Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ventricular zone-expressed PH domain-containing protein homolog 1

Gene

VEPH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SIGNORiQ14D04.

Names & Taxonomyi

Protein namesi
Recommended name:
Ventricular zone-expressed PH domain-containing protein homolog 1
Alternative name(s):
Protein melted
Gene namesi
Name:VEPH1
Synonyms:KIAA1692, VEPH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:25735. VEPH1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134952229.

Polymorphism and mutation databases

BioMutaiVEPH1.
DMDMi121946695.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 833833Ventricular zone-expressed PH domain-containing protein homolog 1PRO_0000297955Add
BLAST

Proteomic databases

MaxQBiQ14D04.
PaxDbiQ14D04.
PeptideAtlasiQ14D04.
PRIDEiQ14D04.
TopDownProteomicsiQ14D04-2. [Q14D04-2]

PTM databases

iPTMnetiQ14D04.
PhosphoSiteiQ14D04.

Expressioni

Gene expression databases

BgeeiQ14D04.
ExpressionAtlasiQ14D04. baseline and differential.
GenevisibleiQ14D04. HS.

Organism-specific databases

HPAiHPA026645.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000354919.

Structurei

3D structure databases

ProteinModelPortaliQ14D04.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini716 – 819104PHPROSITE-ProRule annotationAdd
BLAST

Domaini

The PH domain is required for membrane targeting.By similarity

Sequence similaritiesi

Belongs to the MELT/VEPH family.Curated
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3723. Eukaryota.
ENOG410XQXD. LUCA.
GeneTreeiENSGT00390000018660.
HOVERGENiHBG097059.
InParanoidiQ14D04.
OMAiPQPINRH.
OrthoDBiEOG7GBFWC.
PhylomeDBiQ14D04.
TreeFamiTF314736.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
SSF50729. SSF50729. 2 hits.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14D04-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHQLFRLVLG QKDLSRAGDL FSLDDSEIED SLTEALEQIK IISSSSDYQT
60 70 80 90 100
NNNDQAVVEI CITRITTAIR ETESIEKHAK ALVGLWDSCL EHNLRPFGKD
110 120 130 140 150
EDTPHAKIAS DIMSCILQNY NRPPVMALAI PIAVKFLHRG NKELCRNMSN
160 170 180 190 200
YLSLAAITKA DLLADHTEVI VKSILQGNTM LLRVLPAVYE KQPQPINRHL
210 220 230 240 250
TELLALMSQL EQPEQYHLLR LLHVAAKKKQ LEVVQKCIPF LIGHLKDSTH
260 270 280 290 300
NDIILNILIE IAVYEPVALN SFLPMLKEIG ERFPYLTGQM ARIYGAVGHV
310 320 330 340 350
DEERARSCLT YLVSQLANME HSFHHILLLE IKSITDTFSS ILGPQSRDIF
360 370 380 390 400
RMSNSFTAIA KLLTRQLENT KAGSGRRKIS TEIEFPEKLE ETKLIVTENE
410 420 430 440 450
DHEKLQVKIQ AFEDKINAGS NTPGSIRRYS LGQVSKEERK NIRFNRSKSL
460 470 480 490 500
AFHTMLTKGV GSDDGEDENR GDIPASISLS EIDPLGQGND KLPFKTDTER
510 520 530 540 550
SQLGESSVSY PNIIHIDSEN LSETVKENSQ EETPETTASP IEYQDKLYLH
560 570 580 590 600
LKKNLSKVKA YAMEIGKKIP VPDQCTIEDT VRSCVAKLFF TCSLKGHYCL
610 620 630 640 650
YSKSSFILIS QEPQPWIQIM FLFQQSLFPE PLSIQSHSVQ FLRALWEKTQ
660 670 680 690 700
AGGAHSFETA MMESTFPQQK DLDQVQLHLE EVRFFDVFGF SETAGAWQCF
710 720 730 740 750
MCNNPEKATV VNQDGQPLIE GKLKEKQVRW KFIKRWKTRY FTLAGNQLLF
760 770 780 790 800
QKGKSKDDPD DCPIELSKVQ SVKAVAKKRR DRSLPRAFEI FTDNKTYVFK
810 820 830
AKDEKNAEEW LQCINVAVAQ AKERESREVT TYL
Length:833
Mass (Da):94,745
Last modified:August 22, 2006 - v1
Checksum:i34995B4AB43474A4
GO
Isoform 2 (identifier: Q14D04-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-670: Missing.

