Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q15038

- DAZP2_HUMAN

UniProt

Q15038 - DAZP2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

DAZ-associated protein 2

Gene

DAZAP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. WW domain binding Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
DAZ-associated protein 2
Alternative name(s):
Deleted in azoospermia-associated protein 2
Gene namesi
Name:DAZAP2
Synonyms:KIAA0058
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:2684. DAZAP2.

Subcellular locationi

Cytoplasm. Nucleus
Note: Predominantly nuclear in macrophages, stimulation of IL17RB with its ligand IL17E induces accumulation in the cytoplasm.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27154.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 168168DAZ-associated protein 2PRO_0000079788Add
BLAST

Post-translational modificationi

Ubiquitinated by SMURF2, leading to proteasomal degradation.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQBiQ15038.
PRIDEiQ15038.

PTM databases

PhosphoSiteiQ15038.

Expressioni

Tissue specificityi

Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Down-regulated in multiple myeloma.1 Publication

Gene expression databases

BgeeiQ15038.
CleanExiHS_DAZAP2.
ExpressionAtlasiQ15038. baseline and differential.
GenevestigatoriQ15038.

Interactioni

Subunit structurei

Interacts with SOX6 By similarity. Interacts with DAZ and DAZL. Interacts with IL17RB. May interact with FAM168B.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ATXN1P542532EBI-724310,EBI-930964
BATF2Q8N1L93EBI-724310,EBI-742695
EXD3Q9NX533EBI-724310,EBI-750745
PEF1Q9UBV83EBI-724310,EBI-724639
POLIQ9UNA43EBI-724310,EBI-741774
RHOXF2Q9BQY43EBI-724310,EBI-372094
TOLLIPQ9H0E23EBI-724310,EBI-74615
ZFAND2BQ8WV993EBI-724310,EBI-747823

Protein-protein interaction databases

BioGridi115143. 64 interactions.
IntActiQ15038. 63 interactions.
MINTiMINT-1179995.
STRINGi9606.ENSP00000404968.

Structurei

3D structure databases

ProteinModelPortaliQ15038.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi8 – 134127Pro-richAdd
BLAST

Phylogenomic databases

eggNOGiNOG286791.
GeneTreeiENSGT00390000000685.
HOGENOMiHOG000007683.
HOVERGENiHBG051300.
InParanoidiQ15038.
OMAiMNNKGSY.
OrthoDBiEOG77HDG0.
PhylomeDBiQ15038.
TreeFamiTF329672.

Family and domain databases

InterProiIPR022730. DAZ_assoc-2.
[Graphical view]
PfamiPF11029. DAZAP2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q15038-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNSKGQYPTQ PTYPVQPPGN PVYPQTLHLP QAPPYTDAPP AYSELYRPSF
60 70 80 90 100
VHPGAATVPT MSAAFPGASL YLPMAQSVAV GPLGSTIPMA YYPVGPIYPP
110 120 130 140 150
GSTVLVEGGY DAGARFGAGA TAGNIPPPPP GCPPNAAQLA VMQGANVLVT
160
QRKGNFFMGG SDGGYTIW
Length:168
Mass (Da):17,319
Last modified:November 1, 1996 - v1
Checksum:i49F1B6D281E24AAC
GO
Isoform 2 (identifier: Q15038-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-168: PPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW → VKEDQDHDREQGEEDNGDNNLERRGKM

Note: No experimental confirmation available.

Show »
Length:153
Mass (Da):16,187
Checksum:iFAF1904AF43CA4E4
GO
Isoform 6 (identifier: Q15038-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     65-86: Missing.

Note: No experimental confirmation available.

Show »
Length:146
Mass (Da):15,173
Checksum:i3EA0DB83FB16A1A8
GO
Isoform 3 (identifier: Q15038-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-76: Missing.

Show »
Length:136
Mass (Da):13,987
Checksum:i46E379CE7F8A3A04
GO
Isoform 4 (identifier: Q15038-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-126: Missing.

Note: No experimental confirmation available.

Show »
Length:86
Mass (Da):9,167
Checksum:i5A99269B0CBA9174
GO
Isoform 5 (identifier: Q15038-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-168: GSTVLVEGGY...GGSDGGYTIW → ASTSWMPSQC...RNHVMVAVPP

Note: No experimental confirmation available.

Show »
Length:207
Mass (Da):22,823
Checksum:i24B6E3CC46C33150
GO

Sequence cautioni

The sequence BAA06545.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti29 – 291L → P in BAG64775. (PubMed:14702039)Curated
Sequence conflicti47 – 471R → S in AAR11454. (PubMed:17935665)Curated
Sequence conflicti90 – 901A → V in BU662353. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti102 – 1021S → A.
Corresponds to variant rs57917280 [ dbSNP | Ensembl ].
VAR_061639

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei45 – 12682Missing in isoform 4. 1 PublicationVSP_045678Add
BLAST
Alternative sequencei45 – 7632Missing in isoform 3. 1 PublicationVSP_045679Add
BLAST
Alternative sequencei65 – 8622Missing in isoform 6. CuratedVSP_055181Add
BLAST
Alternative sequencei101 – 16868GSTVL…GYTIW → ASTSWMPSQCCSACSHAGSQ RPRNSAEGELLHGWFRWWLH HLVRNQGHLCAGKDITYLQH FSQCNCFSHINLKLQFRHML LGCLSGAQTFRHFSNLIRNH VMVAVPP in isoform 5. 1 PublicationVSP_046764Add
BLAST
Alternative sequencei127 – 16842PPPPG…GYTIW → VKEDQDHDREQGEEDNGDNN LERRGKM in isoform 2. 1 PublicationVSP_042773Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY430097 mRNA. Translation: AAR11454.1.
BU662353 mRNA. No translation available.
D31767 mRNA. Translation: BAA06545.2. Different initiation.
BX441137 mRNA. No translation available.
AK095963 mRNA. No translation available.
AK290119 mRNA. Translation: BAF82808.1.
AK293330 mRNA. Translation: BAG56846.1.
AK303828 mRNA. Translation: BAG64775.1.
AC046135 Genomic DNA. No translation available.
AC139768 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58181.1.
BC002334 mRNA. Translation: AAH02334.1.
BC007900 mRNA. Translation: AAH07900.1.
CCDSiCCDS44884.1. [Q15038-2]
CCDS44885.1. [Q15038-5]
CCDS44886.1. [Q15038-6]
CCDS44887.1. [Q15038-3]
CCDS44888.1. [Q15038-4]
CCDS8809.1. [Q15038-1]
RefSeqiNP_001129736.1. NM_001136264.1. [Q15038-6]
NP_001129738.1. NM_001136266.1. [Q15038-5]
NP_001129739.1. NM_001136267.1. [Q15038-3]
NP_001129740.1. NM_001136268.1. [Q15038-4]
NP_001129741.1. NM_001136269.1. [Q15038-2]
NP_055579.1. NM_014764.3. [Q15038-1]
UniGeneiHs.369761.

Genome annotation databases

EnsembliENST00000412716; ENSP00000394699; ENSG00000183283. [Q15038-1]
ENST00000425012; ENSP00000408251; ENSG00000183283. [Q15038-2]
ENST00000439799; ENSP00000398804; ENSG00000183283. [Q15038-4]
ENST00000449723; ENSP00000412812; ENSG00000183283. [Q15038-6]
ENST00000549555; ENSP00000448051; ENSG00000183283. [Q15038-5]
ENST00000549732; ENSP00000446554; ENSG00000183283. [Q15038-3]
GeneIDi9802.
KEGGihsa:9802.
UCSCiuc001ryb.3. human. [Q15038-1]
uc010snf.1. human. [Q15038-2]

Polymorphism databases

DMDMi44887865.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY430097 mRNA. Translation: AAR11454.1 .
BU662353 mRNA. No translation available.
D31767 mRNA. Translation: BAA06545.2 . Different initiation.
BX441137 mRNA. No translation available.
AK095963 mRNA. No translation available.
AK290119 mRNA. Translation: BAF82808.1 .
AK293330 mRNA. Translation: BAG56846.1 .
AK303828 mRNA. Translation: BAG64775.1 .
AC046135 Genomic DNA. No translation available.
AC139768 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58181.1 .
BC002334 mRNA. Translation: AAH02334.1 .
BC007900 mRNA. Translation: AAH07900.1 .
CCDSi CCDS44884.1. [Q15038-2 ]
CCDS44885.1. [Q15038-5 ]
CCDS44886.1. [Q15038-6 ]
CCDS44887.1. [Q15038-3 ]
CCDS44888.1. [Q15038-4 ]
CCDS8809.1. [Q15038-1 ]
RefSeqi NP_001129736.1. NM_001136264.1. [Q15038-6 ]
NP_001129738.1. NM_001136266.1. [Q15038-5 ]
NP_001129739.1. NM_001136267.1. [Q15038-3 ]
NP_001129740.1. NM_001136268.1. [Q15038-4 ]
NP_001129741.1. NM_001136269.1. [Q15038-2 ]
NP_055579.1. NM_014764.3. [Q15038-1 ]
UniGenei Hs.369761.

3D structure databases

ProteinModelPortali Q15038.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115143. 64 interactions.
IntActi Q15038. 63 interactions.
MINTi MINT-1179995.
STRINGi 9606.ENSP00000404968.

PTM databases

PhosphoSitei Q15038.

Polymorphism databases

DMDMi 44887865.

Proteomic databases

MaxQBi Q15038.
PRIDEi Q15038.

Protocols and materials databases

DNASUi 9802.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000412716 ; ENSP00000394699 ; ENSG00000183283 . [Q15038-1 ]
ENST00000425012 ; ENSP00000408251 ; ENSG00000183283 . [Q15038-2 ]
ENST00000439799 ; ENSP00000398804 ; ENSG00000183283 . [Q15038-4 ]
ENST00000449723 ; ENSP00000412812 ; ENSG00000183283 . [Q15038-6 ]
ENST00000549555 ; ENSP00000448051 ; ENSG00000183283 . [Q15038-5 ]
ENST00000549732 ; ENSP00000446554 ; ENSG00000183283 . [Q15038-3 ]
GeneIDi 9802.
KEGGi hsa:9802.
UCSCi uc001ryb.3. human. [Q15038-1 ]
uc010snf.1. human. [Q15038-2 ]

Organism-specific databases

CTDi 9802.
GeneCardsi GC12P051634.
HGNCi HGNC:2684. DAZAP2.
MIMi 607431. gene.
neXtProti NX_Q15038.
PharmGKBi PA27154.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG286791.
GeneTreei ENSGT00390000000685.
HOGENOMi HOG000007683.
HOVERGENi HBG051300.
InParanoidi Q15038.
OMAi MNNKGSY.
OrthoDBi EOG77HDG0.
PhylomeDBi Q15038.
TreeFami TF329672.

Miscellaneous databases

ChiTaRSi DAZAP2. human.
GeneWikii DAZAP2.
GenomeRNAii 9802.
NextBioi 36908.
PROi Q15038.
SOURCEi Search...

Gene expression databases

Bgeei Q15038.
CleanExi HS_DAZAP2.
ExpressionAtlasi Q15038. baseline and differential.
Genevestigatori Q15038.

Family and domain databases

InterProi IPR022730. DAZ_assoc-2.
[Graphical view ]
Pfami PF11029. DAZAP2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular features and expression of DAZAP2 in human multiple myeloma."
    Shi Y.-W., Shen R., Ren W., Tang L.J., Tan D.-R., Hu W.-X.
    Chin. Med. J. 120:1659-1665(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION.
    Tissue: Bone marrow.
  2. "Gene expression in human erythroid precursor cells."
    Gubin A.N., Lee Y.T., Bouffard G.G., Miller J.L.
    Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Erythroblast.
  3. "Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1."
    Nomura N., Nagase T., Miyajima N., Sazuka T., Tanaka A., Sato S., Seki N., Kawarabayasi Y., Ishikawa K., Tabata S.
    DNA Res. 1:223-229(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Bone marrow.
  4. "Full-length cDNA libraries and normalization."
    Li W.B., Gruber C., Jessee J., Polayes D.
    Submitted (APR-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Fetal brain.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 5).
    Tissue: Lung, Mammary gland and Thalamus.
  6. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: B-cell and Brain.
  9. "Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1."
    Tsui S., Dai T., Roettger S., Schempp W., Salido E.C., Yen P.H.
    Genomics 65:266-273(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, INTERACTION WITH DAZ AND DAZL.
    Tissue: Testis.
  10. "Characterizing the neurite outgrowth inhibitory effect of Mani."
    Mishra M., Lee S., Lin M.K., Yamashita T., Heese K.
    FEBS Lett. 586:3018-3023(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FAM168B.
  11. "Smurf2 regulates IL17RB by proteasomal degradation of its novel binding partner DAZAP2."
    Popova A., Kzhyshkowska J., Nurgazieva D., Goerdt S., Gratchev A.
    Immunobiology 217:321-328(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION BY SMURF2, SUBCELLULAR LOCATION, INTERACTION WITH IL17RB.

Entry informationi

Entry nameiDAZP2_HUMAN
AccessioniPrimary (citable) accession number: Q15038
Secondary accession number(s): A8K254
, B4DDT5, B4E1G3, C9JA96, C9JP84, E9PB45, F8VU62
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: November 1, 1996
Last modified: October 29, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3