Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Periostin

Gene

POSTN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Induces cell attachment and spreading and plays a role in cell adhesion (PubMed:12235007). Enhances incorporation of BMP1 in the fibronectin matrix of connective tissues, and subsequent proteolytic activation of lysyl oxidase LOX (By similarity).By similarity1 Publication

GO - Molecular functioni

  • cell adhesion molecule binding Source: GO_Central
  • heparin binding Source: UniProtKB
  • metal ion binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Heparin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000133110-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Periostin
Short name:
PN
Alternative name(s):
Osteoblast-specific factor 2
Short name:
OSF-2
Gene namesi
Name:POSTN
Synonyms:OSF2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:16953. POSTN.

Subcellular locationi

GO - Cellular componenti

  • extracellular matrix Source: UniProtKB
  • extracellular space Source: GO_Central
  • neuromuscular junction Source: Ensembl
  • proteinaceous extracellular matrix Source: UniProtKB
  • trans-Golgi network Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Golgi apparatus, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi10631.
OpenTargetsiENSG00000133110.
PharmGKBiPA134900304.

Polymorphism and mutation databases

BioMutaiPOSTN.
DMDMi93138709.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000000878922 – 836PeriostinAdd BLAST815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi44 ↔ 80PROSITE-ProRule annotation
Disulfide bondi60 ↔ 69PROSITE-ProRule annotation
Disulfide bondi79 ↔ 92PROSITE-ProRule annotation
Glycosylationi599N-linked (GlcNAc...)2 Publications1

Post-translational modificationi

Gamma-carboxylation is controversial. Gamma-carboxyglutamated; gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation; this may be required for calcium binding (PubMed:18450759). According to a more recent report, does not contain vitamin K-dependent gamma-carboxyglutamate residues (PubMed:26273833).2 Publications

Keywords - PTMi

Disulfide bond, Gamma-carboxyglutamic acid, Glycoprotein

Proteomic databases

MaxQBiQ15063.
PaxDbiQ15063.
PeptideAtlasiQ15063.
PRIDEiQ15063.

PTM databases

iPTMnetiQ15063.
PhosphoSitePlusiQ15063.

Expressioni

Tissue specificityi

Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus, thyroid tissue and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers.4 Publications

Gene expression databases

BgeeiENSG00000133110.
CleanExiHS_POSTN.
ExpressionAtlasiQ15063. baseline and differential.
GenevisibleiQ15063. HS.

Organism-specific databases

HPAiHPA012306.

Interactioni

Subunit structurei

Interacts with BMP1 and fibronectin.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115875. 1 interactor.
IntActiQ15063. 3 interactors.
MINTiMINT-4533078.
STRINGi9606.ENSP00000369071.

Structurei

3D structure databases

ProteinModelPortaliQ15063.
SMRiQ15063.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini40 – 94EMIPROSITE-ProRule annotationAdd BLAST55
Domaini97 – 230FAS1 1PROSITE-ProRule annotationCuratedAdd BLAST134
Domaini234 – 365FAS1 2PROSITE-ProRule annotationCuratedAdd BLAST132
Domaini368 – 492FAS1 3PROSITE-ProRule annotationCuratedAdd BLAST125
Domaini496 – 628FAS1 4PROSITE-ProRule annotationCuratedAdd BLAST133

Sequence similaritiesi

Contains 1 EMI domain.PROSITE-ProRule annotation
Contains 4 FAS1 domains.PROSITE-ProRule annotationCurated

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiKOG1437. Eukaryota.
COG2335. LUCA.
GeneTreeiENSGT00530000063860.
HOGENOMiHOG000220865.
HOVERGENiHBG000715.
InParanoidiQ15063.
OMAiHGEPIIK.
OrthoDBiEOG091G020T.
PhylomeDBiQ15063.
TreeFamiTF316269.

Family and domain databases

Gene3Di2.30.180.10. 4 hits.
InterProiIPR011489. EMI_domain.
IPR000782. FAS1_domain.
IPR016666. TGFBI/POSTN.
[Graphical view]
PfamiPF02469. Fasciclin. 4 hits.
[Graphical view]
PIRSFiPIRSF016553. BIGH3_OSF2. 1 hit.
SMARTiSM00554. FAS1. 4 hits.
[Graphical view]
SUPFAMiSSF82153. SSF82153. 4 hits.
PROSITEiPS51041. EMI. 1 hit.
PS50213. FAS1. 4 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q15063-1) [UniParc]FASTAAdd to basket
Also known as: OSF-2OS1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIPFLPMFSL LLLLIVNPIN ANNHYDKILA HSRIRGRDQG PNVCALQQIL
60 70 80 90 100
GTKKKYFSTC KNWYKKSICG QKTTVLYECC PGYMRMEGMK GCPAVLPIDH
110 120 130 140 150
VYGTLGIVGA TTTQRYSDAS KLREEIEGKG SFTYFAPSNE AWDNLDSDIR
160 170 180 190 200
RGLESNVNVE LLNALHSHMI NKRMLTKDLK NGMIIPSMYN NLGLFINHYP
210 220 230 240 250
NGVVTVNCAR IIHGNQIATN GVVHVIDRVL TQIGTSIQDF IEAEDDLSSF
260 270 280 290 300
RAAAITSDIL EALGRDGHFT LFAPTNEAFE KLPRGVLERI MGDKVASEAL
310 320 330 340 350
MKYHILNTLQ CSESIMGGAV FETLEGNTIE IGCDGDSITV NGIKMVNKKD
360 370 380 390 400
IVTNNGVIHL IDQVLIPDSA KQVIELAGKQ QTTFTDLVAQ LGLASALRPD
410 420 430 440 450
GEYTLLAPVN NAFSDDTLSM DQRLLKLILQ NHILKVKVGL NELYNGQILE
460 470 480 490 500
TIGGKQLRVF VYRTAVCIEN SCMEKGSKQG RNGAIHIFRE IIKPAEKSLH
510 520 530 540 550
EKLKQDKRFS TFLSLLEAAD LKELLTQPGD WTLFVPTNDA FKGMTSEEKE
560 570 580 590 600
ILIRDKNALQ NIILYHLTPG VFIGKGFEPG VTNILKTTQG SKIFLKEVND
610 620 630 640 650
TLLVNELKSK ESDIMTTNGV IHVVDKLLYP ADTPVGNDQL LEILNKLIKY
660 670 680 690 700
IQIKFVRGST FKEIPVTVYT TKIITKVVEP KIKVIEGSLQ PIIKTEGPTL
710 720 730 740 750
TKVKIEGEPE FRLIKEGETI TEVIHGEPII KKYTKIIDGV PVEITEKETR
760 770 780 790 800
EERIITGPEI KYTRISTGGG ETEETLKKLL QEEVTKVTKF IEGGDGHLFE
810 820 830
DEEIKRLLQG DTPVRKLQAN KKVQGSRRRL REGRSQ
Length:836
Mass (Da):93,314
Last modified:March 7, 2006 - v2
Checksum:i55E7B82D094824FD
GO
Isoform 21 Publication (identifier: Q15063-2) [UniParc]FASTAAdd to basket
Also known as: OSF-2p1

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K

Show »
Length:779
Mass (Da):87,021
Checksum:iC6936F32A42B8366
GO
Isoform 31 Publication (identifier: Q15063-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R
     783-810: Missing.

Show »
Length:781
Mass (Da):87,254
Checksum:iD082BC8F86ABAC37
GO
Isoform 4 (identifier: Q15063-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K
     783-810: Missing.

Show »
Length:751
Mass (Da):83,850
Checksum:i7241170E4CDC18D3
GO
Isoform 5 (identifier: Q15063-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R

Show »
Length:809
Mass (Da):90,424
Checksum:i43DECD94CB76B07A
GO
Isoform 6 (identifier: Q15063-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-757: TTKIITKVVE...ETREERIITG → S

Show »
Length:749
Mass (Da):83,527
Checksum:i13F23F62B1C1AAE9
GO
Isoform 7 (identifier: Q15063-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-757: TTKIITKVVE...ETREERIITG → S
     783-810: Missing.

Show »
Length:721
Mass (Da):80,357
Checksum:iCE5CEFA7E156957B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti290I → F in BAA02836 (PubMed:8363580).Curated1
Sequence conflicti290I → F in BAA02837 (PubMed:8363580).Curated1
Sequence conflicti290I → F in ABY86630 (PubMed:23946676).Curated1
Sequence conflicti290I → F in ABY86631 (PubMed:23946676).Curated1
Sequence conflicti290I → F in ABY86633 (PubMed:23946676).Curated1
Sequence conflicti290I → F in AAY15840 (Ref. 4) Curated1
Sequence conflicti421D → V in BAA02836 (PubMed:8363580).Curated1
Sequence conflicti421D → V in BAA02837 (PubMed:8363580).Curated1
Sequence conflicti421D → V in ABY86630 (PubMed:23946676).Curated1
Sequence conflicti421D → V in ABY86631 (PubMed:23946676).Curated1
Sequence conflicti421D → V in ABY86633 (PubMed:23946676).Curated1
Sequence conflicti421D → V in AAY15840 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049115339T → I.Corresponds to variant rs9594223dbSNPEnsembl.1
Natural variantiVAR_049116814V → M.Corresponds to variant rs9547952dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055183670 – 757TTKII…RIITG → S in isoform 6 and isoform 7. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_050005670 – 727TTKII…VIHGE → K in isoform 2 and isoform 4. 3 PublicationsAdd BLAST58
Alternative sequenceiVSP_050669670 – 697TTKII…IKTEG → R in isoform 3 and isoform 5. 3 PublicationsAdd BLAST28
Alternative sequenceiVSP_050670783 – 810Missing in isoform 3, isoform 4 and isoform 7. 3 PublicationsAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13665 mRNA. Translation: BAA02836.1.
D13666 mRNA. Translation: BAA02837.1.
AY140646 mRNA. Translation: AAN17733.1.
EU262883 mRNA. Translation: ABY86630.1.
EU262884 mRNA. Translation: ABY86631.1.
EU262886 mRNA. Translation: ABY86633.1.
AY918092 mRNA. Translation: AAY15840.1.
AL138679, AL646087 Genomic DNA. Translation: CAH70107.1.
AL646087, AL138679 Genomic DNA. Translation: CAH73568.1.
AL138679, AL646087 Genomic DNA. Translation: CAH70104.1.
AL646087, AL138679 Genomic DNA. Translation: CAH73569.1.
CH471075 Genomic DNA. Translation: EAX08590.1.
BC106709 mRNA. Translation: AAI06710.1.
BC106710 mRNA. Translation: AAI06711.1.
GU354210 mRNA. Translation: ADA79517.1.
CCDSiCCDS45034.1. [Q15063-2]
CCDS53864.1. [Q15063-3]
CCDS66530.1. [Q15063-6]
CCDS66531.1. [Q15063-5]
CCDS9364.1. [Q15063-1]
PIRiS36110.
S36111.
RefSeqiNP_001129406.1. NM_001135934.1. [Q15063-2]
NP_001129407.1. NM_001135935.1. [Q15063-3]
NP_001129408.1. NM_001135936.1. [Q15063-4]
NP_001273594.1. NM_001286665.1. [Q15063-5]
NP_001273595.1. NM_001286666.1. [Q15063-6]
NP_001273596.1. NM_001286667.1. [Q15063-7]
NP_001317446.1. NM_001330517.1.
NP_006466.2. NM_006475.2. [Q15063-1]
UniGeneiHs.136348.
Hs.721018.

