Reviewed,
UniProtKB/Swiss-Prot Q15063 (POSTN_HUMAN)
Last modified
June 16, 2009.
Version 78.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Periostin Short name=PN Alternative name(s): Osteoblast-specific factor 2 Short name=OSF-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 836 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. May play a role in extracellular matrix mineralization. Ref.2 Ref.11 UniProtKB Q62009 |
| Subcellular location | Secreted › extracellular space › extracellular matrix. Ref.2 |
| Tissue specificity | Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the tumor periphery of lung carcinoma tissue but not within the tumor. Overexpressed in breast cancers. Ref.2 Ref.7 Ref.9 |
| Post-translational modification | Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium. |
| Sequence similarities | Contains 1 EMI domain. Contains 4 FAS1 domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Extracellular matrix Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal |
| Ligand | Heparin-binding |
| PTM | Disulfide bond Gamma-carboxyglutamic acid Glycoprotein |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Ref.2 Inferred from direct assay. Source: UniProtKB skeletal system development Ref.1Traceable author statement. Source: ProtInc |
| Cellular component | extracellular space Inferred from electronic annotation. Source: UniProtKB-SubCell proteinaceous extracellular matrixInferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | heparin binding Inferred from sequence or structural similarity. Source: UniProtKB protein bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q15063-1) Also known as: OSF-2OS; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.1 (identifier: Q15063-2) Also known as: OSF-2p1; The sequence of this isoform differs from the canonical sequence as follows: 670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K | ||||||
| Isoform 3 Ref.2 (identifier: Q15063-3) The sequence of this isoform differs from the canonical sequence as follows: 670-697: TTKIITKVVEPKIKVIEGSLQPIIKTEG → R 783-810: Missing. | ||||||
| Isoform 4 (identifier: Q15063-4) The sequence of this isoform differs from the canonical sequence as follows: 670-727: TTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGE → K 783-810: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | ||||||||
| Chain | 22 – 836 | 815 | Periostin | PRO_0000008789 | |||||||
Regions | |||||||||||
| Domain | 40 – 94 | 55 | EMI | ||||||||
| Domain | 97 – 230 | 134 | FAS1 1 | ||||||||
| Domain | 234 – 365 | 132 | FAS1 2 | ||||||||
| Domain | 368 – 492 | 125 | FAS1 3 | ||||||||
| Domain | 496 – 628 | 133 | FAS1 4 | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 124 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 125 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 127 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 140 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 154 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 160 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 242 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 244 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 261 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 277 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 280 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 288 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 298 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 313 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 322 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 325 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 496 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 501 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 517 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 523 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 547 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 548 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 550 | 1 | 4-carboxyglutamate Potential | ||||||||
| Modified residue | 578 | 1 | 4-carboxyglutamate Potential | ||||||||
| Glycosylation | 599 | 1 | N-linked (GlcNAc...) Ref.10 UniProtKB Q62009 | ||||||||
| Disulfide bond | 44 ↔ 80 | By similarity | |||||||||
| Disulfide bond | 60 ↔ 69 | By similarity | |||||||||
| Disulfide bond | 79 ↔ 92 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 670 – 727 | 58 | TTKII…VIHGE → K in isoform 2 and isoform 4. Ref.1 | VSP_050005 | |||||||
| Alternative sequence | 670 – 697 | 28 | TTKII…IKTEG → R in isoform 3. Ref.2 | VSP_050669 | |||||||
| Alternative sequence | 783 – 810 | 28 | Missing in isoform 3 and isoform 4. | VSP_050670 | |||||||
| Natural variant | 339 | 1 | T → I: dbSNP rs9594223. | VAR_049115 | |||||||
| Natural variant | 814 | 1 | V → M: dbSNP rs9547952. | VAR_049116 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 290 | 1 | I → F in BAA02836. Ref.1 | ||||||||
| Sequence conflict | 290 | 1 | I → F in BAA02837. Ref.1 | ||||||||
| Sequence conflict | 290 | 1 | I → F in AAY15840. Ref.3 | ||||||||
| Sequence conflict | 421 | 1 | D → V in BAA02836. Ref.1 | ||||||||
| Sequence conflict | 421 | 1 | D → V in BAA02837. Ref.1 | ||||||||
| Sequence conflict | 421 | 1 | D → V in AAY15840. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Osteoblast-specific factor 2: cloning of a putative bone adhesion protein with homology with the insect protein fasciclin I." Takeshita S., Kikuno R., Tezuka K., Amann E. Biochem. J. 294:271-278(1993) [PubMed: 8363580] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Osteosarcoma and Placenta. |
| [2] | "Periostin secreted by epithelial ovarian carcinoma is a ligand for alpha(V)beta(3) and alpha(V)beta(5) integrins and promotes cell motility." Gillan L., Matei D., Fishman D.A., Gerbin C.S., Karlan B.Y., Chang D.D. Cancer Res. 62:5358-5364(2002) [PubMed: 12235007] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "Identification and characterization of a novel periodontal ligament-specific periostin isoform." Yamada S., Maeda K., Matsubara K., Murakami S. Submitted (FEB-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Periodontal ligament. |
| [4] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed: 15057823] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [7] | "Serum level of the periostin, a homologue of an insect cell adhesion molecule, as a prognostic marker in nonsmall cell lung carcinomas." Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y., Fujii Y., Chen L.B. Cancer 92:843-848(2001) [PubMed: 11550156] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | Erratum Sasaki H., Dai M., Auclair D., Fukai I., Kiriyama M., Yamakawa Y., Fujii Y., Chen L.B. Cancer 95:2580-2580(2002) |
| [9] | "Acquired expression of periostin by human breast cancers promotes tumor angiogenesis through up-regulation of vascular endothelial growth factor receptor 2 expression." Shao R., Bao S., Bai X., Blanchette C., Anderson R.M., Dang T., Gishizky M.L., Marks J.R., Wang X.-F. Mol. Cell. Biol. 24:3992-4003(2004) [PubMed: 15082792] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599, MASS SPECTROMETRY. Tissue: Plasma. |
| [11] | "Periostin, a member of a novel family of vitamin K-dependent proteins, is expressed by mesenchymal stromal cells." Coutu D.L., Wu J.H., Monette A., Rivard G.-E., Blostein M.D., Galipeau J. J. Biol. Chem. 283:17991-18001(2008) [PubMed: 18450759] [Abstract] Cited for: FUNCTION, GAMMA-CARBOXYGLUTAMATION. |
| [12] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-599, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| D13665 mRNA. Translation: BAA02836.1. D13666 mRNA. Translation: BAA02837.1. AY140646 mRNA. Translation: AAN17733.1. AY918092 mRNA. Translation: AAY15840.1. AL138679, AL646087 Genomic DNA. Translation: CAH70107.1. AL646087, AL138679 Genomic DNA. Translation: CAH73568.1. AL138679, AL646087 Genomic DNA. Translation: CAH70104.1. AL646087, AL138679 Genomic DNA. Translation: CAH73569.1. CH471075 Genomic DNA. Translation: EAX08590.1. BC106709 mRNA. Translation: AAI06710.1. BC106710 mRNA. Translation: AAI06711.1. | |
| IPI | IPI00007960. IPI00218585. IPI00873848. IPI00910262. |
| PIR | S36110. S36111. |
| RefSeq | NP_001129406.1. NP_001129407.1. NP_001129408.1. NP_006466.2. |
| UniGene | Hs.136348 Hs.664318 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q15063. |
Proteomic databases | |
| PRIDE | Q15063. |
Genome annotation databases | |
| Ensembl | ENSG00000133110. Homo sapiens. [Contig view] |
| GeneID | 10631. |
| NMPDR | fig|9606.3.peg.8746. |
Organism-specific databases | |
| GeneCards | GC13M037034. |
| H-InvDB | HIX0011247. |
| HGNC | HGNC:16953. POSTN. |
| HPA | HPA012306. |
| MIM | 608777. gene. |
| PharmGKB | PA134900304. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q15063. |
| HOVERGEN | Q15063. |
| OMA | Q15063. NLDSDIR. |
Gene expression databases | |
| ArrayExpress | Q15063. |
| Bgee | Q15063. |
| CleanEx | HS_POSTN. |
| GermOnline | ENSG00000133110. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011489. EMI_domain. IPR000782. FAS1_domain. IPR016666. TGFb-ind_bIGH3/osteoblast_fac2. [Graphical view] |
| Gene3D | G3DSA:2.30.180.10. BIgH3_FAS1. 4 hits. |
| Pfam | PF07546. EMI. 1 hit. PF02469. Fasciclin. 4 hits. [Graphical view] |
| PIRSF | PIRSF016553. BIGH3_OSF2. 1 hit. |
| SMART | SM00554. FAS1. 4 hits. [Graphical view] |
| PROSITE | PS51041. EMI. 1 hit. PS50213. FAS1. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 40399. |
| SOURCE | Search... |
Entry information
| Entry name | POSTN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15063 Secondary accession number(s): Q15064 Q8IZF9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


