Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q15038 (DAZP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 112. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
DAZ-associated protein 2
Alternative name(s):
Deleted in azoospermia-associated protein 2
Gene names
Name:DAZAP2
Synonyms:KIAA0058
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length168 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Interacts with SOX6 By similarity. Interacts with DAZ and DAZL. Interacts with IL17RB. May interact with FAM168B. Ref.9 Ref.10 Ref.11

Subcellular location

Cytoplasm. Nucleus. Note: Predominantly nuclear in macrophages, stimulation of IL17RB with its ligand IL17E induces accumulation in the cytoplasm. Ref.1 Ref.11

Tissue specificity

Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Down-regulated in multiple myeloma. Ref.9

Post-translational modification

Ubiquitinated by SMURF2, leading to proteasomal degradation. Ref.11

Sequence caution

The sequence BAA06545.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   PTMUbl conjugation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionWW domain binding

Inferred from physical interaction PubMed 11342538. Source: UniProtKB

protein binding

Inferred from physical interaction PubMed 16189514PubMed 16713569PubMed 19060904. Source: IntAct

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q15038-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q15038-2)

The sequence of this isoform differs from the canonical sequence as follows:
     127-168: PPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW → VKEDQDHDREQGEEDNGDNNLERRGKM
Note: No experimental confirmation available.
Isoform 6 (identifier: Q15038-6)

The sequence of this isoform differs from the canonical sequence as follows:
     65-86: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q15038-3)

The sequence of this isoform differs from the canonical sequence as follows:
     45-76: Missing.
Isoform 4 (identifier: Q15038-4)

The sequence of this isoform differs from the canonical sequence as follows:
     45-126: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q15038-5)

The sequence of this isoform differs from the canonical sequence as follows:
     101-168: GSTVLVEGGY...GGSDGGYTIW → ASTSWMPSQC...RNHVMVAVPP
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 168168DAZ-associated protein 2
PRO_0000079788

Regions

Compositional bias8 – 134127Pro-rich

Natural variations

Alternative sequence45 – 12682Missing in isoform 4.
VSP_045678
Alternative sequence45 – 7632Missing in isoform 3.
VSP_045679
Alternative sequence65 – 8622Missing in isoform 6.
VSP_055181
Alternative sequence101 – 16868GSTVL…GYTIW → ASTSWMPSQCCSACSHAGSQ RPRNSAEGELLHGWFRWWLH HLVRNQGHLCAGKDITYLQH FSQCNCFSHINLKLQFRHML LGCLSGAQTFRHFSNLIRNH VMVAVPP in isoform 5.
VSP_046764
Alternative sequence127 – 16842PPPPG…GYTIW → VKEDQDHDREQGEEDNGDNN LERRGKM in isoform 2.
VSP_042773
Natural variant1021S → A.
Corresponds to variant rs57917280 [ dbSNP | Ensembl ].
VAR_061639

Experimental info

Sequence conflict291L → P in BAG64775. Ref.5
Sequence conflict471R → S in AAR11454. Ref.1
Sequence conflict901A → V in BU662353. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 49F1B6D281E24AAC

FASTA16817,319
        10         20         30         40         50         60 
MNSKGQYPTQ PTYPVQPPGN PVYPQTLHLP QAPPYTDAPP AYSELYRPSF VHPGAATVPT 

        70         80         90        100        110        120 
MSAAFPGASL YLPMAQSVAV GPLGSTIPMA YYPVGPIYPP GSTVLVEGGY DAGARFGAGA 

       130        140        150        160 
TAGNIPPPPP GCPPNAAQLA VMQGANVLVT QRKGNFFMGG SDGGYTIW 

« Hide

Isoform 2 [UniParc].

Checksum: FAF1904AF43CA4E4
Show »

FASTA15316,187
Isoform 6 [UniParc].

Checksum: 3EA0DB83FB16A1A8
Show »

FASTA14615,173
Isoform 3 [UniParc].

Checksum: 46E379CE7F8A3A04
Show »

FASTA13613,987
Isoform 4 [UniParc].

Checksum: 5A99269B0CBA9174
Show »

FASTA869,167
Isoform 5 [UniParc].

