Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAD2L1-binding protein

Gene

MAD2L1BP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function to silence the spindle checkpoint and allow mitosis to proceed through anaphase by binding MAD2L1 after it has become dissociated from the MAD2L1-CDC20 complex.1 Publication

GO - Biological processi

  • mitotic cell cycle checkpoint Source: UniProtKB
  • regulation of exit from mitosis Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
MAD2L1-binding protein
Alternative name(s):
Caught by MAD2 protein
Gene namesi
Name:MAD2L1BP
Synonyms:CMT2, KIAA0110
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21059. MAD2L1BP.

Subcellular locationi

  • Nucleus
  • Cytoplasmcytoskeletonspindle

  • Note: During early mitosis, unevenly distributed throughout the nucleoplasm. From metaphase to anaphase, concentrated on the spindle.

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • nucleus Source: UniProtKB
  • spindle Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi83 – 831Q → A: Loss of interaction with MAD2L1 and disruption of ability to overcome spindle checkpoint-dependent mitotic arrest; when associated with A-191. 1 Publication
Mutagenesisi191 – 1911F → A: Loss of interaction with MAD2L1 and disruption of ability to overcome spindle checkpoint-dependent mitotic arrest; when associated with A-83. 1 Publication

Organism-specific databases

PharmGKBiPA134911020.

Polymorphism and mutation databases

BioMutaiMAD2L1BP.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 274274MAD2L1-binding proteinPRO_0000096310Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei102 – 1021PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ15013.
MaxQBiQ15013.
PaxDbiQ15013.
PeptideAtlasiQ15013.
PRIDEiQ15013.

PTM databases

iPTMnetiQ15013.
PhosphoSiteiQ15013.

Expressioni

Developmental stagei

During the cell cycle, levels increase and then remain constant until late mitosis after which they drop.1 Publication

Gene expression databases

BgeeiENSG00000124688.
CleanExiHS_MAD2L1BP.
GenevisibleiQ15013. HS.

Organism-specific databases

HPAiHPA028729.

Interactioni

Subunit structurei

Interacts with MAD2L1.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
HOMEZQ8IX15-33EBI-712181,EBI-10172004
INPP5KQ9BT403EBI-712181,EBI-749162
MAD2L1Q1325711EBI-712181,EBI-78203
NMIQ132873EBI-712181,EBI-372942
SGOL2Q562F62EBI-712181,EBI-989213
TRIP13Q156455EBI-712181,EBI-358993
ZBTB14O438293EBI-712181,EBI-10176632

Protein-protein interaction databases

BioGridi114955. 31 interactions.
DIPiDIP-34492N.
IntActiQ15013. 18 interactions.
MINTiMINT-1368732.
STRINGi9606.ENSP00000410818.

Structurei

Secondary structure

1
274
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi55 – 595Combined sources
Helixi67 – 8317Combined sources
Beta strandi86 – 894Combined sources
Helixi91 – 944Combined sources
Helixi120 – 1234Combined sources
Helixi126 – 14419Combined sources
Beta strandi149 – 1568Combined sources
Beta strandi158 – 1603Combined sources
Beta strandi162 – 1687Combined sources
Helixi183 – 19614Combined sources
Turni197 – 2004Combined sources
Beta strandi210 – 2189Combined sources
Beta strandi224 – 2296Combined sources
Beta strandi239 – 2468Combined sources
Turni254 – 2596Combined sources
Beta strandi260 – 2645Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2QYFX-ray2.30B/D36-274[»]
ProteinModelPortaliQ15013.
SMRiQ15013. Positions 54-273.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ15013.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni45 – 7834Interaction with MAD2L1Add
BLAST

Sequence similaritiesi

Belongs to the MAD2L1BP family.Curated

Phylogenomic databases

eggNOGiENOG410IEGA. Eukaryota.
ENOG4111KKB. LUCA.
GeneTreeiENSGT00390000003812.
HOGENOMiHOG000113505.
HOVERGENiHBG052442.
InParanoidiQ15013.
OMAiRLAPNSM.
OrthoDBiEOG091G113C.
PhylomeDBiQ15013.
TreeFamiTF331730.

Family and domain databases

InterProiIPR009511. MAD1/Cdc20-bound-Mad2-bd.
[Graphical view]
PfamiPF06581. p31comet. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q15013-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPEAEVLS SAAVPDLEWY EKSEETHASQ IELLETSSTQ EPLNASEAFC
60 70 80 90 100
PRDCMVPVVF PGPVSQEGCC QFTCELLKHI MYQRQQLPLP YEQLKHFYRK
110 120 130 140 150
PSPQAEEMLK KKPRATTEVS SRKCQQALAE LESVLSHLED FFARTLVPRV
160 170 180 190 200
LILLGGNALS PKEFYELDLS LLAPYSVDQS LSTAACLRRL FRAIFMADAF
210 220 230 240 250
SELQAPPLMG TVVMAQGHRN CGEDWFRPKL NYRVPSRGHK LTVTLSCGRP
260 270
SIRTTAWEDY IWFQAPVTFK GFRE
Length:274
Mass (Da):31,052
Last modified:November 1, 1996 - v1
Checksum:i5C49FBE1F456105C
GO
Isoform 2 (identifier: Q15013-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MAAPEAEVLSSAAVP → MARVPLGRSLTLSPRLEHNGMTSAHHNFRLPGSRDSPASASQVAEII

Note: No experimental confirmation available.
Show »
Length:306
Mass (Da):34,676
Checksum:iBCB9DBD4727B49A9
GO

Sequence cautioni

The sequence BAG59665 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti133 – 1331S → G in BAG59665 (PubMed:14702039).Curated
Sequence conflicti274 – 2741E → D in CAG33174 (Ref. 3) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1515MAAPE…SAAVP → MARVPLGRSLTLSPRLEHNG MTSAHHNFRLPGSRDSPASA SQVAEII in isoform 2. 1 PublicationVSP_046268Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14811 mRNA. Translation: BAA03552.1.
AK297172 mRNA. Translation: BAG59665.1. Different initiation.
CR456893 mRNA. Translation: CAG33174.1.
AL136131 Genomic DNA. Translation: CAC19507.1.
AL353602 Genomic DNA. No translation available.
BC002904 mRNA. Translation: AAH02904.1.
AL537692 mRNA. No translation available.
CCDSiCCDS47431.1. [Q15013-3]
CCDS4904.1. [Q15013-1]
RefSeqiNP_001003690.1. NM_001003690.1. [Q15013-3]
NP_055443.1. NM_014628.2. [Q15013-1]
UniGeneiHs.122346.
Hs.715485.

Genome annotation databases

EnsembliENST00000372171; ENSP00000361244; ENSG00000124688. [Q15013-1]
ENST00000451025; ENSP00000410818; ENSG00000124688. [Q15013-3]
GeneIDi9587.
KEGGihsa:9587.
UCSCiuc003ovu.4. human. [Q15013-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D14811 mRNA. Translation: BAA03552.1.
AK297172 mRNA. Translation: BAG59665.1. Different initiation.
CR456893 mRNA. Translation: CAG33174.1.
AL136131 Genomic DNA. Translation: CAC19507.1.
AL353602 Genomic DNA. No translation available.
BC002904 mRNA. Translation: AAH02904.1.
AL537692 mRNA. No translation available.
CCDSiCCDS47431.1. [Q15013-3]
CCDS4904.1. [Q15013-1]
RefSeqiNP_001003690.1. NM_001003690.1. [Q15013-3]
NP_055443.1. NM_014628.2. [Q15013-1]
UniGeneiHs.122346.
Hs.715485.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2QYFX-ray2.30B/D36-274[»]
ProteinModelPortaliQ15013.
SMRiQ15013. Positions 54-273.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114955. 31 interactions.
DIPiDIP-34492N.
IntActiQ15013. 18 interactions.
MINTiMINT-1368732.
STRINGi9606.ENSP00000410818.

PTM databases

iPTMnetiQ15013.
PhosphoSiteiQ15013.

Polymorphism and mutation databases

BioMutaiMAD2L1BP.

Proteomic databases

EPDiQ15013.
MaxQBiQ15013.
PaxDbiQ15013.
PeptideAtlasiQ15013.
PRIDEiQ15013.

Protocols and materials databases

DNASUi9587.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372171; ENSP00000361244; ENSG00000124688. [Q15013-1]
ENST00000451025; ENSP00000410818; ENSG00000124688. [Q15013-3]
GeneIDi9587.
KEGGihsa:9587.
UCSCiuc003ovu.4. human. [Q15013-1]

Organism-specific databases

CTDi9587.
GeneCardsiMAD2L1BP.
HGNCiHGNC:21059. MAD2L1BP.
HPAiHPA028729.
neXtProtiNX_Q15013.
PharmGKBiPA134911020.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEGA. Eukaryota.
ENOG4111KKB. LUCA.
GeneTreeiENSGT00390000003812.
HOGENOMiHOG000113505.
HOVERGENiHBG052442.
InParanoidiQ15013.
OMAiRLAPNSM.
OrthoDBiEOG091G113C.
PhylomeDBiQ15013.
TreeFamiTF331730.

Miscellaneous databases

EvolutionaryTraceiQ15013.
GeneWikiiMAD2L1BP.
GenomeRNAii9587.
PROiQ15013.

Gene expression databases

BgeeiENSG00000124688.
CleanExiHS_MAD2L1BP.
GenevisibleiQ15013. HS.

Family and domain databases

InterProiIPR009511. MAD1/Cdc20-bound-Mad2-bd.
[Graphical view]
PfamiPF06581. p31comet. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMD2BP_HUMAN
AccessioniPrimary (citable) accession number: Q15013
Secondary accession number(s): B4DLV3, E9PAT7, Q6IBB1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: September 7, 2016
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.