Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q15008

- PSMD6_HUMAN

UniProt

Q15008 - PSMD6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

26S proteasome non-ATPase regulatory subunit 6

Gene

PSMD6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.

GO - Molecular functioni

  1. ATPase activity Source: UniProtKB

GO - Biological processi

  1. anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process Source: Reactome
  2. antigen processing and presentation of exogenous peptide antigen via MHC class I Source: Reactome
  3. antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent Source: Reactome
  4. antigen processing and presentation of peptide antigen via MHC class I Source: Reactome
  5. apoptotic process Source: Reactome
  6. ATP catabolic process Source: GOC
  7. cellular nitrogen compound metabolic process Source: Reactome
  8. DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest Source: Reactome
  9. G1/S transition of mitotic cell cycle Source: Reactome
  10. gene expression Source: Reactome
  11. mitotic cell cycle Source: Reactome
  12. mRNA metabolic process Source: Reactome
  13. negative regulation of apoptotic process Source: Reactome
  14. negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle Source: Reactome
  15. positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle Source: Reactome
  16. protein polyubiquitination Source: Reactome
  17. proteolysis Source: UniProtKB
  18. regulation of apoptotic process Source: Reactome
  19. regulation of cellular amino acid metabolic process Source: Reactome
  20. regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle Source: Reactome
  21. RNA metabolic process Source: Reactome
  22. small molecule metabolic process Source: Reactome
  23. viral process Source: Reactome
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_11063. Degradation of beta-catenin by the destruction complex.
REACT_111056. Cross-presentation of soluble exogenous antigens (endosomes).
REACT_111178. ER-Phagosome pathway.
REACT_1156. Orc1 removal from chromatin.
REACT_118656. Activation of NF-kappaB in B cells.
REACT_1221. CDK-mediated phosphorylation and removal of Cdc6.
REACT_13464. Regulation of activated PAK-2p34 by proteasome mediated degradation.
REACT_13565. Regulation of ornithine decarboxylase (ODC).
REACT_150471. Separation of Sister Chromatids.
REACT_1614. Ubiquitin Mediated Degradation of Phosphorylated Cdc25A.
REACT_172638. Asymmetric localization of PCP proteins.
REACT_1949. CDT1 association with the CDC6:ORC:origin complex.
REACT_200766. degradation of AXIN.
REACT_200841. degradation of DVL.
REACT_20549. Autodegradation of the E3 ubiquitin ligase COP1.
REACT_206597. Degradation of GLI2 by the proteasome.
REACT_228111. Hedgehog ligand biogenesis.
REACT_228209. Hh ligand biogenesis disease.
REACT_231645. GLI3 is processed to GLI3R by the proteasome.
REACT_25325. AUF1 (hnRNP D0) destabilizes mRNA.
REACT_267605. Degradation of GLI1 by the proteasome.
REACT_4. Ubiquitin-dependent degradation of Cyclin D1.
REACT_6761. APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1.
REACT_6785. Autodegradation of Cdh1 by Cdh1:APC/C.
REACT_6821. SCF-beta-TrCP mediated degradation of Emi1.
REACT_6871. APC/C:Cdc20 mediated degradation of Securin.
REACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
REACT_9003. SCF(Skp2)-mediated degradation of p27/p21.
REACT_9031. Vpu mediated degradation of CD4.
REACT_9453. Vif-mediated degradation of APOBEC3G.

Names & Taxonomyi

Protein namesi
Recommended name:
26S proteasome non-ATPase regulatory subunit 6
Alternative name(s):
26S proteasome regulatory subunit RPN7
26S proteasome regulatory subunit S10
Breast cancer-associated protein SGA-113M
Phosphonoformate immuno-associated protein 4
Proteasome regulatory particle subunit p44S10
p42A
Gene namesi
Name:PSMD6
Synonyms:KIAA0107, PFAAP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:9564. PSMD6.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. extracellular vesicular exosome Source: UniProt
  3. nucleoplasm Source: Reactome
  4. proteasome accessory complex Source: UniProtKB
  5. proteasome complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Proteasome

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33910.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 38938926S proteasome non-ATPase regulatory subunit 6PRO_0000173838Add
BLAST

Proteomic databases

MaxQBiQ15008.
PaxDbiQ15008.
PRIDEiQ15008.

PTM databases

PhosphoSiteiQ15008.

Expressioni

Gene expression databases

BgeeiQ15008.
CleanExiHS_PSMD6.
ExpressionAtlasiQ15008. baseline and differential.
GenevestigatoriQ15008.

Organism-specific databases

HPAiHPA036921.
HPA036922.

Interactioni

Subunit structurei

Component of the PA700 complex.

Protein-protein interaction databases

BioGridi115195. 67 interactions.
DIPiDIP-27590N.
IntActiQ15008. 18 interactions.
MINTiMINT-5004632.
STRINGi9606.ENSP00000295901.

Structurei

3D structure databases

ProteinModelPortaliQ15008.
SMRiQ15008. Positions 30-382.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini191 – 358168PCIAdd
BLAST

Sequence similaritiesi

Belongs to the proteasome subunit S10 family.Curated
Contains 1 PCI domain.Curated

Phylogenomic databases

eggNOGiCOG5187.
GeneTreeiENSGT00510000046608.
HOGENOMiHOG000214998.
HOVERGENiHBG023924.
InParanoidiQ15008.
KOiK03037.
OrthoDBiEOG78M020.
PhylomeDBiQ15008.
TreeFamiTF313819.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR019585. 26S_proteasome_reg_su-Rpn7.
IPR000717. PCI_dom.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF01399. PCI. 1 hit.
PF10602. RPN7. 1 hit.
[Graphical view]
SMARTiSM00088. PINT. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q15008-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLENLEEEG LPKNPDLRIA QLRFLLSLPE HRGDAAVRDE LMAAVRDNNM
60 70 80 90 100
APYYEALCKS LDWQIDVDLL NKMKKANEDE LKRLDEELED AEKNLGESEI
110 120 130 140 150
RDAMMAKAEY LCRIGDKEGA LTAFRKTYDK TVALGHRLDI VFYLLRIGLF
160 170 180 190 200
YMDNDLITRN TEKAKSLIEE GGDWDRRNRL KVYQGLYCVA IRDFKQAAEL
210 220 230 240 250
FLDTVSTFTS YELMDYKTFV TYTVYVSMIA LERPDLREKV IKGAEILEVL
260 270 280 290 300
HSLPAVRQYL FSLYECRYSV FFQSLAVVEQ EMKKDWLFAP HYRYYVREMR
310 320 330 340 350
IHAYSQLLES YRSLTLGYMA EAFGVGVEFI DQELSRFIAA GRLHCKIDKV
360 370 380
NEIVETNRPD SKNWQYQETI KKGDLLLNRV QKLSRVINM
Length:389
Mass (Da):45,531
Last modified:November 1, 1996 - v1
Checksum:i8843E6684AE91ACD
GO
Isoform 2 (identifier: Q15008-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNN → MNESNDSTNYD

Show »
Length:351
Mass (Da):41,252
Checksum:i16264993C10CA139
GO
Isoform 3 (identifier: Q15008-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     10-49: GLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNN → D

Note: No experimental confirmation available. Gene prediction based on EST data.

Show »
Length:350
Mass (Da):41,181
Checksum:i539D0FE51F09DE49
GO
Isoform 4 (identifier: Q15008-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: N → NFWNRIRQEQTEDCPPSSPSRGWHCQDWPSRKPPTSIRLCFAKPIIKRHRMPSY

Note: No experimental confirmation available.

Show »
Length:442
Mass (Da):51,923
Checksum:i1E60106CE872DF9F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4949MPLEN…VRDNN → MNESNDSTNYD in isoform 2. 1 PublicationVSP_047711Add
BLAST
Alternative sequencei10 – 4940GLPKN…VRDNN → D in isoform 3. CuratedVSP_055177Add
BLAST
Alternative sequencei49 – 491N → NFWNRIRQEQTEDCPPSSPS RGWHCQDWPSRKPPTSIRLC FAKPIIKRHRMPSY in isoform 4. 1 PublicationVSP_055178

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF215935 mRNA. Translation: AAF65540.1.
AF530062 mRNA. Translation: AAQ09946.1.
AY359879 mRNA. Translation: AAQ63402.1.
AY568086 mRNA. Translation: AAS68366.1.
D14663 mRNA. Translation: BAA03497.1.
BX647742 mRNA. No translation available.
AK290205 mRNA. Translation: BAF82894.1.
AC012557 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW65424.1.
CH471055 Genomic DNA. Translation: EAW65427.1.
BC000630 mRNA. Translation: AAH00630.1.
BC000904 mRNA. Translation: AAH00904.1.
BC012369 mRNA. Translation: AAH12369.1.
CCDSiCCDS2901.1. [Q15008-1]
CCDS63677.1. [Q15008-4]
CCDS63678.1. [Q15008-3]
CCDS63679.1. [Q15008-2]
RefSeqiNP_001258708.1. NM_001271779.1. [Q15008-4]
NP_001258709.1. NM_001271780.1. [Q15008-2]
NP_001258710.1. NM_001271781.1. [Q15008-3]
NP_055629.1. NM_014814.2. [Q15008-1]
UniGeneiHs.152536.

Genome annotation databases

EnsembliENST00000295901; ENSP00000295901; ENSG00000163636. [Q15008-1]
ENST00000394431; ENSP00000377952; ENSG00000163636. [Q15008-2]
ENST00000482510; ENSP00000419227; ENSG00000163636. [Q15008-3]
ENST00000492933; ENSP00000418695; ENSG00000163636. [Q15008-4]
GeneIDi9861.
KEGGihsa:9861.
UCSCiuc003dlz.2. human. [Q15008-1]
uc003dmd.2. human.

Polymorphism databases

DMDMi2494625.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF215935 mRNA. Translation: AAF65540.1 .
AF530062 mRNA. Translation: AAQ09946.1 .
AY359879 mRNA. Translation: AAQ63402.1 .
AY568086 mRNA. Translation: AAS68366.1 .
D14663 mRNA. Translation: BAA03497.1 .
BX647742 mRNA. No translation available.
AK290205 mRNA. Translation: BAF82894.1 .
AC012557 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW65424.1 .
CH471055 Genomic DNA. Translation: EAW65427.1 .
BC000630 mRNA. Translation: AAH00630.1 .
BC000904 mRNA. Translation: AAH00904.1 .
BC012369 mRNA. Translation: AAH12369.1 .
CCDSi CCDS2901.1. [Q15008-1 ]
CCDS63677.1. [Q15008-4 ]
CCDS63678.1. [Q15008-3 ]
CCDS63679.1. [Q15008-2 ]
RefSeqi NP_001258708.1. NM_001271779.1. [Q15008-4 ]
NP_001258709.1. NM_001271780.1. [Q15008-2 ]
NP_001258710.1. NM_001271781.1. [Q15008-3 ]
NP_055629.1. NM_014814.2. [Q15008-1 ]
UniGenei Hs.152536.

3D structure databases

ProteinModelPortali Q15008.
SMRi Q15008. Positions 30-382.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115195. 67 interactions.
DIPi DIP-27590N.
IntActi Q15008. 18 interactions.
MINTi MINT-5004632.
STRINGi 9606.ENSP00000295901.

PTM databases

PhosphoSitei Q15008.

Polymorphism databases

DMDMi 2494625.

Proteomic databases

MaxQBi Q15008.
PaxDbi Q15008.
PRIDEi Q15008.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000295901 ; ENSP00000295901 ; ENSG00000163636 . [Q15008-1 ]
ENST00000394431 ; ENSP00000377952 ; ENSG00000163636 . [Q15008-2 ]
ENST00000482510 ; ENSP00000419227 ; ENSG00000163636 . [Q15008-3 ]
ENST00000492933 ; ENSP00000418695 ; ENSG00000163636 . [Q15008-4 ]
GeneIDi 9861.
KEGGi hsa:9861.
UCSCi uc003dlz.2. human. [Q15008-1 ]
uc003dmd.2. human.

Organism-specific databases

CTDi 9861.
GeneCardsi GC03M063973.
HGNCi HGNC:9564. PSMD6.
HPAi HPA036921.
HPA036922.
neXtProti NX_Q15008.
PharmGKBi PA33910.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5187.
GeneTreei ENSGT00510000046608.
HOGENOMi HOG000214998.
HOVERGENi HBG023924.
InParanoidi Q15008.
KOi K03037.
OrthoDBi EOG78M020.
PhylomeDBi Q15008.
TreeFami TF313819.

Enzyme and pathway databases

Reactomei REACT_11063. Degradation of beta-catenin by the destruction complex.
REACT_111056. Cross-presentation of soluble exogenous antigens (endosomes).
REACT_111178. ER-Phagosome pathway.
REACT_1156. Orc1 removal from chromatin.
REACT_118656. Activation of NF-kappaB in B cells.
REACT_1221. CDK-mediated phosphorylation and removal of Cdc6.
REACT_13464. Regulation of activated PAK-2p34 by proteasome mediated degradation.
REACT_13565. Regulation of ornithine decarboxylase (ODC).
REACT_150471. Separation of Sister Chromatids.
REACT_1614. Ubiquitin Mediated Degradation of Phosphorylated Cdc25A.
REACT_172638. Asymmetric localization of PCP proteins.
REACT_1949. CDT1 association with the CDC6:ORC:origin complex.
REACT_200766. degradation of AXIN.
REACT_200841. degradation of DVL.
REACT_20549. Autodegradation of the E3 ubiquitin ligase COP1.
REACT_206597. Degradation of GLI2 by the proteasome.
REACT_228111. Hedgehog ligand biogenesis.
REACT_228209. Hh ligand biogenesis disease.
REACT_231645. GLI3 is processed to GLI3R by the proteasome.
REACT_25325. AUF1 (hnRNP D0) destabilizes mRNA.
REACT_267605. Degradation of GLI1 by the proteasome.
REACT_4. Ubiquitin-dependent degradation of Cyclin D1.
REACT_6761. APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1.
REACT_6785. Autodegradation of Cdh1 by Cdh1:APC/C.
REACT_6821. SCF-beta-TrCP mediated degradation of Emi1.
REACT_6871. APC/C:Cdc20 mediated degradation of Securin.
REACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
REACT_9003. SCF(Skp2)-mediated degradation of p27/p21.
REACT_9031. Vpu mediated degradation of CD4.
REACT_9453. Vif-mediated degradation of APOBEC3G.

Miscellaneous databases

ChiTaRSi PSMD6. human.
GeneWikii PSMD6.
GenomeRNAii 9861.
NextBioi 35502061.
PROi Q15008.

Gene expression databases

Bgeei Q15008.
CleanExi HS_PSMD6.
ExpressionAtlasi Q15008. baseline and differential.
Genevestigatori Q15008.

Family and domain databases

Gene3Di 1.10.10.10. 1 hit.
InterProi IPR019585. 26S_proteasome_reg_su-Rpn7.
IPR000717. PCI_dom.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view ]
Pfami PF01399. PCI. 1 hit.
PF10602. RPN7. 1 hit.
[Graphical view ]
SMARTi SM00088. PINT. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The p44S10 locus, encoding a subunit of the proteasome regulatory particle, is amplified during progression of cutaneous malignant melanoma."
    Ren S., Smith M.J., Louro I.D., McKie-Bell P., Bani M.R., Wagner M., Zochodne B., Redden D.T., Grizzle W.E., Wang N.D., Smith D.I., Herbst R.A., Bardenheuer W., Opalka B., Schutte J., Trent J.M., Ben-David Y., Ruppert J.M.
    Oncogene 19:1419-1427(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Mammary cancer.
  2. "Screening and cloning of a new immuno-associated gene regulated by phosphonoformate."
    Liu Y., Cheng J., Lu Y.
    Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Cloning of an isoform of KIAA0107 gene related to spermatogenesis."
    Gu A.H., Wang H., Fang X., Lu L., Xu Z.Y., Xu M., Yin L.L., Li J.M., Zhou Z.M., Sha J.H.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
    Tissue: Testis.
  4. "Breast cancer associated protein."
    Petroziello J.M.
    Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  5. "Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1."
    Nagase T., Miyajima N., Tanaka A., Sazuka T., Seki N., Sato S., Tabata S., Ishikawa K., Kawarabayasi Y., Kotani H., Nomura N.
    DNA Res. 2:37-43(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Bone marrow.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Thalamus.
  8. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lymph, Ovary and Placenta.
  11. "Mass spectrometric characterization of the affinity-purified human 26S proteasome complex."
    Wang X., Chen C.-F., Baker P.R., Chen P.-L., Kaiser P., Huang L.
    Biochemistry 46:3553-3565(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPSMD6_HUMAN
AccessioniPrimary (citable) accession number: Q15008
Secondary accession number(s): A8K2E0, E9PHI9, Q6UV22
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: November 26, 2014
This is version 137 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3