Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcolemmal membrane-associated protein

Gene

SLMAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role during myoblast fusion.By similarity

GO - Biological processi

  • muscle contraction Source: ProtInc
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcolemmal membrane-associated protein
Short name:
Sarcolemmal-associated protein
Gene namesi
Name:SLMAP
Synonyms:KIAA1601, SLAP
ORF Names:UNQ1847/PRO3577
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:16643. SLMAP.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 802CytoplasmicSequence analysisAdd BLAST802
Transmembranei803 – 823Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini824 – 828ExtracellularSequence analysis5

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • microtubule organizing center Source: UniProtKB-SubCell
  • sarcolemma Source: UniProtKB-SubCell
  • smooth endoplasmic reticulum Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi7871.
MalaCardsiSLMAP.
OpenTargetsiENSG00000163681.
Orphaneti130. Brugada syndrome.
PharmGKBiPA38179.

Polymorphism and mutation databases

BioMutaiSLMAP.
DMDMi118597508.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002596621 – 828Sarcolemmal membrane-associated proteinAdd BLAST828

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei148PhosphoserineCombined sources1
Modified residuei448PhosphoserineBy similarity1
Modified residuei452PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ14BN4.
MaxQBiQ14BN4.
PaxDbiQ14BN4.
PeptideAtlasiQ14BN4.
PRIDEiQ14BN4.

PTM databases

iPTMnetiQ14BN4.
PhosphoSitePlusiQ14BN4.

Expressioni

Gene expression databases

BgeeiENSG00000163681.
ExpressionAtlasiQ14BN4. baseline and differential.
GenevisibleiQ14BN4. HS.

Organism-specific databases

HPAiHPA002357.
HPA002358.

Interactioni

Subunit structurei

Homodimer. Interacts with myosin (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
OPTNQ96CV92EBI-1043216,EBI-748974
STK3Q131886EBI-1043216,EBI-992580
STK4Q130437EBI-1043216,EBI-367376

Protein-protein interaction databases

BioGridi113620. 65 interactors.
IntActiQ14BN4. 49 interactors.
MINTiMINT-7006290.
STRINGi9606.ENSP00000295951.

Structurei

3D structure databases

ProteinModelPortaliQ14BN4.
SMRiQ14BN4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini28 – 85FHAPROSITE-ProRule annotationAdd BLAST58

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 163Necessary for targeting to centrosomesBy similarityAdd BLAST163

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili167 – 202Sequence analysisAdd BLAST36
Coiled coili230 – 388Sequence analysisAdd BLAST159
Coiled coili477 – 799Sequence analysisAdd BLAST323

Sequence similaritiesi

Belongs to the SLMAP family.Curated
Contains 1 FHA domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3872. Eukaryota.
COG1716. LUCA.
GeneTreeiENSGT00530000063197.
HOVERGENiHBG082442.
InParanoidiQ14BN4.
OMAiFIECQQK.
OrthoDBiEOG091G081W.
PhylomeDBiQ14BN4.
TreeFamiTF318787.

