Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q15008

- PSMD6_HUMAN

UniProt

Q15008 - PSMD6_HUMAN

Protein

26S proteasome non-ATPase regulatory subunit 6

Gene

PSMD6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 135 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.

    GO - Molecular functioni

    1. ATPase activity Source: UniProtKB

    GO - Biological processi

    1. anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process Source: Reactome
    2. antigen processing and presentation of exogenous peptide antigen via MHC class I Source: Reactome
    3. antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent Source: Reactome
    4. antigen processing and presentation of peptide antigen via MHC class I Source: Reactome
    5. apoptotic process Source: Reactome
    6. ATP catabolic process Source: GOC
    7. cellular nitrogen compound metabolic process Source: Reactome
    8. DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest Source: Reactome
    9. G1/S transition of mitotic cell cycle Source: Reactome
    10. gene expression Source: Reactome
    11. mitotic cell cycle Source: Reactome
    12. mRNA metabolic process Source: Reactome
    13. negative regulation of apoptotic process Source: Reactome
    14. negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle Source: Reactome
    15. positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle Source: Reactome
    16. protein polyubiquitination Source: Reactome
    17. proteolysis Source: UniProtKB
    18. regulation of apoptotic process Source: Reactome
    19. regulation of cellular amino acid metabolic process Source: Reactome
    20. regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle Source: Reactome
    21. RNA metabolic process Source: Reactome
    22. small molecule metabolic process Source: Reactome
    23. viral process Source: Reactome

    Enzyme and pathway databases

    ReactomeiREACT_111056. Cross-presentation of soluble exogenous antigens (endosomes).
    REACT_111178. ER-Phagosome pathway.
    REACT_1156. Orc1 removal from chromatin.
    REACT_118656. Activation of NF-kappaB in B cells.
    REACT_1221. CDK-mediated phosphorylation and removal of Cdc6.
    REACT_13464. Regulation of activated PAK-2p34 by proteasome mediated degradation.
    REACT_13565. Regulation of ornithine decarboxylase (ODC).
    REACT_150471. Separation of Sister Chromatids.
    REACT_1614. Ubiquitin Mediated Degradation of Phosphorylated Cdc25A.
    REACT_172638. Asymmetric localization of PCP proteins.
    REACT_1949. CDT1 association with the CDC6:ORC:origin complex.
    REACT_200766. degradation of AXIN.
    REACT_200841. degradation of DVL.
    REACT_20549. Autodegradation of the E3 ubiquitin ligase COP1.
    REACT_25325. AUF1 (hnRNP D0) destabilizes mRNA.
    REACT_4. Ubiquitin-dependent degradation of Cyclin D1.
    REACT_6761. APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1.
    REACT_6785. Autodegradation of Cdh1 by Cdh1:APC/C.
    REACT_6821. SCF-beta-TrCP mediated degradation of Emi1.
    REACT_6871. APC/C:Cdc20 mediated degradation of Securin.
    REACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
    REACT_9003. SCF(Skp2)-mediated degradation of p27/p21.
    REACT_9031. Vpu mediated degradation of CD4.
    REACT_9453. Vif-mediated degradation of APOBEC3G.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    26S proteasome non-ATPase regulatory subunit 6
    Alternative name(s):
    26S proteasome regulatory subunit RPN7
    26S proteasome regulatory subunit S10
    Breast cancer-associated protein SGA-113M
    Phosphonoformate immuno-associated protein 4
    Proteasome regulatory particle subunit p44S10
    p42A
    Gene namesi
    Name:PSMD6
    Synonyms:KIAA0107, PFAAP4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:9564. PSMD6.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. extracellular vesicular exosome Source: UniProt
    3. nucleoplasm Source: Reactome
    4. proteasome accessory complex Source: UniProtKB
    5. proteasome complex Source: UniProtKB

    Keywords - Cellular componenti

    Proteasome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33910.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 38938926S proteasome non-ATPase regulatory subunit 6PRO_0000173838Add
    BLAST

    Proteomic databases

    MaxQBiQ15008.
    PaxDbiQ15008.
    PRIDEiQ15008.

    PTM databases

    PhosphoSiteiQ15008.

    Expressioni

    Gene expression databases

    ArrayExpressiQ15008.
    BgeeiQ15008.
    CleanExiHS_PSMD6.
    GenevestigatoriQ15008.

    Organism-specific databases

    HPAiHPA036921.
    HPA036922.

    Interactioni

    Subunit structurei

    Component of the PA700 complex.

    Protein-protein interaction databases

    BioGridi115195. 60 interactions.
    DIPiDIP-27590N.
    IntActiQ15008. 18 interactions.
    MINTiMINT-5004632.
    STRINGi9606.ENSP00000295901.

    Structurei

    3D structure databases

    ProteinModelPortaliQ15008.
    SMRiQ15008. Positions 30-382.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini191 – 358168PCIAdd
    BLAST

    Sequence similaritiesi

    Belongs to the proteasome subunit S10 family.Curated
    Contains 1 PCI domain.Curated

    Phylogenomic databases

    eggNOGiCOG5187.
    HOGENOMiHOG000214998.
    HOVERGENiHBG023924.
    InParanoidiQ15008.
    KOiK03037.
    OrthoDBiEOG78M020.
    PhylomeDBiQ15008.
    TreeFamiTF313819.

    Family and domain databases

    Gene3Di1.10.10.10. 1 hit.
    InterProiIPR019585. 26S_proteasome_reg_su-Rpn7.
    IPR000717. PCI_dom.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view]
    PfamiPF01399. PCI. 1 hit.
    PF10602. RPN7. 1 hit.
    [Graphical view]
    SMARTiSM00088. PINT. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q15008-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPLENLEEEG LPKNPDLRIA QLRFLLSLPE HRGDAAVRDE LMAAVRDNNM    50
    APYYEALCKS LDWQIDVDLL NKMKKANEDE LKRLDEELED AEKNLGESEI 100
    RDAMMAKAEY LCRIGDKEGA LTAFRKTYDK TVALGHRLDI VFYLLRIGLF 150
    YMDNDLITRN TEKAKSLIEE GGDWDRRNRL KVYQGLYCVA IRDFKQAAEL 200
    FLDTVSTFTS YELMDYKTFV TYTVYVSMIA LERPDLREKV IKGAEILEVL 250
    HSLPAVRQYL FSLYECRYSV FFQSLAVVEQ EMKKDWLFAP HYRYYVREMR 300
    IHAYSQLLES YRSLTLGYMA EAFGVGVEFI DQELSRFIAA GRLHCKIDKV 350
    NEIVETNRPD SKNWQYQETI KKGDLLLNRV QKLSRVINM 389
    Length:389
    Mass (Da):45,531
    Last modified:November 1, 1996 - v1
    Checksum:i8843E6684AE91ACD
    GO
    Isoform 2 (identifier: Q15008-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-49: MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNN → MNESNDSTNYD

    Show »
    Length:351
    Mass (Da):41,252
    Checksum:i16264993C10CA139
    GO
    Isoform 3 (identifier: Q15008-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         10-49: GLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNN → D

    Note: No experimental confirmation available. Gene prediction based on EST data.

    Show »
    Length:350
    Mass (Da):41,181
    Checksum:i539D0FE51F09DE49
    GO
    Isoform 4 (identifier: Q15008-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         49-49: N → NFWNRIRQEQTEDCPPSSPSRGWHCQDWPSRKPPTSIRLCFAKPIIKRHRMPSY

    Note: No experimental confirmation available.

    Show »
    Length:442
    Mass (Da):51,923
    Checksum:i1E60106CE872DF9F
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4949MPLEN…VRDNN → MNESNDSTNYD in isoform 2. 1 PublicationVSP_047711Add
    BLAST
    Alternative sequencei10 – 4940GLPKN…VRDNN → D in isoform 3. CuratedVSP_055177Add
    BLAST
    Alternative sequencei49 – 491N → NFWNRIRQEQTEDCPPSSPS RGWHCQDWPSRKPPTSIRLC FAKPIIKRHRMPSY in isoform 4. 1 PublicationVSP_055178

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF215935 mRNA. Translation: AAF65540.1.
    AF530062 mRNA. Translation: AAQ09946.1.
    AY359879 mRNA. Translation: AAQ63402.1.
    AY568086 mRNA. Translation: AAS68366.1.
    D14663 mRNA. Translation: BAA03497.1.
    BX647742 mRNA. No translation available.
    AK290205 mRNA. Translation: BAF82894.1.
    AC012557 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW65424.1.
    CH471055 Genomic DNA. Translation: EAW65427.1.
    BC000630 mRNA. Translation: AAH00630.1.
    BC000904 mRNA. Translation: AAH00904.1.
    BC012369 mRNA. Translation: AAH12369.1.
    CCDSiCCDS2901.1. [Q15008-1]
    CCDS63677.1. [Q15008-4]
    CCDS63678.1. [Q15008-3]
    CCDS63679.1. [Q15008-2]
    RefSeqiNP_001258708.1. NM_001271779.1.
    NP_001258709.1. NM_001271780.1. [Q15008-2]
    NP_001258710.1. NM_001271781.1.
    NP_055629.1. NM_014814.2. [Q15008-1]
    UniGeneiHs.152536.

    Genome annotation databases

    EnsembliENST00000295901; ENSP00000295901; ENSG00000163636. [Q15008-1]
    ENST00000394431; ENSP00000377952; ENSG00000163636. [Q15008-2]
    ENST00000482510; ENSP00000419227; ENSG00000163636. [Q15008-3]
    ENST00000492933; ENSP00000418695; ENSG00000163636. [Q15008-4]
    GeneIDi9861.
    KEGGihsa:9861.
    UCSCiuc003dlz.2. human. [Q15008-1]
    uc003dmd.2. human.

    Polymorphism databases

    DMDMi2494625.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF215935 mRNA. Translation: AAF65540.1 .
    AF530062 mRNA. Translation: AAQ09946.1 .
    AY359879 mRNA. Translation: AAQ63402.1 .
    AY568086 mRNA. Translation: AAS68366.1 .
    D14663 mRNA. Translation: BAA03497.1 .
    BX647742 mRNA. No translation available.
    AK290205 mRNA. Translation: BAF82894.1 .
    AC012557 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW65424.1 .
    CH471055 Genomic DNA. Translation: EAW65427.1 .
    BC000630 mRNA. Translation: AAH00630.1 .
    BC000904 mRNA. Translation: AAH00904.1 .
    BC012369 mRNA. Translation: AAH12369.1 .
    CCDSi CCDS2901.1. [Q15008-1 ]
    CCDS63677.1. [Q15008-4 ]
    CCDS63678.1. [Q15008-3 ]
    CCDS63679.1. [Q15008-2 ]
    RefSeqi NP_001258708.1. NM_001271779.1.
    NP_001258709.1. NM_001271780.1. [Q15008-2 ]
    NP_001258710.1. NM_001271781.1.
    NP_055629.1. NM_014814.2. [Q15008-1 ]
    UniGenei Hs.152536.

    3D structure databases

    ProteinModelPortali Q15008.
    SMRi Q15008. Positions 30-382.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115195. 60 interactions.
    DIPi DIP-27590N.
    IntActi Q15008. 18 interactions.
    MINTi MINT-5004632.
    STRINGi 9606.ENSP00000295901.

    PTM databases

    PhosphoSitei Q15008.

    Polymorphism databases

    DMDMi 2494625.

    Proteomic databases

    MaxQBi Q15008.
    PaxDbi Q15008.
    PRIDEi Q15008.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000295901 ; ENSP00000295901 ; ENSG00000163636 . [Q15008-1 ]
    ENST00000394431 ; ENSP00000377952 ; ENSG00000163636 . [Q15008-2 ]
    ENST00000482510 ; ENSP00000419227 ; ENSG00000163636 . [Q15008-3 ]
    ENST00000492933 ; ENSP00000418695 ; ENSG00000163636 . [Q15008-4 ]
    GeneIDi 9861.
    KEGGi hsa:9861.
    UCSCi uc003dlz.2. human. [Q15008-1 ]
    uc003dmd.2. human.

    Organism-specific databases

    CTDi 9861.
    GeneCardsi GC03M063973.
    HGNCi HGNC:9564. PSMD6.
    HPAi HPA036921.
    HPA036922.
    neXtProti NX_Q15008.
    PharmGKBi PA33910.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5187.
    HOGENOMi HOG000214998.
    HOVERGENi HBG023924.
    InParanoidi Q15008.
    KOi K03037.
    OrthoDBi EOG78M020.
    PhylomeDBi Q15008.
    TreeFami TF313819.

    Enzyme and pathway databases

    Reactomei REACT_111056. Cross-presentation of soluble exogenous antigens (endosomes).
    REACT_111178. ER-Phagosome pathway.
    REACT_1156. Orc1 removal from chromatin.
    REACT_118656. Activation of NF-kappaB in B cells.
    REACT_1221. CDK-mediated phosphorylation and removal of Cdc6.
    REACT_13464. Regulation of activated PAK-2p34 by proteasome mediated degradation.
    REACT_13565. Regulation of ornithine decarboxylase (ODC).
    REACT_150471. Separation of Sister Chromatids.
    REACT_1614. Ubiquitin Mediated Degradation of Phosphorylated Cdc25A.
    REACT_172638. Asymmetric localization of PCP proteins.
    REACT_1949. CDT1 association with the CDC6:ORC:origin complex.
    REACT_200766. degradation of AXIN.
    REACT_200841. degradation of DVL.
    REACT_20549. Autodegradation of the E3 ubiquitin ligase COP1.
    REACT_25325. AUF1 (hnRNP D0) destabilizes mRNA.
    REACT_4. Ubiquitin-dependent degradation of Cyclin D1.
    REACT_6761. APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1.
    REACT_6785. Autodegradation of Cdh1 by Cdh1:APC/C.
    REACT_6821. SCF-beta-TrCP mediated degradation of Emi1.
    REACT_6871. APC/C:Cdc20 mediated degradation of Securin.
    REACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
    REACT_9003. SCF(Skp2)-mediated degradation of p27/p21.
    REACT_9031. Vpu mediated degradation of CD4.
    REACT_9453. Vif-mediated degradation of APOBEC3G.

    Miscellaneous databases

    ChiTaRSi PSMD6. human.
    GeneWikii PSMD6.
    GenomeRNAii 9861.
    NextBioi 35502061.
    PROi Q15008.

    Gene expression databases

    ArrayExpressi Q15008.
    Bgeei Q15008.
    CleanExi HS_PSMD6.
    Genevestigatori Q15008.

    Family and domain databases

    Gene3Di 1.10.10.10. 1 hit.
    InterProi IPR019585. 26S_proteasome_reg_su-Rpn7.
    IPR000717. PCI_dom.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view ]
    Pfami PF01399. PCI. 1 hit.
    PF10602. RPN7. 1 hit.
    [Graphical view ]
    SMARTi SM00088. PINT. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The p44S10 locus, encoding a subunit of the proteasome regulatory particle, is amplified during progression of cutaneous malignant melanoma."
      Ren S., Smith M.J., Louro I.D., McKie-Bell P., Bani M.R., Wagner M., Zochodne B., Redden D.T., Grizzle W.E., Wang N.D., Smith D.I., Herbst R.A., Bardenheuer W., Opalka B., Schutte J., Trent J.M., Ben-David Y., Ruppert J.M.
      Oncogene 19:1419-1427(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Mammary cancer.
    2. "Screening and cloning of a new immuno-associated gene regulated by phosphonoformate."
      Liu Y., Cheng J., Lu Y.
      Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "Cloning of an isoform of KIAA0107 gene related to spermatogenesis."
      Gu A.H., Wang H., Fang X., Lu L., Xu Z.Y., Xu M., Yin L.L., Li J.M., Zhou Z.M., Sha J.H.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
      Tissue: Testis.
    4. "Breast cancer associated protein."
      Petroziello J.M.
      Submitted (MAR-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    5. "Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1."
      Nagase T., Miyajima N., Tanaka A., Sazuka T., Seki N., Sato S., Tabata S., Ishikawa K., Kawarabayasi Y., Kotani H., Nomura N.
      DNA Res. 2:37-43(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Bone marrow.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Thalamus.
    8. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lymph, Ovary and Placenta.
    11. "Mass spectrometric characterization of the affinity-purified human 26S proteasome complex."
      Wang X., Chen C.-F., Baker P.R., Chen P.-L., Kaiser P., Huang L.
      Biochemistry 46:3553-3565(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic kidney.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPSMD6_HUMAN
    AccessioniPrimary (citable) accession number: Q15008
    Secondary accession number(s): A8K2E0, E9PHI9, Q6UV22
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 135 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3