Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DAZ-associated protein 2

Gene

DAZAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • WW domain binding Source: UniProtKB

Names & Taxonomyi

Protein namesi
Recommended name:
DAZ-associated protein 2
Alternative name(s):
Deleted in azoospermia-associated protein 2
Gene namesi
Name:DAZAP2
Synonyms:KIAA0058
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000183283.15.
HGNCiHGNC:2684. DAZAP2.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi9802.
OpenTargetsiENSG00000183283.
PharmGKBiPA27154.

Polymorphism and mutation databases

BioMutaiDAZAP2.
DMDMi44887865.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000797881 – 168DAZ-associated protein 2Add BLAST168

Post-translational modificationi

Ubiquitinated by SMURF2, leading to proteasomal degradation.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

MaxQBiQ15038.
PaxDbiQ15038.
PeptideAtlasiQ15038.
PRIDEiQ15038.

PTM databases

iPTMnetiQ15038.
PhosphoSitePlusiQ15038.

Expressioni

Tissue specificityi

Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Down-regulated in multiple myeloma.1 Publication

Gene expression databases

BgeeiENSG00000183283.
CleanExiHS_DAZAP2.
ExpressionAtlasiQ15038. baseline and differential.
GenevisibleiQ15038. HS.

Organism-specific databases

HPAiHPA045940.

Interactioni

Subunit structurei

Interacts with SOX6 (By similarity). Interacts with DAZ and DAZL. Interacts with IL17RB. May interact with FAM168B.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself4EBI-724310,EBI-724310
ACOT7O00154-44EBI-724310,EBI-12007918
ARID5AQ039898EBI-724310,EBI-948603
ATXN1P542532EBI-724310,EBI-930964
BAG3O958178EBI-724310,EBI-747185
BATF2Q8N1L93EBI-724310,EBI-742695
C1orf94Q6P1W56EBI-724310,EBI-946029
CALCOCO2Q131374EBI-724310,EBI-739580
DAB1O755533EBI-724310,EBI-7875264
DCUN1D1Q96GG96EBI-724310,EBI-740086
EPN1Q9Y6I33EBI-724310,EBI-713198
EPN3I6L9I84EBI-724310,EBI-12866582
EXD3Q9NX535EBI-724310,EBI-750745
FAM168AQ925673EBI-724310,EBI-7957930
FAM46BQ96A094EBI-724310,EBI-752030
HEY1Q9Y5J34EBI-724310,EBI-7231130
HGSO149646EBI-724310,EBI-740220
HIP1O002913EBI-724310,EBI-473886
KRTAP19-5Q3LI727EBI-724310,EBI-1048945
KRTAP8-1Q8IUC25EBI-724310,EBI-10261141
MAGED1Q9Y5V33EBI-724310,EBI-716006
MTURNQ8N3F04EBI-724310,EBI-11980301
NEDD4LQ96PU53EBI-724310,EBI-717962
OPTNQ96CV95EBI-724310,EBI-748974
OTULINQ96BN85EBI-724310,EBI-750730
PEF1Q9UBV85EBI-724310,EBI-724639
PLEKHB2Q96CS77EBI-724310,EBI-373552
PLSCR1O151624EBI-724310,EBI-740019
POGZQ7Z3K35EBI-724310,EBI-1389308
POLIQ9UNA43EBI-724310,EBI-741774
PRR20CP864794EBI-724310,EBI-10172814
RABGEF1Q9UJ413EBI-724310,EBI-913954
RBFOX2O432514EBI-724310,EBI-746056
RBM43Q6ZSC34EBI-724310,EBI-2880658
RBPMSQ930626EBI-724310,EBI-740322
RBPMSQ93062-36EBI-724310,EBI-740343
RHOXF2Q9BQY48EBI-724310,EBI-372094
RNF115Q9Y4L54EBI-724310,EBI-2129242
RNF208Q9H0X66EBI-724310,EBI-751555
ROR2A1L4F53EBI-724310,EBI-10172778
RPS27AP629798EBI-724310,EBI-357375
SMAP2Q8WU795EBI-724310,EBI-2822515
SQSTM1Q135013EBI-724310,EBI-307104
STAM2O758866EBI-724310,EBI-373258
TAX1BP1Q86VP15EBI-724310,EBI-529518
TEX37Q96LM65EBI-724310,EBI-743976
TFGQ927344EBI-724310,EBI-357061
TNIP3Q96KP69EBI-724310,EBI-2509913
TOLLIPQ6FIE93EBI-724310,EBI-10249783
TOLLIPQ9H0E28EBI-724310,EBI-74615
UBA52P629875EBI-724310,EBI-357304
UBAC1Q9BSL16EBI-724310,EBI-749370
UBASH3AP570754EBI-724310,EBI-2105393
UBASH3BQ8TF425EBI-724310,EBI-1380492
UBBP0CG476EBI-724310,EBI-413034
UBBQ5U5U63EBI-724310,EBI-1642104
UBCP0CG484EBI-724310,EBI-3390054
UBCQ96C324EBI-724310,EBI-745483
UBE2D4Q9Y2X83EBI-724310,EBI-745527
UBE2E2Q96LR53EBI-724310,EBI-2129763
UBQLN2Q9UHD94EBI-724310,EBI-947187
USP5P459743EBI-724310,EBI-741277
VHLLQ6RSH75EBI-724310,EBI-10254232
VPS37CA5D8V65EBI-724310,EBI-2559305
WWOXQ9NZC7-56EBI-724310,EBI-12040603
ZC3H10Q96K804EBI-724310,EBI-742550
ZFAND2BQ8WV998EBI-724310,EBI-747823

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • WW domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi115143. 98 interactors.
IntActiQ15038. 169 interactors.
MINTiMINT-1179995.
STRINGi9606.ENSP00000448051.

Structurei

3D structure databases

ProteinModelPortaliQ15038.
SMRiQ15038.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi8 – 134Pro-richAdd BLAST127

Phylogenomic databases

eggNOGiENOG410IVQC. Eukaryota.
ENOG4111N7I. LUCA.
GeneTreeiENSGT00390000000685.
HOGENOMiHOG000007683.
HOVERGENiHBG051300.
InParanoidiQ15038.
OMAiAYSEIYQ.
OrthoDBiEOG091G18SW.
PhylomeDBiQ15038.
TreeFamiTF329672.

Family and domain databases

InterProiView protein in InterPro
IPR022730. DAZ_assoc-2.
PfamiView protein in Pfam
PF11029. DAZAP2. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15038-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNSKGQYPTQ PTYPVQPPGN PVYPQTLHLP QAPPYTDAPP AYSELYRPSF
60 70 80 90 100
VHPGAATVPT MSAAFPGASL YLPMAQSVAV GPLGSTIPMA YYPVGPIYPP
110 120 130 140 150
GSTVLVEGGY DAGARFGAGA TAGNIPPPPP GCPPNAAQLA VMQGANVLVT
160
QRKGNFFMGG SDGGYTIW
Length:168
Mass (Da):17,319
Last modified:November 1, 1996 - v1
Checksum:i49F1B6D281E24AAC
GO
Isoform 2 (identifier: Q15038-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-168: PPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW → VKEDQDHDREQGEEDNGDNNLERRGKM

Note: No experimental confirmation available.
Show »
Length:153
Mass (Da):16,187
Checksum:iFAF1904AF43CA4E4
GO
Isoform 6 (identifier: Q15038-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     65-86: Missing.

Note: No experimental confirmation available.
Show »
Length:146
Mass (Da):15,173
Checksum:i3EA0DB83FB16A1A8
GO
Isoform 3 (identifier: Q15038-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-76: Missing.

Show »
Length:136
Mass (Da):13,987
Checksum:i46E379CE7F8A3A04
GO
Isoform 4 (identifier: Q15038-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-126: Missing.

Note: No experimental confirmation available.
Show »
Length:86
Mass (Da):9,167
Checksum:i5A99269B0CBA9174
GO
Isoform 5 (identifier: Q15038-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-168: GSTVLVEGGY...GGSDGGYTIW → ASTSWMPSQC...RNHVMVAVPP

Note: No experimental confirmation available.
Show »
Length:207
Mass (Da):22,823
Checksum:i24B6E3CC46C33150
GO

Sequence cautioni

The sequence BAA06545 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti29L → P in BAG64775 (PubMed:14702039).Curated1
Sequence conflicti47R → S in AAR11454 (PubMed:17935665).Curated1
Sequence conflicti90A → V in BU662353 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061639102S → A. Corresponds to variant dbSNP:rs57917280Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04567845 – 126Missing in isoform 4. 1 PublicationAdd BLAST82
Alternative sequenceiVSP_04567945 – 76Missing in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_05518165 – 86Missing in isoform 6. CuratedAdd BLAST22
Alternative sequenceiVSP_046764101 – 168GSTVL…GYTIW → ASTSWMPSQCCSACSHAGSQ RPRNSAEGELLHGWFRWWLH HLVRNQGHLCAGKDITYLQH FSQCNCFSHINLKLQFRHML LGCLSGAQTFRHFSNLIRNH VMVAVPP in isoform 5. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_042773127 – 168PPPPG…GYTIW → VKEDQDHDREQGEEDNGDNN LERRGKM in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY430097 mRNA. Translation: AAR11454.1.
BU662353 mRNA. No translation available.
D31767 mRNA. Translation: BAA06545.2. Different initiation.
BX441137 mRNA. No translation available.
AK095963 mRNA. No translation available.
AK290119 mRNA. Translation: BAF82808.1.
AK293330 mRNA. Translation: BAG56846.1.
AK303828 mRNA. Translation: BAG64775.1.
AC046135 Genomic DNA. No translation available.
AC139768 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW58181.1.
BC002334 mRNA. Translation: AAH02334.1.
BC007900 mRNA. Translation: AAH07900.1.
CCDSiCCDS44884.1. [Q15038-2]
CCDS44885.1. [Q15038-5]
CCDS44886.1. [Q15038-6]
CCDS44887.1. [Q15038-3]
CCDS44888.1. [Q15038-4]
CCDS8809.1. [Q15038-1]
RefSeqiNP_001129736.1. NM_001136264.1. [Q15038-6]
NP_001129738.1. NM_001136266.1. [Q15038-5]
NP_001129739.1. NM_001136267.1. [Q15038-3]
NP_001129740.1. NM_001136268.1. [Q15038-4]
NP_001129741.1. NM_001136269.1. [Q15038-2]
NP_055579.1. NM_014764.3. [Q15038-1]
UniGeneiHs.369761.

Genome annotation databases

EnsembliENST00000412716; ENSP00000394699; ENSG00000183283. [Q15038-1]
ENST00000425012; ENSP00000408251; ENSG00000183283. [Q15038-2]
ENST00000439799; ENSP00000398804; ENSG00000183283. [Q15038-4]
ENST00000449723; ENSP00000412812; ENSG00000183283. [Q15038-6]
ENST00000549555; ENSP00000448051; ENSG00000183283. [Q15038-5]
ENST00000549732; ENSP00000446554; ENSG00000183283. [Q15038-3]
GeneIDi9802.
KEGGihsa:9802.
UCSCiuc001ryb.4. human. [Q15038-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiDAZP2_HUMAN
AccessioniPrimary (citable) accession number: Q15038
Secondary accession number(s): A8K254
, B4DDT5, B4E1G3, C9JA96, C9JP84, E9PB45, F8VU62
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: November 1, 1996
Last modified: November 22, 2017
This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot