Q15038 (DAZP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DAZ-associated protein 2 Alternative name(s): Deleted in azoospermia-associated protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 168 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Interacts with SOX6 By similarity. Interacts with DAZ and DAZL. Interacts with IL17RB. May interact with FAM168B. Ref.9 Ref.10 Ref.11 |
| Subcellular location | Cytoplasm. Nucleus. Note: Predominantly nuclear in macrophages, stimulation of IL17RB with its ligand IL17E induces accumulation in the cytoplasm. Ref.1 Ref.11 |
| Tissue specificity | Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Down-regulated in multiple myeloma. Ref.9 |
| Post-translational modification | Ubiquitinated by SMURF2, leading to proteasomal degradation. Ref.11 |
| Sequence caution | The sequence BAA06545.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN1 | P54253 | 2 | EBI-724310,EBI-930964 | |
| BATF2 | Q8N1L9 | 3 | EBI-724310,EBI-742695 | |
| EXD3 | Q9NX53 | 3 | EBI-724310,EBI-750745 | |
| PEF1 | Q9UBV8 | 3 | EBI-724310,EBI-724639 | |
| POLI | Q9UNA4 | 3 | EBI-724310,EBI-741774 | |
| RHOXF2 | Q9BQY4 | 3 | EBI-724310,EBI-372094 | |
| TOLLIP | Q9H0E2 | 3 | EBI-724310,EBI-74615 | |
| ZFAND2B | Q8WV99 | 3 | EBI-724310,EBI-747823 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15038-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15038-2) The sequence of this isoform differs from the canonical sequence as follows: 127-168: PPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW → VKEDQDHDREQGEEDNGDNNLERRGKM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q15038-3) The sequence of this isoform differs from the canonical sequence as follows: 45-76: Missing. | ||||||
| Isoform 4 (identifier: Q15038-4) The sequence of this isoform differs from the canonical sequence as follows: 45-126: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 168 | 168 | DAZ-associated protein 2 | PRO_0000079788 | |||||
Regions | |||||||||
| Compositional bias | 8 – 134 | 127 | Pro-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 45 – 126 | 82 | Missing in isoform 4. | VSP_045678 | |||||
| Alternative sequence | 45 – 76 | 32 | Missing in isoform 3. | VSP_045679 | |||||
| Alternative sequence | 127 – 168 | 42 | PPPPG…GYTIW → VKEDQDHDREQGEEDNGDNN LERRGKM in isoform 2. | VSP_042773 | |||||
| Natural variant | 102 | 1 | S → A. Corresponds to variant rs57917280 [ dbSNP | Ensembl ]. | VAR_061639 | |||||
Experimental info | |||||||||
| Sequence conflict | 47 | 1 | R → S in AAR11454. Ref.1 | ||||||
| Sequence conflict | 90 | 1 | A → V in BU662353. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular features and expression of DAZAP2 in human multiple myeloma." Shi Y.-W., Shen R., Ren W., Tang L.J., Tan D.-R., Hu W.-X. Chin. Med. J. 120:1659-1665(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION. Tissue: Bone marrow. |
| [2] | "Gene expression in human erythroid precursor cells." Gubin A.N., Lee Y.T., Bouffard G.G., Miller J.L. Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Erythroblast. |
| [3] | "Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1." Nomura N., Nagase T., Miyajima N., Sazuka T., Tanaka A., Sato S., Seki N., Kawarabayasi Y., Ishikawa K., Tabata S. DNA Res. 1:223-229(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [4] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Fetal brain. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Mammary gland and Thalamus. |
| [6] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: B-cell and Brain. |
| [9] | "Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1." Tsui S., Dai T., Roettger S., Schempp W., Salido E.C., Yen P.H. Genomics 65:266-273(2000) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, INTERACTION WITH DAZ AND DAZL. Tissue: Testis. |
| [10] | "Characterizing the neurite outgrowth inhibitory effect of Mani." Mishra M., Lee S., Lin M.K., Yamashita T., Heese K. FEBS Lett. 586:3018-3023(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FAM168B. |
| [11] | "Smurf2 regulates IL17RB by proteasomal degradation of its novel binding partner DAZAP2." Popova A., Kzhyshkowska J., Nurgazieva D., Goerdt S., Gratchev A. Immunobiology 217:321-328(2012) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION BY SMURF2, SUBCELLULAR LOCATION, INTERACTION WITH IL17RB. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY430097 mRNA. Translation: AAR11454.1. BU662353 mRNA. No translation available. D31767 mRNA. Translation: BAA06545.2. Different initiation. BX441137 mRNA. No translation available. AK290119 mRNA. Translation: BAF82808.1. AK293330 mRNA. Translation: BAG56846.1. AC046135 Genomic DNA. No translation available. AC139768 Genomic DNA. No translation available. CH471111 Genomic DNA. Translation: EAW58181.1. BC002334 mRNA. Translation: AAH02334.1. BC007900 mRNA. Translation: AAH07900.1. |
| IPI | IPI00006115. IPI00790018. IPI00914856. IPI00914867. |
| RefSeq | NP_001129736.1. NM_001136264.1. NP_001129739.1. NM_001136267.1. NP_001129740.1. NM_001136268.1. NP_001129741.1. NM_001136269.1. NP_055579.1. NM_014764.3. |
| UniGene | Hs.369761. |
3D structure databases | |
| ProteinModelPortal | Q15038. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q15038. 46 interactions. |
| MINT | MINT-1179995. |
| STRING | 9606.ENSP00000404968. |
PTM databases | |
| PhosphoSite | Q15038. |
Polymorphism databases | |
| DMDM | 44887865. |
Proteomic databases | |
| PRIDE | Q15038. |
Protocols and materials databases | |
| DNASU | 9802. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000412716; ENSP00000394699; ENSG00000183283. ENST00000425012; ENSP00000408251; ENSG00000183283. ENST00000439799; ENSP00000398804; ENSG00000183283. ENST00000549732; ENSP00000446554; ENSG00000183283. |
| GeneID | 9802. |
| KEGG | hsa:9802. |
| UCSC | uc001ryb.3. human. |
Organism-specific databases | |
| CTD | 9802. |
| GeneCards | GC12P051634. |
| HGNC | HGNC:2684. DAZAP2. |
| MIM | 607431. gene. |
| neXtProt | NX_Q15038. |
| PharmGKB | PA27154. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG286791. |
| HOGENOM | HOG000007683. |
| HOVERGEN | HBG051300. |
| InParanoid | Q15038. |
| OMA | AMQGANV. |
Gene expression databases | |
| ArrayExpress | Q15038. |
| Bgee | Q15038. |
| CleanEx | HS_DAZAP2. |
| Genevestigator | Q15038. |
| GermOnline | ENSG00000183283. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR022730. DAZ_assoc-2. [Graphical view] |
| Pfam | PF11029. DAZAP2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | DAZAP2. human. |
| GenomeRNAi | 9802. |
| NextBio | 36908. |
| SOURCE | Search... |
Entry information
| Entry name | DAZP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15038 Secondary accession number(s): A8K254 C9JP84 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
