Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14CN2

- CLCA4_HUMAN

UniProt

Q14CN2 - CLCA4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Calcium-activated chloride channel regulator 4

Gene

CLCA4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May be involved in mediating calcium-activated chloride conductance.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi155 – 1551ZincBy similarity
Metal bindingi159 – 1591ZincBy similarity
Metal bindingi166 – 1661ZincBy similarity
Sitei697 – 6982Cleavage; by autoproteolysisBy similarity

GO - Molecular functioni

  1. chloride channel activity Source: ProtInc

GO - Biological processi

  1. chloride transmembrane transport Source: GOC
  2. chloride transport Source: GOC
  3. transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Biological processi

Transport

Keywords - Ligandi

Chloride, Metal-binding, Zinc

Protein family/group databases

MEROPSiM87.002.
TCDBi1.A.13.1.2. the epithelial chloride channel (e-clc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-activated chloride channel regulator 4 (EC:3.4.-.-By similarity)
Alternative name(s):
Calcium-activated chloride channel family member 4
Short name:
hCLCA4
Calcium-activated chloride channel protein 2
Short name:
CaCC-2
Short name:
hCaCC-2
Cleaved into the following 2 chains:
Gene namesi
Name:CLCA4
Synonyms:CaCC2
ORF Names:UNQ562/PRO1124
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:2018. CLCA4.

Subcellular locationi

Cell membrane By similarity; Single-pass membrane protein By similarity. Apical cell membrane By similarity. Secreted By similarity
Note: The C-terminus 30 kDa form is anchored to the membrane. The N-terminus 110 kDa form is released from the membrane triggered by an unknown stimulus.By similarity

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

Orphaneti586. Cystic fibrosis.
PharmGKBiPA26545.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini? – 919Calcium-activated chloride channel regulator 4, 30 kDa formPRO_0000345391
Signal peptidei1 – 2121Sequence AnalysisAdd
BLAST
Chaini22 – 919898Calcium-activated chloride channel regulator 4PRO_0000345389Add
BLAST
Chaini22 – ?Calcium-activated chloride channel regulator 4, 110 kDa formPRO_0000345390

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi75 – 751N-linked (GlcNAc...)Sequence Analysis
Glycosylationi340 – 3401N-linked (GlcNAc...)Sequence Analysis
Glycosylationi504 – 5041N-linked (GlcNAc...)Sequence Analysis
Glycosylationi542 – 5421N-linked (GlcNAc...)Sequence Analysis
Glycosylationi588 – 5881N-linked (GlcNAc...)Sequence Analysis
Glycosylationi628 – 6281N-linked (GlcNAc...)Sequence Analysis
Glycosylationi811 – 8111N-linked (GlcNAc...)1 Publication
Glycosylationi832 – 8321N-linked (GlcNAc...)Sequence Analysis
Glycosylationi837 – 8371N-linked (GlcNAc...)Sequence Analysis
Glycosylationi852 – 8521N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

The translation product is autoproteolytically cleaved by the metalloprotease domain in the endoplasmic reticulum into a N-terminal and a C-terminal products that remain physically associated with each other. The cleavage is necessary for calcium-activated chloride channel (CaCC) activation activity.By similarity

Keywords - PTMi

Autocatalytic cleavage, Glycoprotein

Proteomic databases

PaxDbiQ14CN2.
PRIDEiQ14CN2.

Expressioni

Tissue specificityi

Primarily expressed in the digestive tract, mainly in colon. Detected in smaller amounts in brain, urogenital organs, testis, and salivary and mammary glands. Highly expressed in the epithelial layer and submucosal gland of the inferior turbinate mucosa. Lower levels in the epithelial layer of nasal polyp.3 Publications

Inductioni

Down-regulated in oral tongue squamous cell carcinomas.1 Publication

Gene expression databases

BgeeiQ14CN2.
CleanExiHS_CLCA4.
ExpressionAtlasiQ14CN2. baseline and differential.
GenevestigatoriQ14CN2.

Organism-specific databases

HPAiHPA017045.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000359594.

Structurei

3D structure databases

ProteinModelPortaliQ14CN2.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei895 – 91521HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini306 – 476171VWFAPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni45 – 199155Metalloprotease domainBy similarityAdd
BLAST

Domaini

The metalloprotease region is responsible for autoproteolytic processing. It can also cross-cleave other CLCA Substrates.By similarity

Sequence similaritiesi

Belongs to the CLCR family.Curated
Contains 1 VWFA domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG42884.
GeneTreeiENSGT00390000004810.
HOGENOMiHOG000015107.
HOVERGENiHBG005560.
InParanoidiQ14CN2.
KOiK05030.
OMAiPWMNDTV.
OrthoDBiEOG78WKR1.
PhylomeDBiQ14CN2.
TreeFamiTF328396.

Family and domain databases

Gene3Di3.40.50.410. 1 hit.
InterProiIPR004727. CaCC_prot.
IPR013642. Cl_channel_Ca.
IPR015394. DUF1973.
IPR002035. VWF_A.
[Graphical view]
PfamiPF08434. CLCA_N. 1 hit.
PF09315. DUF1973. 1 hit.
[Graphical view]
SMARTiSM00327. VWA. 1 hit.
[Graphical view]
SUPFAMiSSF53300. SSF53300. 1 hit.
TIGRFAMsiTIGR00868. hCaCC. 1 hit.
PROSITEiPS50234. VWFA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q14CN2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLFRGFVFL LVLCLLHQSN TSFIKLNNNG FEDIVIVIDP SVPEDEKIIE
60 70 80 90 100
QIEDMVTTAS TYLFEATEKR FFFKNVSILI PENWKENPQY KRPKHENHKH
110 120 130 140 150
ADVIVAPPTL PGRDEPYTKQ FTECGEKGEY IHFTPDLLLG KKQNEYGPPG
160 170 180 190 200
KLFVHEWAHL RWGVFDEYNE DQPFYRAKSK KIEATRCSAG ISGRNRVYKC
210 220 230 240 250
QGGSCLSRAC RIDSTTKLYG KDCQFFPDKV QTEKASIMFM QSIDSVVEFC
260 270 280 290 300
NEKTHNQEAP SLQNIKCNFR STWEVISNSE DFKNTIPMVT PPPPPVFSLL
310 320 330 340 350
KISQRIVCLV LDKSGSMGGK DRLNRMNQAA KHFLLQTVEN GSWVGMVHFD
360 370 380 390 400
STATIVNKLI QIKSSDERNT LMAGLPTYPL GGTSICSGIK YAFQVIGELH
410 420 430 440 450
SQLDGSEVLL LTDGEDNTAS SCIDEVKQSG AIVHFIALGR AADEAVIEMS
460 470 480 490 500
KITGGSHFYV SDEAQNNGLI DAFGALTSGN TDLSQKSLQL ESKGLTLNSN
510 520 530 540 550
AWMNDTVIID STVGKDTFFL ITWNSLPPSI SLWDPSGTIM ENFTVDATSK
560 570 580 590 600
MAYLSIPGTA KVGTWAYNLQ AKANPETLTI TVTSRAANSS VPPITVNAKM
610 620 630 640 650
NKDVNSFPSP MIVYAEILQG YVPVLGANVT AFIESQNGHT EVLELLDNGA
660 670 680 690 700
GADSFKNDGV YSRYFTAYTE NGRYSLKVRA HGGANTARLK LRPPLNRAAY
710 720 730 740 750
IPGWVVNGEI EANPPRPEID EDTQTTLEDF SRTASGGAFV VSQVPSLPLP
760 770 780 790 800
DQYPPSQITD LDATVHEDKI ILTWTAPGDN FDVGKVQRYI IRISASILDL
810 820 830 840 850
RDSFDDALQV NTTDLSPKEA NSKESFAFKP ENISEENATH IFIAIKSIDK
860 870 880 890 900
SNLTSKVSNI AQVTLFIPQA NPDDIDPTPT PTPTPTPDKS HNSGVNISTL
910
VLSVIGSVVI VNFILSTTI
Length:919
Mass (Da):101,283
Last modified:July 22, 2008 - v2
Checksum:i47C0DF125A319810
GO
Isoform 2 (identifier: Q14CN2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-287: Missing.
     490-524: LESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWN → VRVLIPWVFMFTFATRKNHLVVISFEFHIFLKVNF
     525-919: Missing.

Note: No experimental confirmation available.

Show »
Length:237
Mass (Da):25,849
Checksum:i0B3A1F1D60877BA6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti303 – 3031S → R in AAD48398. (PubMed:10437792)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti43 – 431P → S.
Corresponds to variant rs2231580 [ dbSNP | Ensembl ].
VAR_045816
Natural varianti443 – 4431D → V.
Corresponds to variant rs2839932 [ dbSNP | Ensembl ].
VAR_045817
Natural varianti449 – 4491M → L.
Corresponds to variant rs1011048 [ dbSNP | Ensembl ].
VAR_045818
Natural varianti810 – 8101V → L.1 Publication
Corresponds to variant rs2231604 [ dbSNP | Ensembl ].
VAR_045819
Natural varianti877 – 8782Missing.2 Publications
VAR_045820

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 287287Missing in isoform 2. 1 PublicationVSP_056117Add
BLAST
Alternative sequencei490 – 52435LESKG…LITWN → VRVLIPWVFMFTFATRKNHL VVISFEFHIFLKVNF in isoform 2. 1 PublicationVSP_056118Add
BLAST
Alternative sequencei525 – 919395Missing in isoform 2. 1 PublicationVSP_056119Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF127035 mRNA. Translation: AAD48398.1.
AY358470 mRNA. Translation: AAQ88834.1.
AK293766 mRNA. Translation: BAH11591.1.
AL122002 Genomic DNA. Translation: CAI22170.1.
BC113687 mRNA. Translation: AAI13688.1.
BC113689 mRNA. Translation: AAI13690.1.
CCDSiCCDS41355.1. [Q14CN2-1]
RefSeqiNP_036260.2. NM_012128.3.
UniGeneiHs.567422.

Genome annotation databases

EnsembliENST00000370563; ENSP00000359594; ENSG00000016602. [Q14CN2-1]
GeneIDi22802.
KEGGihsa:22802.
UCSCiuc009wcs.3. human. [Q14CN2-1]

Polymorphism databases

DMDMi205831469.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF127035 mRNA. Translation: AAD48398.1 .
AY358470 mRNA. Translation: AAQ88834.1 .
AK293766 mRNA. Translation: BAH11591.1 .
AL122002 Genomic DNA. Translation: CAI22170.1 .
BC113687 mRNA. Translation: AAI13688.1 .
BC113689 mRNA. Translation: AAI13690.1 .
CCDSi CCDS41355.1. [Q14CN2-1 ]
RefSeqi NP_036260.2. NM_012128.3.
UniGenei Hs.567422.

3D structure databases

ProteinModelPortali Q14CN2.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000359594.

Chemistry

ChEMBLi CHEMBL2364708.

Protein family/group databases

MEROPSi M87.002.
TCDBi 1.A.13.1.2. the epithelial chloride channel (e-clc) family.

Polymorphism databases

DMDMi 205831469.

Proteomic databases

PaxDbi Q14CN2.
PRIDEi Q14CN2.

Protocols and materials databases

DNASUi 22802.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000370563 ; ENSP00000359594 ; ENSG00000016602 . [Q14CN2-1 ]
GeneIDi 22802.
KEGGi hsa:22802.
UCSCi uc009wcs.3. human. [Q14CN2-1 ]

Organism-specific databases

CTDi 22802.
GeneCardsi GC01P087012.
H-InvDB HIX0000752.
HGNCi HGNC:2018. CLCA4.
HPAi HPA017045.
neXtProti NX_Q14CN2.
Orphaneti 586. Cystic fibrosis.
PharmGKBi PA26545.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG42884.
GeneTreei ENSGT00390000004810.
HOGENOMi HOG000015107.
HOVERGENi HBG005560.
InParanoidi Q14CN2.
KOi K05030.
OMAi PWMNDTV.
OrthoDBi EOG78WKR1.
PhylomeDBi Q14CN2.
TreeFami TF328396.

Miscellaneous databases

GeneWikii CLCA4.
GenomeRNAii 22802.
NextBioi 35464810.
PROi Q14CN2.

Gene expression databases

Bgeei Q14CN2.
CleanExi HS_CLCA4.
ExpressionAtlasi Q14CN2. baseline and differential.
Genevestigatori Q14CN2.

Family and domain databases

Gene3Di 3.40.50.410. 1 hit.
InterProi IPR004727. CaCC_prot.
IPR013642. Cl_channel_Ca.
IPR015394. DUF1973.
IPR002035. VWF_A.
[Graphical view ]
Pfami PF08434. CLCA_N. 1 hit.
PF09315. DUF1973. 1 hit.
[Graphical view ]
SMARTi SM00327. VWA. 1 hit.
[Graphical view ]
SUPFAMi SSF53300. SSF53300. 1 hit.
TIGRFAMsi TIGR00868. hCaCC. 1 hit.
PROSITEi PS50234. VWFA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of three novel members of the calcium-dependent chloride channel (CaCC) family predominantly expressed in the digestive tract and trachea."
    Agnel M., Vermat T., Culouscou J.-M.
    FEBS Lett. 455:295-301(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT 877-PRO-THR-878 DEL, TISSUE SPECIFICITY.
    Tissue: Colon.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Cerebellum.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS LEU-810 AND 877-PRO-THR-878 DEL.
  6. "The CLCA gene locus as a modulator of the gastrointestinal basic defect in cystic fibrosis."
    Ritzka M., Stanke F., Jansen S., Gruber A.D., Pusch L., Woelfl S., Veeze H.J., Halley D.J., Tummler B.
    Hum. Genet. 115:483-491(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  7. "Expression and distribution of ion transport mRNAs in human nasal mucosa and nasal polyps."
    Lee S.H., Park J.H., Jung H.H., Lee S.H., Oh J.W., Lee H.M., Jun H.S., Cho W.J., Lee J.Y.
    Acta Oto-Laryngol. 125:745-752(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry."
    Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A.
    J. Proteome Res. 5:1493-1503(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-811.
    Tissue: Saliva.
  9. "Transcriptomic dissection of tongue squamous cell carcinoma."
    Ye H., Yu T., Temam S., Ziober B.L., Wang J., Schwartz J.L., Mao L., Wong D.T., Zhou X.
    BMC Genomics 9:69-69(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.

Entry informationi

Entry nameiCLCA4_HUMAN
AccessioniPrimary (citable) accession number: Q14CN2
Secondary accession number(s): A8MQC9
, B7Z1Q5, Q6UX81, Q9UNF7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: October 29, 2014
This is version 74 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3