Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q14BN4

- SLMAP_HUMAN

UniProt

Q14BN4 - SLMAP_HUMAN

Protein

Sarcolemmal membrane-associated protein

Gene

SLMAP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 77 (01 Oct 2014)
      Sequence version 1 (22 Aug 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role during myoblast fusion.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. muscle contraction Source: ProtInc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sarcolemmal membrane-associated protein
    Short name:
    Sarcolemmal-associated protein
    Gene namesi
    Name:SLMAP
    Synonyms:KIAA1601, SLAP
    ORF Names:UNQ1847/PRO3577
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:16643. SLMAP.

    Subcellular locationi

    Cell membranesarcolemma By similarity; Single-pass type IV membrane protein By similarity. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome By similarity
    Note: Membrane-associated. Distributed in the transverse tubules and near the junctional sarcoplasmic reticulum. Detected along the Z- and M-lines in cardiomyocytes. Centrosome. Localizes to the centrosomes in a microtubule- dependent manner By similarity.By similarity

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. microtubule organizing center Source: UniProtKB-SubCell
    3. sarcolemma Source: UniProtKB-SubCell
    4. smooth endoplasmic reticulum Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Cytoskeleton, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38179.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 828828Sarcolemmal membrane-associated proteinPRO_0000259662Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei452 – 4521Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ14BN4.
    PaxDbiQ14BN4.
    PRIDEiQ14BN4.

    PTM databases

    PhosphoSiteiQ14BN4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ14BN4.
    BgeeiQ14BN4.
    GenevestigatoriQ14BN4.

    Organism-specific databases

    HPAiHPA002357.
    HPA002358.

    Interactioni

    Subunit structurei

    Homodimer. Interacts with myosin By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    OPTNQ96CV92EBI-1043216,EBI-748974
    STK3Q131883EBI-1043216,EBI-992580
    STK4Q130436EBI-1043216,EBI-367376

    Protein-protein interaction databases

    BioGridi113620. 35 interactions.
    IntActiQ14BN4. 45 interactions.
    MINTiMINT-7006290.

    Structurei

    3D structure databases

    ProteinModelPortaliQ14BN4.
    SMRiQ14BN4. Positions 60-85.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 802802CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini824 – 8285ExtracellularSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei803 – 82321Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini28 – 8558FHAPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 163163Necessary for targeting to centrosomesBy similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili167 – 20236Sequence AnalysisAdd
    BLAST
    Coiled coili230 – 388159Sequence AnalysisAdd
    BLAST
    Coiled coili477 – 799323Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the SLMAP family.Curated
    Contains 1 FHA domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1716.
    HOVERGENiHBG082442.
    OMAiCQKKLIV.
    OrthoDBiEOG7V1FQD.
    PhylomeDBiQ14BN4.
    TreeFamiTF318787.

    Family and domain databases

    Gene3Di2.60.200.20. 1 hit.
    InterProiIPR000253. FHA_dom.
    IPR008984. SMAD_FHA_domain.
    [Graphical view]
    PfamiPF00498. FHA. 1 hit.
    [Graphical view]
    SMARTiSM00240. FHA. 1 hit.
    [Graphical view]
    SUPFAMiSSF49879. SSF49879. 1 hit.
    PROSITEiPS50006. FHA_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q14BN4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPSALAIFTC RPNSHPFQER HVYLDEPIKI GRSVARCRPA QNNATFDCKV    50
    LSRNHALVWF DHKTGKFYLQ DTKSSNGTFI NSQRLSRGSE ESPPCEILSG 100
    DIIQFGVDVT ENTRKVTHGC IVSTIKLFLP DGMEARLRSD VIHAPLPSPV 150
    DKVAANTPSM YSQELFQLSQ YLQEALHREQ MLEQKLATLQ RLLAITQEAS 200
    DTSWQALIDE DRLLSRLEVM GNQLQACSKN QTEDSLRKEL IALQEDKHNY 250
    ETTAKESLRR VLQEKIEVVR KLSEVERSLS NTEDECTHLK EMNERTQEEL 300
    RELANKYNGA VNEIKDLSDK LKVAEGKQEE IQQKGQAEKK ELQHKIDEME 350
    EKEQELQAKI EALQADNDFT NERLTALQVR LEHLQEKTLK ECSSLEHLLS 400
    KSGGDCTFIH QFIECQKKLI VEGHLTKAVE ETKLSKENQT RAKESDFSDT 450
    LSPSKEKSSD DTTDAQMDEQ DLNEPLAKVS LLKDDLQGAQ SEIEAKQEIQ 500
    HLRKELIEAQ ELARTSKQKC FELQALLEEE RKAYRNQVEE STKQIQVLQA 550
    QLQRLHIDTE NLREEKDSEI TSTRDELLSA RDEILLLHQA AAKVASERDT 600
    DIASLQEELK KVRAELERWR KAASEYEKEI TSLQNSFQLR CQQCEDQQRE 650
    EATRLQGELE KLRKEWNALE TECHSLKREN VLLSSELQRQ EKELHNSQKQ 700
    SLELTSDLSI LQMSRKELEN QVGSLKEQHL RDSADLKTLL SKAENQAKDV 750
    QKEYEKTQTV LSELKLKFEM TEQEKQSITD ELKQCKNNLK LLREKGNNKP 800
    WPWMPMLAAL VAVTAIVLYV PGLARASP 828
    Length:828
    Mass (Da):95,198
    Last modified:August 22, 2006 - v1
    Checksum:i20F5FA38174CA383
    GO
    Isoform 2 (identifier: Q14BN4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         379-417: VRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQK → E

    Show »
    Length:790
    Mass (Da):90,829
    Checksum:i2A5F92ECEF240518
    GO
    Isoform 3 (identifier: Q14BN4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         379-395: Missing.

    Note: Incomplete sequence.

    Show »
    Length:811
    Mass (Da):93,203
    Checksum:i17BCE2C5B6243F6C
    GO
    Isoform 4 (identifier: Q14BN4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-348: Missing.
         379-436: Missing.
         798-798: N → NPSILQPVPARIHRPIPGFPDMVIRSIVERK

    Show »
    Length:452
    Mass (Da):52,228
    Checksum:i28B281416FD23FCD
    GO
    Isoform 5 (identifier: Q14BN4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-466: Missing.
         799-828: KPWPWMPMLAALVAVTAIVLYVPGLARASP → PSILQPVPAVFIGLFLAFLFWCFGPLW

    Show »
    Length:359
    Mass (Da):41,896
    Checksum:iDAEFBF630F5C6443
    GO
    Isoform 6 (identifier: Q14BN4-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         396-417: EHLLSKSGGDCTFIHQFIECQK → GIQVDDFLPKINGSTEKE
         484-510: DDLQGAQSEIEAKQEIQHLRKELIEAQ → GTLTCFYDIVNQGIKSPFAIKSVLDIM
         511-828: Missing.

    Show »
    Length:506
    Mass (Da):57,531
    Checksum:i2A77ABF7E61C8418
    GO
    Isoform 7 (identifier: Q14BN4-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         396-428: EHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKA → ADRRRASNQSGRRNKAFKRFVFCFSMFFDSSFG
         429-828: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:428
    Mass (Da):49,177
    Checksum:i103B2A7E6103D7DF
    GO
    Isoform 8 (identifier: Q14BN4-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-466: Missing.
         484-524: Missing.
         754-778: YEKTQTVLSELKLKFEMTEQEKQSI → VKRKDIMSPIMVGLKAKSKSDIHAS
         779-828: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:271
    Mass (Da):31,437
    Checksum:i84CA2BC512502DF9
    GO

    Sequence cautioni

    The sequence AAQ88776.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAH10369.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti493 – 4931I → T in AAG41949. (PubMed:10986292)Curated
    Sequence conflicti515 – 5151T → A in AAG41949. (PubMed:10986292)Curated
    Sequence conflicti812 – 8121A → Q in AAD43014. (PubMed:11042152)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 466466Missing in isoform 5 and isoform 8. 2 PublicationsVSP_021499Add
    BLAST
    Alternative sequencei1 – 348348Missing in isoform 4. 1 PublicationVSP_021500Add
    BLAST
    Alternative sequencei379 – 43658Missing in isoform 4. 1 PublicationVSP_021501Add
    BLAST
    Alternative sequencei379 – 41739VRLEH…IECQK → E in isoform 2. 1 PublicationVSP_021502Add
    BLAST
    Alternative sequencei379 – 39517Missing in isoform 3. 1 PublicationVSP_021503Add
    BLAST
    Alternative sequencei396 – 42833EHLLS…HLTKA → ADRRRASNQSGRRNKAFKRF VFCFSMFFDSSFG in isoform 7. 1 PublicationVSP_021504Add
    BLAST
    Alternative sequencei396 – 41722EHLLS…IECQK → GIQVDDFLPKINGSTEKE in isoform 6. 1 PublicationVSP_021505Add
    BLAST
    Alternative sequencei429 – 828400Missing in isoform 7. 1 PublicationVSP_021506Add
    BLAST
    Alternative sequencei484 – 52441Missing in isoform 8. 1 PublicationVSP_021507Add
    BLAST
    Alternative sequencei484 – 51027DDLQG…LIEAQ → GTLTCFYDIVNQGIKSPFAI KSVLDIM in isoform 6. 1 PublicationVSP_021508Add
    BLAST
    Alternative sequencei511 – 828318Missing in isoform 6. 1 PublicationVSP_021509Add
    BLAST
    Alternative sequencei754 – 77825YEKTQ…EKQSI → VKRKDIMSPIMVGLKAKSKS DIHAS in isoform 8. 1 PublicationVSP_021510Add
    BLAST
    Alternative sequencei779 – 82850Missing in isoform 8. 1 PublicationVSP_021511Add
    BLAST
    Alternative sequencei798 – 7981N → NPSILQPVPARIHRPIPGFP DMVIRSIVERK in isoform 4. 1 PublicationVSP_021512
    Alternative sequencei799 – 82830KPWPW…ARASP → PSILQPVPAVFIGLFLAFLF WCFGPLW in isoform 5. 1 PublicationVSP_021513Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF304450 mRNA. Translation: AAG41949.1.
    AF100750 mRNA. Translation: AAD43014.1.
    AY358410 mRNA. Translation: AAQ88776.1. Different initiation.
    AK124200 mRNA. Translation: BAC85803.1.
    AL834538 mRNA. Translation: CAD39194.1.
    CR627321 mRNA. Translation: CAH10369.1. Different initiation.
    BC114627 mRNA. Translation: AAI14628.1.
    BC115701 mRNA. Translation: AAI15702.1.
    AB046821 mRNA. Translation: BAB13427.1.
    CCDSiCCDS33774.1. [Q14BN4-3]
    RefSeqiNP_009090.2. NM_007159.2. [Q14BN4-3]
    XP_005265518.1. XM_005265461.2. [Q14BN4-1]
    XP_005265523.1. XM_005265466.2. [Q14BN4-3]
    XP_005265528.1. XM_005265471.2. [Q14BN4-2]
    UniGeneiHs.476432.

    Genome annotation databases

    EnsembliENST00000295951; ENSP00000295951; ENSG00000163681. [Q14BN4-3]
    ENST00000295952; ENSP00000295952; ENSG00000163681. [Q14BN4-3]
    ENST00000383718; ENSP00000373224; ENSG00000163681. [Q14BN4-6]
    ENST00000428312; ENSP00000398661; ENSG00000163681. [Q14BN4-1]
    ENST00000449503; ENSP00000412945; ENSG00000163681. [Q14BN4-2]
    GeneIDi7871.
    KEGGihsa:7871.
    UCSCiuc003djc.1. human. [Q14BN4-6]
    uc003djd.1. human. [Q14BN4-3]
    uc003dje.1. human. [Q14BN4-1]
    uc003djf.1. human. [Q14BN4-2]
    uc003djh.3. human. [Q14BN4-8]
    uc003dji.1. human. [Q14BN4-5]

    Polymorphism databases

    DMDMi118597508.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF304450 mRNA. Translation: AAG41949.1 .
    AF100750 mRNA. Translation: AAD43014.1 .
    AY358410 mRNA. Translation: AAQ88776.1 . Different initiation.
    AK124200 mRNA. Translation: BAC85803.1 .
    AL834538 mRNA. Translation: CAD39194.1 .
    CR627321 mRNA. Translation: CAH10369.1 . Different initiation.
    BC114627 mRNA. Translation: AAI14628.1 .
    BC115701 mRNA. Translation: AAI15702.1 .
    AB046821 mRNA. Translation: BAB13427.1 .
    CCDSi CCDS33774.1. [Q14BN4-3 ]
    RefSeqi NP_009090.2. NM_007159.2. [Q14BN4-3 ]
    XP_005265518.1. XM_005265461.2. [Q14BN4-1 ]
    XP_005265523.1. XM_005265466.2. [Q14BN4-3 ]
    XP_005265528.1. XM_005265471.2. [Q14BN4-2 ]
    UniGenei Hs.476432.

    3D structure databases

    ProteinModelPortali Q14BN4.
    SMRi Q14BN4. Positions 60-85.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113620. 35 interactions.
    IntActi Q14BN4. 45 interactions.
    MINTi MINT-7006290.

    PTM databases

    PhosphoSitei Q14BN4.

    Polymorphism databases

    DMDMi 118597508.

    Proteomic databases

    MaxQBi Q14BN4.
    PaxDbi Q14BN4.
    PRIDEi Q14BN4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000295951 ; ENSP00000295951 ; ENSG00000163681 . [Q14BN4-3 ]
    ENST00000295952 ; ENSP00000295952 ; ENSG00000163681 . [Q14BN4-3 ]
    ENST00000383718 ; ENSP00000373224 ; ENSG00000163681 . [Q14BN4-6 ]
    ENST00000428312 ; ENSP00000398661 ; ENSG00000163681 . [Q14BN4-1 ]
    ENST00000449503 ; ENSP00000412945 ; ENSG00000163681 . [Q14BN4-2 ]
    GeneIDi 7871.
    KEGGi hsa:7871.
    UCSCi uc003djc.1. human. [Q14BN4-6 ]
    uc003djd.1. human. [Q14BN4-3 ]
    uc003dje.1. human. [Q14BN4-1 ]
    uc003djf.1. human. [Q14BN4-2 ]
    uc003djh.3. human. [Q14BN4-8 ]
    uc003dji.1. human. [Q14BN4-5 ]

    Organism-specific databases

    CTDi 7871.
    GeneCardsi GC03P057802.
    H-InvDB HIX0003396.
    HGNCi HGNC:16643. SLMAP.
    HPAi HPA002357.
    HPA002358.
    MIMi 602701. gene.
    neXtProti NX_Q14BN4.
    PharmGKBi PA38179.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1716.
    HOVERGENi HBG082442.
    OMAi CQKKLIV.
    OrthoDBi EOG7V1FQD.
    PhylomeDBi Q14BN4.
    TreeFami TF318787.

    Miscellaneous databases

    ChiTaRSi SLMAP. human.
    GeneWikii SLMAP.
    GenomeRNAii 7871.
    NextBioi 30324.
    PROi Q14BN4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q14BN4.
    Bgeei Q14BN4.
    Genevestigatori Q14BN4.

    Family and domain databases

    Gene3Di 2.60.200.20. 1 hit.
    InterProi IPR000253. FHA_dom.
    IPR008984. SMAD_FHA_domain.
    [Graphical view ]
    Pfami PF00498. FHA. 1 hit.
    [Graphical view ]
    SMARTi SM00240. FHA. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49879. SSF49879. 1 hit.
    PROSITEi PS50006. FHA_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Alternative splicing, expression, and genomic structure of the 3' region of the gene encoding the sarcolemmal-associated proteins (SLAPs) defines a novel class of coiled-coil tail-anchored membrane proteins."
      Wielowieyski P.A., Sevinc S., Guzzo R., Salih M., Wigle J.T., Tuana B.S.
      J. Biol. Chem. 275:38474-38481(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING.
      Tissue: Heart.
    2. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
      Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
      , Gu J., Chen S.-J., Chen Z.
      Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Umbilical cord blood.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
      Tissue: Thymus.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 528-828.
      Tissue: Fetal liver and Uterus.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    7. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
      DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 122-828 (ISOFORM 3).
      Tissue: Brain.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSLMAP_HUMAN
    AccessioniPrimary (citable) accession number: Q14BN4
    Secondary accession number(s): Q14C95
    , Q6AI54, Q6UXC9, Q6ZVQ8, Q8NCW9, Q9H297, Q9HCH1, Q9Y681
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: August 22, 2006
    Last modified: October 1, 2014
    This is version 77 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3