Q15019 (SEPT2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 143.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Septin-2 Alternative name(s): Neural precursor cell expressed developmentally down-regulated protein 5 Short name=NEDD-5 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 361 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Plays a role in the biogenesis of polarized columnar-shaped epithelium by maintaining polyglutamylated microtubules, thus facilitating efficient vesicle transport, and by impeding MAP4 binding to tubulin. Required for the progression through mitosis. Forms a scaffold at the midplane of the mitotic splindle required to maintain CENPE localization at kinetochores and consequently chromosome congression. During anaphase, may be required for chromosome segregation and spindle elongation. Plays a role in ciliogenesis and collective cell movements. In cilia, required for the integrity of the diffusion barrier at the base of the primary cilium that prevents diffusion of transmembrane proteins between the cilia and plasma membranes: probably acts by regulating the assembly of the tectonic-like complex (also named B9 complex) by localizing TMEM231 protein. May play a role in the internalization of 2 intracellular microbial pathogens, Listeria monocytogenes and Shigella flexneri. Ref.11 Ref.14 Ref.15 Ref.23 |
| Subunit structure | Septins polymerize into heterooligomeric protein complexes that form filaments, and associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation. Filaments are assembled from asymmetrical heterotrimers, composed of SEPT2, SEPT6 and SEPT7 that associate head-to-head to form a hexameric unit. Interaction between SEPT2 and SEPT7 seems indirect. Interacts with SEPT5 By similarity. Interaction with SEPT4 not detected By similarity. Interacts with SEPT9. Interacts with MAP4. Ref.10 Ref.13 Ref.23 Ref.29 Ref.30 |
| Subcellular location | Cytoplasm. Cytoplasm › cytoskeleton. Cytoplasm › cytoskeleton › spindle. Chromosome › centromere › kinetochore. Cleavage furrow. Midbody. Cytoplasm › cell cortex. Cell projection › cilium membrane By similarity. Note: In metaphase cells, localized within the microtubule spindle. At the metaphase plate, in close apposition to the kinetochores of the congressed chromosomes. In cells undergoing cytokinesis, localized to the midbody, the ingressing cleavage furrow, and the central spindle. During bacterial infection, displays a collar shape structure next to actin at the pole of invading bacteria. In epithelial cells, colocalizes with polyglutamylated tubulin around the trans-Golgi network, as well as juxatnuclear and proximal Golgi apparatus. Localizes at the base of the cilia near the morphological distinction between the cilia and plasma membranes. Ref.11 |
| Tissue specificity | Widely expressed. Up-regulated in liver cancer. Ref.9 Ref.21 |
| Miscellaneous | Coordinated expression with SEPT6 and SEPT7. |
| Sequence similarities | Belongs to the septin family. |
| Sequence caution | The sequence AAY14718.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence BAA09928.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| SEPT6 | Q14141 | 4 | EBI-741220,EBI-745901 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q15019-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q15019-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MPWISEGRATRPCLRVPSARRGDEGLHQRDEASQKM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 361 | 361 | Septin-2 | PRO_0000173515 | ||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 44 – 51 | 8 | GTP | |||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 183 – 191 | 9 | GTP | |||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 260 – 270 | 11 | Important for dimerization | |||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 78 | 1 | GTP By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 104 | 1 | GTP; via amide nitrogen By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 241 | 1 | GTP; via amide nitrogen and carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 256 | 1 | GTP | |||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 156 | 1 | Important for dimerization | |||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 190 | 1 | N6-acetyllysine Ref.25 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 218 | 1 | Phosphoserine Ref.8 Ref.12 Ref.16 Ref.17 Ref.18 Ref.19 Ref.20 Ref.21 Ref.22 Ref.24 Ref.26 Ref.28 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 228 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MPWISEGRATRPCLRVPSAR RGDEGLHQRDEASQKM in isoform 2. | VSP_038271 | ||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 156 | 1 | F → D: Loss of dimerization. Ref.29 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 218 | 1 | S → A: Loss of phosphorylation. Ref.21 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 260 | 1 | W → A: Loss of dimerization. Ref.29 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 270 | 1 | H → D: Loss of dimerization. Ref.29 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 69 | 1 | P → S in AAH14455. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 72 | 1 | A → AALNTRKTLLW in AAH33559. Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 360 – 361 | 2 | HV → TCKVMCTYKKSEKTLSWIKK KTFQMHDPAVCFQSLGGCHP HFNSTCA in BAA05893. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 23 – 34 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 38 – 45 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 50 – 58 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 85 – 88 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 95 – 102 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 118 – 133 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 148 – 153 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 155 – 159 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 171 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 172 – 174 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 177 – 181 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 184 – 186 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 189 – 205 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 225 – 232 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 236 – 238 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 243 – 245 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 254 – 258 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 261 – 264 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 268 – 270 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 273 – 282 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 284 – 293 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 295 – 305 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1." Nagase T., Seki N., Tanaka A., Ishikawa K., Nomura N. DNA Res. 2:167-174(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow. |
| [2] | "Isolation and mapping of a human gene (DIFF6) homologous to yeast CDC3, CDC10, CDC11, and CDC12, and mouse Diff6." Mori T., Miura K., Fujiwara T., Shin S., Inazawa J., Nakamura Y. Cytogenet. Cell Genet. 73:224-227(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Human homolog of mouse Nedd5 mRNA." Hu G. Submitted (DEC-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Amygdala. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle and Testis. |
| [7] | Lubec G., Afjehi-Sadat L. Submitted (MAR-2007) to UniProtKB Cited for: PROTEIN SEQUENCE OF 51-66, MASS SPECTROMETRY. Tissue: Brain and Cajal-Retzius cell. |
| [8] | "Septin 2 phosphorylation: theoretical and mass spectrometric evidence for the existence of a single phosphorylation site in vivo." She Y.M., Huang Y.W., Zhang L., Trimble W.S. Rapid Commun. Mass Spectrom. 18:1123-1130(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-218. |
| [9] | "Expression profiling the human septin gene family." Hall P.A., Jung K., Hillan K.J., Russell S.E.H. J. Pathol. 206:269-278(2005) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "Mammalian septins regulate microtubule stability through interaction with the microtubule-binding protein MAP4." Kremer B.E., Haystead T., Macara I.G. Mol. Biol. Cell 16:4648-4659(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MAP4, COORDINATED EXPRESSION WITH SEPT2 AND SEPT7. |
| [11] | "A mitotic septin scaffold required for mammalian chromosome congression and segregation." Spiliotis E.T., Kinoshita M., Nelson W.J. Science 307:1781-1785(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [12] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Structural analysis of septin 2, 6, and 7 complexes." Low C., Macara I.G. J. Biol. Chem. 281:30697-30706(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SEPT6 AND SEPT7. |
| [14] | "Septins regulate actin organization and cell-cycle arrest through nuclear accumulation of NCK mediated by SOCS7." Kremer B.E., Adang L.A., Macara I.G. Cell 130:837-850(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [15] | "Epithelial polarity requires septin coupling of vesicle transport to polyglutamylated microtubules." Spiliotis E.T., Hunt S.J., Hu Q., Kinoshita M., Nelson W.J. J. Cell Biol. 180:295-303(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, COLOCALIZATION WITH POLYGLUTAMYLATED TUBULIN. |
| [16] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [17] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. Tissue: Platelet. |
| [18] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [19] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [20] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. Tissue: Liver. |
| [21] | "The phosphorylation of SEPT2 on Ser218 by casein kinase 2 is important to hepatoma carcinoma cell proliferation." Yu W., Ding X., Chen F., Liu M., Shen S., Gu X., Yu L. Mol. Cell. Biochem. 325:61-67(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-218, MUTAGENESIS OF SER-218, TISSUE SPECIFICITY. |
| [22] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. |
| [23] | "Septins regulate bacterial entry into host cells." Mostowy S., Nam Tham T., Danckaert A., Guadagnini S., Boisson-Dupuis S., Pizarro-Cerda J., Cossart P. PLoS ONE 4:E4196-E4196(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SEPT9, ROLE IN BACTERIAL INFECTION. |
| [24] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [25] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-190, MASS SPECTROMETRY. |
| [26] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [27] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [28] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-218, MASS SPECTROMETRY. |
| [29] | "Structural insight into filament formation by mammalian septins." Sirajuddin M., Farkasovsky M., Hauer F., Kuehlmann D., Macara I.G., Weyand M., Stark H., Wittinghofer A. Nature 449:311-315(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.4 ANGSTROMS) OF 1-315 IN COMPLEXES WITH GTP, ELECTRON MICROSCOPY, MUTAGENESIS OF PHE-156; TRP-260 AND HIS-270, SUBUNIT. |
| [30] | "Human septin 2 in complex with GDP." Structural genomics consortium (SGC) Submitted (AUG-2007) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 21-320 IN COMPLEX WITH GDP, SUBUNIT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D63878 mRNA. Translation: BAA09928.2. Different initiation. D28540 mRNA. Translation: BAA05893.1. AF038404 mRNA. Translation: AAB92377.1. AK294563 mRNA. Translation: BAG57759.1. AC005104 Genomic DNA. No translation available. AC104841 Genomic DNA. Translation: AAY14718.1. Sequence problems. BC014455 mRNA. Translation: AAH14455.1. BC033559 mRNA. Translation: AAH33559.1. | ||||||||||||||||||||||||
| IPI | IPI00014177. IPI00871851. | ||||||||||||||||||||||||
| RefSeq | NP_001008491.1. NM_001008491.1. NP_001008492.1. NM_001008492.1. NP_004395.1. NM_004404.3. NP_006146.1. NM_006155.1. | ||||||||||||||||||||||||
| UniGene | Hs.721234. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q15019. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q15019. 7 interactions. | ||||||||||||||||||||||||
| MINT | MINT-1433588. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000353157. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q15019. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 2500769. | ||||||||||||||||||||||||
2D gel databases | |||||||||||||||||||||||||
| OGP | Q15019. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q15019. | ||||||||||||||||||||||||
| PRIDE | Q15019. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 4735. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000360051; ENSP00000353157; ENSG00000168385. ENST00000391971; ENSP00000375832; ENSG00000168385. ENST00000391973; ENSP00000375834; ENSG00000168385. ENST00000401990; ENSP00000385109; ENSG00000168385. ENST00000402092; ENSP00000385172; ENSG00000168385. | ||||||||||||||||||||||||
| GeneID | 4735. | ||||||||||||||||||||||||
| KEGG | hsa:4735. | ||||||||||||||||||||||||
| UCSC | uc002wbc.3. human. uc010zop.2. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 4735. | ||||||||||||||||||||||||
| GeneCards | GC02P242254. | ||||||||||||||||||||||||
| HGNC | HGNC:7729. SEPT2. | ||||||||||||||||||||||||
| HPA | CAB017190. HPA018481. | ||||||||||||||||||||||||
| MIM | 601506. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q15019. | ||||||||||||||||||||||||
| PharmGKB | PA31535. | ||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG5019. | ||||||||||||||||||||||||
| HOGENOM | HOG000233586. | ||||||||||||||||||||||||
| HOVERGEN | HBG065093. | ||||||||||||||||||||||||
| OMA | QDCFSTI. | ||||||||||||||||||||||||
| OrthoDB | EOG47SSF3. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q15019. | ||||||||||||||||||||||||
| Bgee | Q15019. | ||||||||||||||||||||||||
| CleanEx | HS_SEPT2. | ||||||||||||||||||||||||
| Genevestigator | Q15019. | ||||||||||||||||||||||||
| GermOnline | ENSG00000168385. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR000038. Cell_div_GTP-bd. IPR016491. Septin. IPR008113. Septin2. [Graphical view] | ||||||||||||||||||||||||
| PANTHER | PTHR18884. PTHR18884. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF00735. Septin. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PIRSF | PIRSF006698. Septin. 1 hit. | ||||||||||||||||||||||||
| PRINTS | PR01740. SEPTIN2. | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | SEPT2. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q15019. | ||||||||||||||||||||||||
| GenomeRNAi | 4735. | ||||||||||||||||||||||||
| NextBio | 18256. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | SEPT2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q15019 Secondary accession number(s): B4DGE8 Q96CB0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