Note: No experimental confirmation available.
Show »
Length:788
Mass (Da):89,684
Checksum:i4D65E7A98FFF7854
GO
Isoform 3 (identifier: Q14D04-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-213: NTMLLRVLPAVYEKQPQPINRHLTELLALMSQLEQP → MVRKLSLGTCFGRYLKVFSSSIYGLWEARPRVLEAN
     214-833: Missing.

Note: No experimental confirmation available.
Show »
Length:213
Mass (Da):23,877
Checksum:i16757EB780A31BF8
GO
Isoform 4 (identifier: Q14D04-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-177: G → V
     178-833: Missing.

Note: No experimental confirmation available.
Show »
Length:177
Mass (Da):19,789
Checksum:iC27573F8B3DC7757
GO

Sequence cautioni

The sequence BAB14165.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB21783.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti259 – 2591I → M in BAB55243 (PubMed:14702039).Curated
Sequence conflicti808 – 8081E → A in BAB55243 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti208 – 2081S → C.
Corresponds to variant rs34559487 [ dbSNP | Ensembl ].
VAR_034692
Natural varianti263 – 2631V → G.1 Publication
Corresponds to variant rs1378796 [ dbSNP | Ensembl ].
VAR_034693
Natural varianti271 – 2711S → C.
Corresponds to variant rs1378795 [ dbSNP | Ensembl ].
VAR_034694
Natural varianti319 – 3191M → V.
Corresponds to variant rs11923380 [ dbSNP | Ensembl ].
VAR_034695
Natural varianti329 – 3291L → V.
Corresponds to variant rs34823544 [ dbSNP | Ensembl ].
VAR_034696
Natural varianti365 – 3651R → Q.
Corresponds to variant rs16827563 [ dbSNP | Ensembl ].
VAR_034697
Natural varianti501 – 5011S → L.
Corresponds to variant rs59504298 [ dbSNP | Ensembl ].
VAR_061683
Natural varianti522 – 5221S → P.1 Publication
Corresponds to variant rs11918974 [ dbSNP | Ensembl ].
VAR_034698

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei177 – 1771G → V in isoform 4. CuratedVSP_047655
Alternative sequencei178 – 833656Missing in isoform 4. CuratedVSP_047656Add
BLAST
Alternative sequencei178 – 21336NTMLL…QLEQP → MVRKLSLGTCFGRYLKVFSS SIYGLWEARPRVLEAN in isoform 3. CuratedVSP_027431Add
BLAST
Alternative sequencei214 – 833620Missing in isoform 3. CuratedVSP_027432Add
BLAST
Alternative sequencei626 – 67045Missing in isoform 2. 1 PublicationVSP_027433Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051479 mRNA. Translation: BAB21783.1. Different initiation.
AK022666 mRNA. Translation: BAB14165.1. Different initiation.
AK027625 mRNA. Translation: BAB55243.1.
AL713656 mRNA. Translation: CAD28465.2.
AC020630 Genomic DNA. No translation available.
AC092944 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78705.1.
CH471052 Genomic DNA. Translation: EAW78706.1.
CH471052 Genomic DNA. Translation: EAW78707.1.
BC042159 mRNA. Translation: AAH42159.1.
BC057999 mRNA. Translation: AAH57999.1.
BC101660 mRNA. Translation: AAI01661.1.
BC111017 mRNA. Translation: AAI11018.1.
BC113555 mRNA. Translation: AAI13556.1.
CCDSiCCDS3179.1. [Q14D04-1]
CCDS54661.1. [Q14D04-3]
CCDS54662.1. [Q14D04-2]
CCDS54663.1. [Q14D04-4]
RefSeqiNP_001161383.1. NM_001167911.1. [Q14D04-2]
NP_001161384.1. NM_001167912.1. [Q14D04-1]
NP_001161387.1. NM_001167915.1. [Q14D04-3]
NP_001161388.1. NM_001167916.1. [Q14D04-3]
NP_001161389.1. NM_001167917.1. [Q14D04-4]
NP_078897.2. NM_024621.2. [Q14D04-1]
UniGeneiHs.658046.

Genome annotation databases

EnsembliENST00000362010; ENSP00000354919; ENSG00000197415. [Q14D04-1]
ENST00000392832; ENSP00000376577; ENSG00000197415. [Q14D04-1]
ENST00000392833; ENSP00000376578; ENSG00000197415. [Q14D04-2]
ENST00000468233; ENSP00000417268; ENSG00000197415. [Q14D04-3]
ENST00000494677; ENSP00000419193; ENSG00000197415. [Q14D04-3]
ENST00000537559; ENSP00000443868; ENSG00000197415. [Q14D04-4]
GeneIDi79674.
KEGGihsa:79674.
UCSCiuc003fbj.3. human. [Q14D04-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051479 mRNA. Translation: BAB21783.1. Different initiation.
AK022666 mRNA. Translation: BAB14165.1. Different initiation.
AK027625 mRNA. Translation: BAB55243.1.
AL713656 mRNA. Translation: CAD28465.2.
AC020630 Genomic DNA. No translation available.
AC092944 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78705.1.
CH471052 Genomic DNA. Translation: EAW78706.1.
CH471052 Genomic DNA. Translation: EAW78707.1.
BC042159 mRNA. Translation: AAH42159.1.
BC057999 mRNA. Translation: AAH57999.1.
BC101660 mRNA. Translation: AAI01661.1.
BC111017 mRNA. Translation: AAI11018.1.
BC113555 mRNA. Translation: AAI13556.1.
CCDSiCCDS3179.1. [Q14D04-1]
CCDS54661.1. [Q14D04-3]
CCDS54662.1. [Q14D04-2]
CCDS54663.1. [Q14D04-4]
RefSeqiNP_001161383.1. NM_001167911.1. [Q14D04-2]
NP_001161384.1. NM_001167912.1. [Q14D04-1]
NP_001161387.1. NM_001167915.1. [Q14D04-3]
NP_001161388.1. NM_001167916.1. [Q14D04-3]
NP_001161389.1. NM_001167917.1. [Q14D04-4]
NP_078897.2. NM_024621.2. [Q14D04-1]
UniGeneiHs.658046.

3D structure databases

ProteinModelPortaliQ14D04.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000354919.

PTM databases

iPTMnetiQ14D04.
PhosphoSiteiQ14D04.

Polymorphism and mutation databases

BioMutaiVEPH1.
DMDMi121946695.

Proteomic databases

MaxQBiQ14D04.
PaxDbiQ14D04.
PeptideAtlasiQ14D04.
PRIDEiQ14D04.
TopDownProteomicsiQ14D04-2. [Q14D04-2]

Protocols and materials databases

DNASUi79674.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000362010; ENSP00000354919; ENSG00000197415. [Q14D04-1]
ENST00000392832; ENSP00000376577; ENSG00000197415. [Q14D04-1]
ENST00000392833; ENSP00000376578; ENSG00000197415. [Q14D04-2]
ENST00000468233; ENSP00000417268; ENSG00000197415. [Q14D04-3]
ENST00000494677; ENSP00000419193; ENSG00000197415. [Q14D04-3]
ENST00000537559; ENSP00000443868; ENSG00000197415. [Q14D04-4]
GeneIDi79674.
KEGGihsa:79674.
UCSCiuc003fbj.3. human. [Q14D04-1]

Organism-specific databases

CTDi79674.
GeneCardsiVEPH1.
HGNCiHGNC:25735. VEPH1.
HPAiHPA026645.
MIMi609594. gene.
neXtProtiNX_Q14D04.
PharmGKBiPA134952229.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3723. Eukaryota.
ENOG410XQXD. LUCA.
GeneTreeiENSGT00390000018660.
HOVERGENiHBG097059.
InParanoidiQ14D04.
OMAiPQPINRH.
OrthoDBiEOG7GBFWC.
PhylomeDBiQ14D04.
TreeFamiTF314736.

Enzyme and pathway databases

SIGNORiQ14D04.

Miscellaneous databases

ChiTaRSiVEPH1. human.
GenomeRNAii79674.
PROiQ14D04.
SOURCEiSearch...

Gene expression databases

BgeeiQ14D04.
ExpressionAtlasiQ14D04. baseline and differential.
GenevisibleiQ14D04. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
SSF50729. SSF50729. 2 hits.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
    DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLY-263.
    Tissue: Brain.
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-522.
    Tissue: Brain, Kidney and Skin.
  7. "Identification and characterization of Veph, a novel gene encoding a PH domain-containing protein expressed in the developing central nervous system of vertebrates."
    Muto E., Tabata Y., Taneda T., Aoki Y., Muto A., Arai K., Watanabe S.
    Biochimie 86:523-531(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  8. "Drosophila Melted modulates FOXO and TOR activity."
    Teleman A.A., Chen Y.-W., Cohen S.M.
    Dev. Cell 9:271-281(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.

Entry informationi

Entry nameiMELT_HUMAN
AccessioniPrimary (citable) accession number: Q14D04
Secondary accession number(s): D3DNL0
, F5GZ91, Q2TAA9, Q3MIX2, Q6PEL3, Q86TL5, Q8TCR3, Q96SP7, Q9C0H1, Q9H9Q7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: August 22, 2006
Last modified: July 6, 2016
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.