Checksum: 24B6E3CC46C33150
Show »

FASTA20722,823

References

« Hide 'large scale' references
[1]"Molecular features and expression of DAZAP2 in human multiple myeloma."
Shi Y.-W., Shen R., Ren W., Tang L.J., Tan D.-R., Hu W.-X.
Chin. Med. J. 120:1659-1665(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION.
Tissue: Bone marrow.
[2]"Gene expression in human erythroid precursor cells."
Gubin A.N., Lee Y.T., Bouffard G.G., Miller J.L.
Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Erythroblast.
[3]"Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1."
Nomura N., Nagase T., Miyajima N., Sazuka T., Tanaka A., Sato S., Seki N., Kawarabayasi Y., Ishikawa K., Tabata S.
DNA Res. 1:223-229(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Bone marrow.
[4]"Full-length cDNA libraries and normalization."
Li W.B., Gruber C., Jessee J., Polayes D.
Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Fetal brain.
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 5).
Tissue: Lung, Mammary gland and Thalamus.
[6]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: B-cell and Brain.
[9]"Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1."
Tsui S., Dai T., Roettger S., Schempp W., Salido E.C., Yen P.H.
Genomics 65:266-273(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, INTERACTION WITH DAZ AND DAZL.
Tissue: Testis.
[10]"Characterizing the neurite outgrowth inhibitory effect of Mani."
Mishra M., Lee S., Lin M.K., Yamashita T., Heese K.
FEBS Lett. 586:3018-3023(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH FAM168B.
[11]"Smurf2 regulates IL17RB by proteasomal degradation of its novel binding partner DAZAP2."
Popova A., Kzhyshkowska J., Nurgazieva D., Goerdt S., Gratchev A.
Immunobiology 217:321-328(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: UBIQUITINATION BY SMURF2, SUBCELLULAR LOCATION, INTERACTION WITH IL17RB.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY430097 mRNA. Translation: AAR11454.1.
BU662353 mRNA. No translation available.
D31767 mRNA. Translation: BAA06545.2. Different initiation.
BX441137 mRNA. No translation available.
AK095963 mRNA. No translation available.
AK290119 mRNA. Translation: BAF82808.1.
AK293330 mRNA. Translation: BAG56846.1.
AK303828 mRNA. Translation: BAG64775.1.
AC046135 Genomic DNA. No translation available.
AC139768 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58181.1.
BC002334 mRNA. Translation: AAH02334.1.
BC007900 mRNA. Translation: AAH07900.1.
CCDSCCDS44884.1. [Q15038-2]
CCDS44885.1. [Q15038-5]
CCDS44887.1. [Q15038-3]
CCDS44888.1. [Q15038-4]
CCDS8809.1. [Q15038-1]
RefSeqNP_001129736.1. NM_001136264.1.
NP_001129738.1. NM_001136266.1. [Q15038-5]
NP_001129739.1. NM_001136267.1. [Q15038-3]
NP_001129740.1. NM_001136268.1. [Q15038-4]
NP_001129741.1. NM_001136269.1. [Q15038-2]
NP_055579.1. NM_014764.3. [Q15038-1]
UniGeneHs.369761.

3D structure databases

ProteinModelPortalQ15038.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115143. 63 interactions.
IntActQ15038. 62 interactions.
MINTMINT-1179995.
STRING9606.ENSP00000404968.

PTM databases

PhosphoSiteQ15038.

Polymorphism databases

DMDM44887865.

Proteomic databases

MaxQBQ15038.
PRIDEQ15038.

Protocols and materials databases

DNASU9802.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000412716; ENSP00000394699; ENSG00000183283. [Q15038-1]
ENST00000425012; ENSP00000408251; ENSG00000183283. [Q15038-2]
ENST00000439799; ENSP00000398804; ENSG00000183283. [Q15038-4]
ENST00000449723; ENSP00000412812; ENSG00000183283.
ENST00000549555; ENSP00000448051; ENSG00000183283. [Q15038-5]
ENST00000549732; ENSP00000446554; ENSG00000183283. [Q15038-3]
GeneID9802.
KEGGhsa:9802.
UCSCuc001ryb.3. human. [Q15038-1]
uc010snf.1. human. [Q15038-2]

Organism-specific databases

CTD9802.
GeneCardsGC12P051634.
HGNCHGNC:2684. DAZAP2.
MIM607431. gene.
neXtProtNX_Q15038.
PharmGKBPA27154.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG286791.
HOGENOMHOG000007683.
HOVERGENHBG051300.
InParanoidQ15038.
OMAMNNKGSY.
OrthoDBEOG77HDG0.
PhylomeDBQ15038.
TreeFamTF329672.

Gene expression databases

ArrayExpressQ15038.
BgeeQ15038.
CleanExHS_DAZAP2.
GenevestigatorQ15038.

Family and domain databases

InterProIPR022730. DAZ_assoc-2.
[Graphical view]
PfamPF11029. DAZAP2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSDAZAP2. human.
GeneWikiDAZAP2.
GenomeRNAi9802.
NextBio36908.
PROQ15038.
SOURCESearch...

Entry information

Entry nameDAZP2_HUMAN
AccessionPrimary (citable) accession number: Q15038
Secondary accession number(s): A8K254 expand/collapse secondary AC list , B4DDT5, B4E1G3, C9JA96, C9JP84, E9PB45, F8VU62
Entry history
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: November 1, 1996
Last modified: July 9, 2014
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM