Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q15008 (PSMD6_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 133. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
26S proteasome non-ATPase regulatory subunit 6
Alternative name(s):
26S proteasome regulatory subunit RPN7
26S proteasome regulatory subunit S10
Breast cancer-associated protein SGA-113M
Phosphonoformate immuno-associated protein 4
Proteasome regulatory particle subunit p44S10
p42A
Gene names
Name:PSMD6
Synonyms:KIAA0107, PFAAP4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length389 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.

Subunit structure

Component of the PA700 complex.

Sequence similarities

Belongs to the proteasome subunit S10 family.

Contains 1 PCI domain.

Ontologies

Keywords
   Cellular componentProteasome
   Coding sequence diversityAlternative splicing
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processATP catabolic process

Non-traceable author statement Ref.1. Source: GOC

DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest

Traceable author statement. Source: Reactome

G1/S transition of mitotic cell cycle

Traceable author statement. Source: Reactome

RNA metabolic process

Traceable author statement. Source: Reactome

anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process

Traceable author statement. Source: Reactome

antigen processing and presentation of exogenous peptide antigen via MHC class I

Traceable author statement. Source: Reactome

antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent

Traceable author statement. Source: Reactome

antigen processing and presentation of peptide antigen via MHC class I

Traceable author statement. Source: Reactome

apoptotic process

Traceable author statement. Source: Reactome

cellular nitrogen compound metabolic process

Traceable author statement. Source: Reactome

gene expression

Traceable author statement. Source: Reactome

mRNA metabolic process

Traceable author statement. Source: Reactome

mitotic cell cycle

Traceable author statement. Source: Reactome

negative regulation of apoptotic process

Traceable author statement. Source: Reactome

negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle

Traceable author statement. Source: Reactome

positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle

Traceable author statement. Source: Reactome

protein polyubiquitination

Traceable author statement. Source: Reactome

proteolysis

Non-traceable author statement Ref.1. Source: UniProtKB

regulation of apoptotic process

Traceable author statement. Source: Reactome

regulation of cellular amino acid metabolic process

Traceable author statement. Source: Reactome

regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle

Traceable author statement. Source: Reactome

small molecule metabolic process

Traceable author statement. Source: Reactome

viral process

Traceable author statement. Source: Reactome

   Cellular_componentcytosol

Traceable author statement. Source: Reactome

nucleoplasm

Traceable author statement. Source: Reactome

proteasome accessory complex

Inferred from sequence or structural similarity. Source: UniProtKB

proteasome complex

Non-traceable author statement Ref.1. Source: UniProtKB

   Molecular_functionATPase activity

Non-traceable author statement Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q15008-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q15008-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNN → MNESNDSTNYD
Isoform 3 (identifier: Q15008-3)

The sequence of this isoform differs from the canonical sequence as follows:
     10-49: GLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNN → D
Note: No experimental confirmation available. Gene prediction based on EST data.
Isoform 4 (identifier: Q15008-4)

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: N → NFWNRIRQEQTEDCPPSSPSRGWHCQDWPSRKPPTSIRLCFAKPIIKRHRMPSY
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 38938926S proteasome non-ATPase regulatory subunit 6
PRO_0000173838

Regions

Domain191 – 358168PCI

Natural variations

Alternative sequence1 – 4949MPLEN…VRDNN → MNESNDSTNYD in isoform 2.
VSP_047711
Alternative sequence10 – 4940GLPKN…VRDNN → D in isoform 3.
VSP_055177
Alternative sequence491N → NFWNRIRQEQTEDCPPSSPS RGWHCQDWPSRKPPTSIRLC FAKPIIKRHRMPSY in isoform 4.
VSP_055178

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 8843E6684AE91ACD

FASTA38945,531
        10         20         30         40         50         60 
MPLENLEEEG LPKNPDLRIA QLRFLLSLPE HRGDAAVRDE LMAAVRDNNM APYYEALCKS 

        70         80         90        100        110        120 
LDWQIDVDLL NKMKKANEDE LKRLDEELED AEKNLGESEI RDAMMAKAEY LCRIGDKEGA 

       130        140        150        160        170        180 
LTAFRKTYDK TVALGHRLDI VFYLLRIGLF YMDNDLITRN TEKAKSLIEE GGDWDRRNRL 

       190        200        210        220        230        240 
KVYQGLYCVA IRDFKQAAEL FLDTVSTFTS YELMDYKTFV TYTVYVSMIA LERPDLREKV 

       250        260        270        280        290        300 
IKGAEILEVL HSLPAVRQYL FSLYECRYSV FFQSLAVVEQ EMKKDWLFAP HYRYYVREMR 

       310        320        330        340        350        360 
IHAYSQLLES YRSLTLGYMA EAFGVGVEFI DQELSRFIAA GRLHCKIDKV NEIVETNRPD 

       370        380 
SKNWQYQETI KKGDLLLNRV QKLSRVINM 

« Hide

Isoform 2 [UniParc].

Checksum: 16264993C10CA139
Show »

FASTA35141,252
Isoform 3 [UniParc].

Checksum: 539D0FE51F09DE49
Show »

FASTA35041,181
Isoform 4 [UniParc].

Checksum: 1E60106CE872DF9F
Show »

FASTA44251,923

References

« Hide 'large scale' references
[1]"The p44S10 locus, encoding a subunit of the proteasome regulatory particle, is amplified during progression of cutaneous malignant melanoma."
Ren S., Smith M.J., Louro I.D., McKie-Bell P., Bani M.R., Wagner M., Zochodne B., Redden D.T., Grizzle W.E., Wang N.D., Smith D.I., Herbst R.A., Bardenheuer W., Opalka B., Schutte J., Trent J.M., Ben-David Y., Ruppert J.M.
Oncogene 19:1419-1427(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Mammary cancer.
[2]"Screening and cloning of a new immuno-associated gene regulated by phosphonoformate."
Liu Y., Cheng J., Lu Y.
Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Cloning of an isoform of KIAA0107 gene related to spermatogenesis."
Gu A.H., Wang H., Fang X., Lu L., Xu Z.Y., Xu M., Yin L.L., Li J.M., Zhou Z.M., Sha J.H.
Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
Tissue: Testis.
[4]"Breast cancer associated protein."
Petroziello J.M.
Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[5]"Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1."
Nagase T., Miyajima N., Tanaka A., Sazuka T., Seki N., Sato S., Tabata S., Ishikawa K., Kawarabayasi Y., Kotani H., Nomura N.
DNA Res. 2:37-43(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Bone marrow.
[6]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
[7]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Thalamus.
[8]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Lymph, Ovary and Placenta.
[11]"Mass spectrometric characterization of the affinity-purified human 26S proteasome complex."
Wang X., Chen C.-F., Baker P.R., Chen P.-L., Kaiser P., Huang L.
Biochemistry 46:3553-3565(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic kidney.
[12]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[13]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF215935 mRNA. Translation: AAF65540.1.
AF530062 mRNA. Translation: AAQ09946.1.
AY359879 mRNA. Translation: AAQ63402.1.
AY568086 mRNA. Translation: AAS68366.1.
D14663 mRNA. Translation: BAA03497.1.
BX647742 mRNA. No translation available.
AK290205 mRNA. Translation: BAF82894.1.
AC012557 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW65424.1.
CH471055 Genomic DNA. Translation: EAW65427.1.
BC000630 mRNA. Translation: AAH00630.1.
BC000904 mRNA. Translation: AAH00904.1.
BC012369 mRNA. Translation: AAH12369.1.
CCDSCCDS2901.1. [Q15008-1]
CCDS63679.1. [Q15008-2]
RefSeqNP_001258708.1. NM_001271779.1.
NP_001258709.1. NM_001271780.1. [Q15008-2]
NP_001258710.1. NM_001271781.1.
NP_055629.1. NM_014814.2. [Q15008-1]
UniGeneHs.152536.

3D structure databases

ProteinModelPortalQ15008.
SMRQ15008. Positions 30-382.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid115195. 62 interactions.
DIPDIP-27590N.
IntActQ15008. 17 interactions.
MINTMINT-5004632.
STRING9606.ENSP00000295901.

PTM databases

PhosphoSiteQ15008.

Polymorphism databases

DMDM2494625.

Proteomic databases

MaxQBQ15008.
PaxDbQ15008.
PRIDEQ15008.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000295901; ENSP00000295901; ENSG00000163636. [Q15008-1]
ENST00000394431; ENSP00000377952; ENSG00000163636. [Q15008-2]
ENST00000482510; ENSP00000419227; ENSG00000163636.
GeneID9861.
KEGGhsa:9861.
UCSCuc003dlz.2. human. [Q15008-1]

Organism-specific databases

CTD9861.
GeneCardsGC03M063973.
HGNCHGNC:9564. PSMD6.
HPAHPA036921.
HPA036922.
neXtProtNX_Q15008.
PharmGKBPA33910.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5187.
HOGENOMHOG000214998.
HOVERGENHBG023924.
InParanoidQ15008.
KOK03037.
OrthoDBEOG78M020.
PhylomeDBQ15008.
TreeFamTF313819.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.
REACT_111217. Metabolism.
REACT_115566. Cell Cycle.
REACT_116125. Disease.
REACT_13505. Proteasome mediated degradation of PAK-2p34.
REACT_21257. Metabolism of RNA.
REACT_21300. Mitotic M-M/G1 phases.
REACT_383. DNA Replication.
REACT_578. Apoptosis.
REACT_6850. Cdc20:Phospho-APC/C mediated degradation of Cyclin A.
REACT_6900. Immune System.
REACT_71. Gene Expression.

Gene expression databases

ArrayExpressQ15008.
BgeeQ15008.
CleanExHS_PSMD6.
GenevestigatorQ15008.

Family and domain databases

Gene3D1.10.10.10. 1 hit.
InterProIPR019585. 26S_proteasome_reg_su-Rpn7.
IPR000717. PCI_dom.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamPF01399. PCI. 1 hit.
PF10602. RPN7. 1 hit.
[Graphical view]
SMARTSM00088. PINT. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSPSMD6. human.
GeneWikiPSMD6.
GenomeRNAi9861.
NextBio37172.
PROQ15008.

Entry information

Entry namePSMD6_HUMAN
AccessionPrimary (citable) accession number: Q15008
Secondary accession number(s): A8K2E0, E9PHI9, Q6UV22
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: July 9, 2014
This is version 133 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM