Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q14CN2

- CLCA4_HUMAN

UniProt

Q14CN2 - CLCA4_HUMAN

Protein

Calcium-activated chloride channel regulator 4

Gene

CLCA4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 73 (01 Oct 2014)
      Sequence version 2 (22 Jul 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in mediating calcium-activated chloride conductance.

    GO - Molecular functioni

    1. chloride channel activity Source: ProtInc

    GO - Biological processi

    1. chloride transmembrane transport Source: GOC
    2. chloride transport Source: GOC
    3. transport Source: ProtInc

    Keywords - Biological processi

    Transport

    Keywords - Ligandi

    Chloride

    Protein family/group databases

    MEROPSiM87.002.
    TCDBi1.A.13.1.2. the epithelial chloride channel (e-clc) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calcium-activated chloride channel regulator 4
    Alternative name(s):
    Calcium-activated chloride channel family member 4
    Short name:
    hCLCA4
    Calcium-activated chloride channel protein 2
    Short name:
    CaCC-2
    Short name:
    hCaCC-2
    Cleaved into the following 2 chains:
    Gene namesi
    Name:CLCA4
    Synonyms:CaCC2
    ORF Names:UNQ562/PRO1124
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:2018. CLCA4.

    Subcellular locationi

    Cell membrane By similarity; Single-pass membrane protein By similarity. Apical cell membrane By similarity. Secreted By similarity
    Note: The C-terminus 30 kDa form is anchored to the membrane. The N-terminus 110 kDa form is released from the membrane triggered by an unknown stimulus.By similarity

    GO - Cellular componenti

    1. apical plasma membrane Source: UniProtKB-SubCell
    2. extracellular vesicular exosome Source: UniProt
    3. integral component of plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    Orphaneti586. Cystic fibrosis.
    PharmGKBiPA26545.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini? – 919Calcium-activated chloride channel regulator 4, 30 kDa formPRO_0000345391
    Signal peptidei1 – 2121Sequence AnalysisAdd
    BLAST
    Chaini22 – 919898Calcium-activated chloride channel regulator 4PRO_0000345389Add
    BLAST
    Chaini22 – ?Calcium-activated chloride channel regulator 4, 110 kDa formPRO_0000345390

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi75 – 751N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi340 – 3401N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi504 – 5041N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi542 – 5421N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi588 – 5881N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi628 – 6281N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi811 – 8111N-linked (GlcNAc...)1 Publication
    Glycosylationi832 – 8321N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi837 – 8371N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi852 – 8521N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Processed at a monobasic residue to yield a larger N-terminal and a smaller C-terminal cleavage products of 90 to 110 and 30 to 35 kDa, respectively.By similarity

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ14CN2.
    PRIDEiQ14CN2.

    Expressioni

    Tissue specificityi

    Primarily expressed in the digestive tract, mainly in colon. Detected in smaller amounts in brain, urogenital organs, testis, and salivary and mammary glands. Highly expressed in the epithelial layer and submucosal gland of the inferior turbinate mucosa. Lower levels in the epithelial layer of nasal polyp.3 Publications

    Inductioni

    Down-regulated in oral tongue squamous cell carcinomas.1 Publication

    Gene expression databases

    ArrayExpressiQ14CN2.
    BgeeiQ14CN2.
    CleanExiHS_CLCA4.
    GenevestigatoriQ14CN2.

    Organism-specific databases

    HPAiHPA017045.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000359594.

    Structurei

    3D structure databases

    ProteinModelPortaliQ14CN2.
    SMRiQ14CN2. Positions 303-439.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei895 – 91521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini306 – 476171VWFAPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the CLCR family.Curated
    Contains 1 VWFA domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG42884.
    HOGENOMiHOG000015107.
    HOVERGENiHBG005560.
    KOiK05030.
    OMAiPWMNDTV.
    OrthoDBiEOG78WKR1.
    PhylomeDBiQ14CN2.
    TreeFamiTF328396.

    Family and domain databases

    Gene3Di3.40.50.410. 1 hit.
    InterProiIPR004727. CaCC_prot.
    IPR013642. Cl_channel_Ca.
    IPR015394. DUF1973.
    IPR002035. VWF_A.
    [Graphical view]
    PfamiPF08434. CLCA_N. 1 hit.
    PF09315. DUF1973. 1 hit.
    [Graphical view]
    SMARTiSM00327. VWA. 1 hit.
    [Graphical view]
    SUPFAMiSSF53300. SSF53300. 1 hit.
    TIGRFAMsiTIGR00868. hCaCC. 1 hit.
    PROSITEiPS50234. VWFA. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q14CN2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGLFRGFVFL LVLCLLHQSN TSFIKLNNNG FEDIVIVIDP SVPEDEKIIE    50
    QIEDMVTTAS TYLFEATEKR FFFKNVSILI PENWKENPQY KRPKHENHKH 100
    ADVIVAPPTL PGRDEPYTKQ FTECGEKGEY IHFTPDLLLG KKQNEYGPPG 150
    KLFVHEWAHL RWGVFDEYNE DQPFYRAKSK KIEATRCSAG ISGRNRVYKC 200
    QGGSCLSRAC RIDSTTKLYG KDCQFFPDKV QTEKASIMFM QSIDSVVEFC 250
    NEKTHNQEAP SLQNIKCNFR STWEVISNSE DFKNTIPMVT PPPPPVFSLL 300
    KISQRIVCLV LDKSGSMGGK DRLNRMNQAA KHFLLQTVEN GSWVGMVHFD 350
    STATIVNKLI QIKSSDERNT LMAGLPTYPL GGTSICSGIK YAFQVIGELH 400
    SQLDGSEVLL LTDGEDNTAS SCIDEVKQSG AIVHFIALGR AADEAVIEMS 450
    KITGGSHFYV SDEAQNNGLI DAFGALTSGN TDLSQKSLQL ESKGLTLNSN 500
    AWMNDTVIID STVGKDTFFL ITWNSLPPSI SLWDPSGTIM ENFTVDATSK 550
    MAYLSIPGTA KVGTWAYNLQ AKANPETLTI TVTSRAANSS VPPITVNAKM 600
    NKDVNSFPSP MIVYAEILQG YVPVLGANVT AFIESQNGHT EVLELLDNGA 650
    GADSFKNDGV YSRYFTAYTE NGRYSLKVRA HGGANTARLK LRPPLNRAAY 700
    IPGWVVNGEI EANPPRPEID EDTQTTLEDF SRTASGGAFV VSQVPSLPLP 750
    DQYPPSQITD LDATVHEDKI ILTWTAPGDN FDVGKVQRYI IRISASILDL 800
    RDSFDDALQV NTTDLSPKEA NSKESFAFKP ENISEENATH IFIAIKSIDK 850
    SNLTSKVSNI AQVTLFIPQA NPDDIDPTPT PTPTPTPDKS HNSGVNISTL 900
    VLSVIGSVVI VNFILSTTI 919
    Length:919
    Mass (Da):101,283
    Last modified:July 22, 2008 - v2
    Checksum:i47C0DF125A319810
    GO
    Isoform 2 (identifier: Q14CN2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-287: Missing.
         490-524: LESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWN → VRVLIPWVFMFTFATRKNHLVVISFEFHIFLKVNF
         525-919: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:237
    Mass (Da):25,849
    Checksum:i0B3A1F1D60877BA6
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti303 – 3031S → R in AAD48398. (PubMed:10437792)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti43 – 431P → S.
    Corresponds to variant rs2231580 [ dbSNP | Ensembl ].
    VAR_045816
    Natural varianti443 – 4431D → V.
    Corresponds to variant rs2839932 [ dbSNP | Ensembl ].
    VAR_045817
    Natural varianti449 – 4491M → L.
    Corresponds to variant rs1011048 [ dbSNP | Ensembl ].
    VAR_045818
    Natural varianti810 – 8101V → L.1 Publication
    Corresponds to variant rs2231604 [ dbSNP | Ensembl ].
    VAR_045819
    Natural varianti877 – 8782Missing.1 Publication
    VAR_045820

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 287287Missing in isoform 2. 1 PublicationVSP_056117Add
    BLAST
    Alternative sequencei490 – 52435LESKG…LITWN → VRVLIPWVFMFTFATRKNHL VVISFEFHIFLKVNF in isoform 2. 1 PublicationVSP_056118Add
    BLAST
    Alternative sequencei525 – 919395Missing in isoform 2. 1 PublicationVSP_056119Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF127035 mRNA. Translation: AAD48398.1.
    AY358470 mRNA. Translation: AAQ88834.1.
    AK293766 mRNA. Translation: BAH11591.1.
    AL122002 Genomic DNA. Translation: CAI22170.1.
    BC113687 mRNA. Translation: AAI13688.1.
    BC113689 mRNA. Translation: AAI13690.1.
    CCDSiCCDS41355.1.
    RefSeqiNP_036260.2. NM_012128.3.
    UniGeneiHs.567422.

    Genome annotation databases

    EnsembliENST00000263723; ENSP00000263723; ENSG00000016602.
    ENST00000370563; ENSP00000359594; ENSG00000016602.
    GeneIDi22802.
    KEGGihsa:22802.
    UCSCiuc009wcs.3. human.

    Polymorphism databases

    DMDMi205831469.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF127035 mRNA. Translation: AAD48398.1 .
    AY358470 mRNA. Translation: AAQ88834.1 .
    AK293766 mRNA. Translation: BAH11591.1 .
    AL122002 Genomic DNA. Translation: CAI22170.1 .
    BC113687 mRNA. Translation: AAI13688.1 .
    BC113689 mRNA. Translation: AAI13690.1 .
    CCDSi CCDS41355.1.
    RefSeqi NP_036260.2. NM_012128.3.
    UniGenei Hs.567422.

    3D structure databases

    ProteinModelPortali Q14CN2.
    SMRi Q14CN2. Positions 303-439.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000359594.

    Chemistry

    ChEMBLi CHEMBL2364708.

    Protein family/group databases

    MEROPSi M87.002.
    TCDBi 1.A.13.1.2. the epithelial chloride channel (e-clc) family.

    Polymorphism databases

    DMDMi 205831469.

    Proteomic databases

    PaxDbi Q14CN2.
    PRIDEi Q14CN2.

    Protocols and materials databases

    DNASUi 22802.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263723 ; ENSP00000263723 ; ENSG00000016602 .
    ENST00000370563 ; ENSP00000359594 ; ENSG00000016602 .
    GeneIDi 22802.
    KEGGi hsa:22802.
    UCSCi uc009wcs.3. human.

    Organism-specific databases

    CTDi 22802.
    GeneCardsi GC01P087012.
    H-InvDB HIX0000752.
    HGNCi HGNC:2018. CLCA4.
    HPAi HPA017045.
    neXtProti NX_Q14CN2.
    Orphaneti 586. Cystic fibrosis.
    PharmGKBi PA26545.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG42884.
    HOGENOMi HOG000015107.
    HOVERGENi HBG005560.
    KOi K05030.
    OMAi PWMNDTV.
    OrthoDBi EOG78WKR1.
    PhylomeDBi Q14CN2.
    TreeFami TF328396.

    Miscellaneous databases

    GeneWikii CLCA4.
    GenomeRNAii 22802.
    NextBioi 43156.
    PROi Q14CN2.

    Gene expression databases

    ArrayExpressi Q14CN2.
    Bgeei Q14CN2.
    CleanExi HS_CLCA4.
    Genevestigatori Q14CN2.

    Family and domain databases

    Gene3Di 3.40.50.410. 1 hit.
    InterProi IPR004727. CaCC_prot.
    IPR013642. Cl_channel_Ca.
    IPR015394. DUF1973.
    IPR002035. VWF_A.
    [Graphical view ]
    Pfami PF08434. CLCA_N. 1 hit.
    PF09315. DUF1973. 1 hit.
    [Graphical view ]
    SMARTi SM00327. VWA. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53300. SSF53300. 1 hit.
    TIGRFAMsi TIGR00868. hCaCC. 1 hit.
    PROSITEi PS50234. VWFA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of three novel members of the calcium-dependent chloride channel (CaCC) family predominantly expressed in the digestive tract and trachea."
      Agnel M., Vermat T., Culouscou J.-M.
      FEBS Lett. 455:295-301(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT 877-PRO-THR-878 DEL, TISSUE SPECIFICITY.
      Tissue: Colon.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Cerebellum.
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS LEU-810 AND 877-PRO-THR-878 DEL.
    6. "The CLCA gene locus as a modulator of the gastrointestinal basic defect in cystic fibrosis."
      Ritzka M., Stanke F., Jansen S., Gruber A.D., Pusch L., Woelfl S., Veeze H.J., Halley D.J., Tummler B.
      Hum. Genet. 115:483-491(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    7. "Expression and distribution of ion transport mRNAs in human nasal mucosa and nasal polyps."
      Lee S.H., Park J.H., Jung H.H., Lee S.H., Oh J.W., Lee H.M., Jun H.S., Cho W.J., Lee J.Y.
      Acta Oto-Laryngol. 125:745-752(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    8. "Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry."
      Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A.
      J. Proteome Res. 5:1493-1503(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-811.
      Tissue: Saliva.
    9. "Transcriptomic dissection of tongue squamous cell carcinoma."
      Ye H., Yu T., Temam S., Ziober B.L., Wang J., Schwartz J.L., Mao L., Wong D.T., Zhou X.
      BMC Genomics 9:69-69(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.

    Entry informationi

    Entry nameiCLCA4_HUMAN
    AccessioniPrimary (citable) accession number: Q14CN2
    Secondary accession number(s): A8MQC9
    , B7Z1Q5, Q6UX81, Q9UNF7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 22, 2008
    Last sequence update: July 22, 2008
    Last modified: October 1, 2014
    This is version 73 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3