Family and domain databases

Gene3Di2.60.200.20. 1 hit.
InterProiIPR000253. FHA_dom.
IPR030498. SLMAP.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR15715:SF22. PTHR15715:SF22. 1 hit.
PfamiPF00498. FHA. 1 hit.
[Graphical view]
SMARTiSM00240. FHA. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14BN4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSALAIFTC RPNSHPFQER HVYLDEPIKI GRSVARCRPA QNNATFDCKV
60 70 80 90 100
LSRNHALVWF DHKTGKFYLQ DTKSSNGTFI NSQRLSRGSE ESPPCEILSG
110 120 130 140 150
DIIQFGVDVT ENTRKVTHGC IVSTIKLFLP DGMEARLRSD VIHAPLPSPV
160 170 180 190 200
DKVAANTPSM YSQELFQLSQ YLQEALHREQ MLEQKLATLQ RLLAITQEAS
210 220 230 240 250
DTSWQALIDE DRLLSRLEVM GNQLQACSKN QTEDSLRKEL IALQEDKHNY
260 270 280 290 300
ETTAKESLRR VLQEKIEVVR KLSEVERSLS NTEDECTHLK EMNERTQEEL
310 320 330 340 350
RELANKYNGA VNEIKDLSDK LKVAEGKQEE IQQKGQAEKK ELQHKIDEME
360 370 380 390 400
EKEQELQAKI EALQADNDFT NERLTALQVR LEHLQEKTLK ECSSLEHLLS
410 420 430 440 450
KSGGDCTFIH QFIECQKKLI VEGHLTKAVE ETKLSKENQT RAKESDFSDT
460 470 480 490 500
LSPSKEKSSD DTTDAQMDEQ DLNEPLAKVS LLKDDLQGAQ SEIEAKQEIQ
510 520 530 540 550
HLRKELIEAQ ELARTSKQKC FELQALLEEE RKAYRNQVEE STKQIQVLQA
560 570 580 590 600
QLQRLHIDTE NLREEKDSEI TSTRDELLSA RDEILLLHQA AAKVASERDT
610 620 630 640 650
DIASLQEELK KVRAELERWR KAASEYEKEI TSLQNSFQLR CQQCEDQQRE
660 670 680 690 700
EATRLQGELE KLRKEWNALE TECHSLKREN VLLSSELQRQ EKELHNSQKQ
710 720 730 740 750
SLELTSDLSI LQMSRKELEN QVGSLKEQHL RDSADLKTLL SKAENQAKDV
760 770 780 790 800
QKEYEKTQTV LSELKLKFEM TEQEKQSITD ELKQCKNNLK LLREKGNNKP
810 820
WPWMPMLAAL VAVTAIVLYV PGLARASP
Length:828
Mass (Da):95,198
Last modified:August 22, 2006 - v1
Checksum:i20F5FA38174CA383
GO
Isoform 2 (identifier: Q14BN4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-417: VRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQK → E

Show »
Length:790
Mass (Da):90,829
Checksum:i2A5F92ECEF240518
GO
Isoform 3 (identifier: Q14BN4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-395: Missing.

Note: Incomplete sequence.
Show »
Length:811
Mass (Da):93,203
Checksum:i17BCE2C5B6243F6C
GO
Isoform 4 (identifier: Q14BN4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-348: Missing.
     379-436: Missing.
     798-798: N → NPSILQPVPARIHRPIPGFPDMVIRSIVERK

Show »
Length:452
Mass (Da):52,228
Checksum:i28B281416FD23FCD
GO
Isoform 5 (identifier: Q14BN4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     799-828: KPWPWMPMLAALVAVTAIVLYVPGLARASP → PSILQPVPAVFIGLFLAFLFWCFGPLW

Show »
Length:359
Mass (Da):41,896
Checksum:iDAEFBF630F5C6443
GO
Isoform 6 (identifier: Q14BN4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-417: EHLLSKSGGDCTFIHQFIECQK → GIQVDDFLPKINGSTEKE
     484-510: DDLQGAQSEIEAKQEIQHLRKELIEAQ → GTLTCFYDIVNQGIKSPFAIKSVLDIM
     511-828: Missing.

Show »
Length:506
Mass (Da):57,531
Checksum:i2A77ABF7E61C8418
GO
Isoform 7 (identifier: Q14BN4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-428: EHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKA → ADRRRASNQSGRRNKAFKRFVFCFSMFFDSSFG
     429-828: Missing.

Note: No experimental confirmation available.
Show »
Length:428
Mass (Da):49,177
Checksum:i103B2A7E6103D7DF
GO
Isoform 8 (identifier: Q14BN4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     484-524: Missing.
     754-778: YEKTQTVLSELKLKFEMTEQEKQSI → VKRKDIMSPIMVGLKAKSKSDIHAS
     779-828: Missing.