Genome annotation databases

EnsembliENST00000379742; ENSP00000369066; ENSG00000133110. [Q15063-2]
ENST00000379743; ENSP00000369067; ENSG00000133110. [Q15063-5]
ENST00000379747; ENSP00000369071; ENSG00000133110. [Q15063-1]
ENST00000541179; ENSP00000437959; ENSG00000133110. [Q15063-3]
ENST00000541481; ENSP00000437953; ENSG00000133110. [Q15063-6]
GeneIDi10631.
KEGGihsa:10631.
UCSCiuc001uwo.5. human. [Q15063-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13665 mRNA. Translation: BAA02836.1.
D13666 mRNA. Translation: BAA02837.1.
AY140646 mRNA. Translation: AAN17733.1.
EU262883 mRNA. Translation: ABY86630.1.
EU262884 mRNA. Translation: ABY86631.1.
EU262886 mRNA. Translation: ABY86633.1.
AY918092 mRNA. Translation: AAY15840.1.
AL138679, AL646087 Genomic DNA. Translation: CAH70107.1.
AL646087, AL138679 Genomic DNA. Translation: CAH73568.1.
AL138679, AL646087 Genomic DNA. Translation: CAH70104.1.
AL646087, AL138679 Genomic DNA. Translation: CAH73569.1.
CH471075 Genomic DNA. Translation: EAX08590.1.
BC106709 mRNA. Translation: AAI06710.1.
BC106710 mRNA. Translation: AAI06711.1.
GU354210 mRNA. Translation: ADA79517.1.
CCDSiCCDS45034.1. [Q15063-2]
CCDS53864.1. [Q15063-3]
CCDS66530.1. [Q15063-6]
CCDS66531.1. [Q15063-5]
CCDS9364.1. [Q15063-1]
PIRiS36110.
S36111.
RefSeqiNP_001129406.1. NM_001135934.1. [Q15063-2]
NP_001129407.1. NM_001135935.1. [Q15063-3]
NP_001129408.1. NM_001135936.1. [Q15063-4]
NP_001273594.1. NM_001286665.1. [Q15063-5]
NP_001273595.1. NM_001286666.1. [Q15063-6]
NP_001273596.1. NM_001286667.1. [Q15063-7]
NP_001317446.1. NM_001330517.1.
NP_006466.2. NM_006475.2. [Q15063-1]
UniGeneiHs.136348.
Hs.721018.

3D structure databases

ProteinModelPortaliQ15063.
SMRiQ15063.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115875. 1 interactor.
IntActiQ15063. 3 interactors.
MINTiMINT-4533078.
STRINGi9606.ENSP00000369071.

PTM databases

iPTMnetiQ15063.
PhosphoSitePlusiQ15063.

Polymorphism and mutation databases

BioMutaiPOSTN.
DMDMi93138709.

Proteomic databases

MaxQBiQ15063.
PaxDbiQ15063.
PeptideAtlasiQ15063.
PRIDEiQ15063.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379742; ENSP00000369066; ENSG00000133110. [Q15063-2]
ENST00000379743; ENSP00000369067; ENSG00000133110. [Q15063-5]
ENST00000379747; ENSP00000369071; ENSG00000133110. [Q15063-1]
ENST00000541179; ENSP00000437959; ENSG00000133110. [Q15063-3]
ENST00000541481; ENSP00000437953; ENSG00000133110. [Q15063-6]
GeneIDi10631.
KEGGihsa:10631.
UCSCiuc001uwo.5. human. [Q15063-1]

Organism-specific databases

CTDi10631.
DisGeNETi10631.
GeneCardsiPOSTN.
HGNCiHGNC:16953. POSTN.
HPAiHPA012306.
MIMi608777. gene.
neXtProtiNX_Q15063.
OpenTargetsiENSG00000133110.
PharmGKBiPA134900304.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1437. Eukaryota.
COG2335. LUCA.
GeneTreeiENSGT00530000063860.
HOGENOMiHOG000220865.
HOVERGENiHBG000715.
InParanoidiQ15063.
OMAiHGEPIIK.
OrthoDBiEOG091G020T.
PhylomeDBiQ15063.
TreeFamiTF316269.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000133110-MONOMER.

Miscellaneous databases

ChiTaRSiPOSTN. human.
GeneWikiiPeriostin.
POSTN.
GenomeRNAii10631.
PROiQ15063.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000133110.
CleanExiHS_POSTN.
ExpressionAtlasiQ15063. baseline and differential.
GenevisibleiQ15063. HS.

Family and domain databases

Gene3Di2.30.180.10. 4 hits.
InterProiIPR011489. EMI_domain.
IPR000782. FAS1_domain.
IPR016666. TGFBI/POSTN.
[Graphical view]
PfamiPF02469. Fasciclin. 4 hits.
[Graphical view]
PIRSFiPIRSF016553. BIGH3_OSF2. 1 hit.
SMARTiSM00554. FAS1. 4 hits.
[Graphical view]
SUPFAMiSSF82153. SSF82153. 4 hits.
PROSITEiPS51041. EMI. 1 hit.
PS50213. FAS1. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPOSTN_HUMAN
AccessioniPrimary (citable) accession number: Q15063
Secondary accession number(s): B1ALD8
, C0IMJ1, C0IMJ2, C0IMJ4, D2KRH7, F5H628, Q15064, Q29XZ0, Q3KPJ5, Q5VSY5, Q8IZF9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: March 7, 2006
Last modified: November 30, 2016
This is version 148 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.