AL138679 Genomic DNA. Translation: CAH73568.1 .
AL138679 , AL646087 Genomic DNA. Translation: CAH70104.1 .
AL646087 , AL138679 Genomic DNA. Translation: CAH73569.1 .
CH471075 Genomic DNA. Translation: EAX08590.1 .
BC106709 mRNA. Translation: AAI06710.1 .
BC106710 mRNA. Translation: AAI06711.1 .
GU354210 mRNA. Translation: ADA79517.1 .
CCDSi CCDS45034.1. [Q15063-2 ]
CCDS53864.1. [Q15063-3 ]
CCDS66530.1. [Q15063-6 ]
CCDS66531.1. [Q15063-5 ]
CCDS9364.1. [Q15063-1 ]
PIRi S36110.
S36111.
RefSeqi NP_001129406.1. NM_001135934.1. [Q15063-2 ]
NP_001129407.1. NM_001135935.1. [Q15063-3 ]
NP_001129408.1. NM_001135936.1. [Q15063-4 ]
NP_001273594.1. NM_001286665.1. [Q15063-5 ]
NP_001273595.1. NM_001286666.1. [Q15063-6 ]
NP_001273596.1. NM_001286667.1. [Q15063-7 ]
NP_006466.2. NM_006475.2. [Q15063-1 ]
UniGenei Hs.136348.
Hs.721018.

3D structure databases

ProteinModelPortali Q15063.
SMRi Q15063. Positions 236-367, 503-630.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q15063. 2 interactions.
MINTi MINT-4533078.
STRINGi 9606.ENSP00000369071.

PTM databases

PhosphoSitei Q15063.

Polymorphism databases

DMDMi 93138709.

Proteomic databases

MaxQBi Q15063.
PaxDbi Q15063.
PRIDEi Q15063.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000379742 ; ENSP00000369066 ; ENSG00000133110 . [Q15063-2 ]
ENST00000379743 ; ENSP00000369067 ; ENSG00000133110 . [Q15063-5 ]
ENST00000379747 ; ENSP00000369071 ; ENSG00000133110 . [Q15063-1 ]
ENST00000541179 ; ENSP00000437959 ; ENSG00000133110 . [Q15063-3 ]
ENST00000541481 ; ENSP00000437953 ; ENSG00000133110 . [Q15063-6 ]
GeneIDi 10631.
KEGGi hsa:10631.
UCSCi uc001uwo.4. human. [Q15063-1 ]
uc001uwp.4. human. [Q15063-2 ]
uc001uwq.3. human. [Q15063-4 ]
uc001uwr.3. human. [Q15063-3 ]

Organism-specific databases

CTDi 10631.
GeneCardsi GC13M038136.
HGNCi HGNC:16953. POSTN.
HPAi HPA012306.
MIMi 608777. gene.
neXtProti NX_Q15063.
PharmGKBi PA134900304.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2335.
GeneTreei ENSGT00530000063860.
HOGENOMi HOG000220865.
HOVERGENi HBG000715.
InParanoidi Q15063.
OMAi HGEPIIK.
PhylomeDBi Q15063.
TreeFami TF316269.

Miscellaneous databases

ChiTaRSi POSTN. human.
GeneWikii Periostin.
POSTN.
GenomeRNAii 10631.
NextBioi 35466661.
PROi Q15063.
SOURCEi Search...

Gene expression databases

Bgeei Q15063.
CleanExi HS_POSTN.
ExpressionAtlasi Q15063. baseline and differential.
Genevestigatori Q15063.

Family and domain databases

Gene3Di 2.30.180.10. 4 hits.
InterProi IPR011489. EMI_domain.
IPR000782. FAS1_domain.
IPR016666. TGFb-ind_bIGH3/osteoblast_fac2.
[Graphical view ]
Pfami PF02469. Fasciclin. 4 hits.
[Graphical view ]
PIRSFi PIRSF016553. BIGH3_OSF2. 1 hit.
SMARTi SM00554. FAS1. 4 hits.
[Graphical view ]
SUPFAMi SSF82153. SSF82153. 4 hits.
PROSITEi PS51041. EMI. 1 hit.
PS50213. FAS1. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Osteoblast-specific factor 2: cloning of a putative bone adhesion protein with homology with the insect protein fasciclin I."
    Takeshita S., Kikuno R., Tezuka K., Amann E.
    Biochem. J. 294:271-278(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Osteosarcoma1 Publication and Placenta1 Publication.
  2. "Periostin secreted by epithelial ovarian carcinoma is a ligand for alpha(V)beta(3) and alpha(V)beta(5) integrins and promotes cell motility."
    Gillan L., Matei D., Fishman D.A., Gerbin C.S., Karlan B.Y., Chang D.D.
    Cancer Res. 62:5358-5364(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  3. "Novel isoforms of periostin expressed in the human thyroid."
    Bai Y., Nakamura M., Zhou G., Li Y., Liu Z., Ozaki T., Mori I., Kakudo K.
    Jpn. Clin. Med. 1:13-20(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5; 6; 7), ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
  4. "Identification and characterization of a novel periodontal ligament-specific periostin isoform."
    Yamada S., Maeda K., Matsubara K., Murakami S.
    Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Periodontal ligament.
  5. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  8. "OSF-2 expression in head and neck squamous cell carcinomas."
    Habtemichael N., Schweitzer A., Knauer S., Stauber R.H.
    Submitted (NOV-2009) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-798 (ISOFORM 5).
  9. "Serum level of the periostin, a homologue of an insect cell adhesion molecule, as a prognostic marker in nonsmall cell lung carcinomas."
    Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y., Fujii Y., Chen L.B.
    Cancer 92:843-848(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  10. "Acquired expression of periostin by human breast cancers promotes tumor angiogenesis through up-regulation of vascular endothelial growth factor receptor 2 expression."
    Shao R., Bao S., Bai X., Blanchette C., Anderson R.M., Dang T., Gishizky M.L., Marks J.R., Wang X.-F.
    Mol. Cell. Biol. 24:3992-4003(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  11. "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry."
    Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.
    J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599.
    Tissue: Plasma.
  12. "Periostin, a member of a novel family of vitamin K-dependent proteins, is expressed by mesenchymal stromal cells."
    Coutu D.L., Wu J.H., Monette A., Rivard G.-E., Blostein M.D., Galipeau J.
    J. Biol. Chem. 283:17991-18001(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, GAMMA-CARBOXYGLUTAMATION.
  13. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599.
    Tissue: Liver.

Entry informationi

Entry nameiPOSTN_HUMAN
AccessioniPrimary (citable) accession number: Q15063
Secondary accession number(s): B1ALD8
, C0IMJ1, C0IMJ2, C0IMJ4, D2KRH7, F5H628, Q15064, Q29XZ0, Q3KPJ5, Q5VSY5, Q8IZF9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: March 7, 2006
Last modified: October 29, 2014
This is version 127 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3