Note: No experimental confirmation available.
Show »
Length:271
Mass (Da):31,437
Checksum:i84CA2BC512502DF9
GO

Sequence cautioni

The sequence AAQ88776 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAH10369 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti493I → T in AAG41949 (PubMed:10986292).Curated1
Sequence conflicti515T → A in AAG41949 (PubMed:10986292).Curated1
Sequence conflicti812A → Q in AAD43014 (PubMed:11042152).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0214991 – 466Missing in isoform 5 and isoform 8. 2 PublicationsAdd BLAST466
Alternative sequenceiVSP_0215001 – 348Missing in isoform 4. 1 PublicationAdd BLAST348
Alternative sequenceiVSP_021501379 – 436Missing in isoform 4. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_021502379 – 417VRLEH…IECQK → E in isoform 2. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_021503379 – 395Missing in isoform 3. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_021504396 – 428EHLLS…HLTKA → ADRRRASNQSGRRNKAFKRF VFCFSMFFDSSFG in isoform 7. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_021505396 – 417EHLLS…IECQK → GIQVDDFLPKINGSTEKE in isoform 6. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_021506429 – 828Missing in isoform 7. 1 PublicationAdd BLAST400
Alternative sequenceiVSP_021507484 – 524Missing in isoform 8. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_021508484 – 510DDLQG…LIEAQ → GTLTCFYDIVNQGIKSPFAI KSVLDIM in isoform 6. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_021509511 – 828Missing in isoform 6. 1 PublicationAdd BLAST318
Alternative sequenceiVSP_021510754 – 778YEKTQ…EKQSI → VKRKDIMSPIMVGLKAKSKS DIHAS in isoform 8. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_021511779 – 828Missing in isoform 8. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_021512798N → NPSILQPVPARIHRPIPGFP DMVIRSIVERK in isoform 4. 1 Publication1
Alternative sequenceiVSP_021513799 – 828KPWPW…ARASP → PSILQPVPAVFIGLFLAFLF WCFGPLW in isoform 5. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF304450 mRNA. Translation: AAG41949.1.
AF100750 mRNA. Translation: AAD43014.1.
AY358410 mRNA. Translation: AAQ88776.1. Different initiation.
AK124200 mRNA. Translation: BAC85803.1.
AL834538 mRNA. Translation: CAD39194.1.
CR627321 mRNA. Translation: CAH10369.1. Different initiation.
BC114627 mRNA. Translation: AAI14628.1.
BC115701 mRNA. Translation: AAI15702.1.
AB046821 mRNA. Translation: BAB13427.1.
CCDSiCCDS33774.1. [Q14BN4-3]
CCDS77757.1. [Q14BN4-1]
CCDS77758.1. [Q14BN4-2]
RefSeqiNP_001291349.1. NM_001304420.2. [Q14BN4-1]
NP_001291350.1. NM_001304421.2. [Q14BN4-2]
NP_001298107.1. NM_001311178.1. [Q14BN4-5]
NP_001298108.1. NM_001311179.1. [Q14BN4-8]
NP_009090.2. NM_007159.4. [Q14BN4-3]
XP_005265518.1. XM_005265461.3. [Q14BN4-1]
XP_005265523.1. XM_005265466.3. [Q14BN4-3]
XP_005265528.1. XM_005265471.3. [Q14BN4-2]
XP_016862659.1. XM_017007170.1. [Q14BN4-5]
UniGeneiHs.476432.
Hs.574978.

Genome annotation databases

EnsembliENST00000295951; ENSP00000295951; ENSG00000163681. [Q14BN4-3]
ENST00000295952; ENSP00000295952; ENSG00000163681. [Q14BN4-3]
ENST00000383718; ENSP00000373224; ENSG00000163681. [Q14BN4-6]
ENST00000428312; ENSP00000398661; ENSG00000163681. [Q14BN4-1]
ENST00000449503; ENSP00000412945; ENSG00000163681. [Q14BN4-2]
GeneIDi7871.
KEGGihsa:7871.
UCSCiuc003djc.2. human. [Q14BN4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF304450 mRNA. Translation: AAG41949.1.
AF100750 mRNA. Translation: AAD43014.1.
AY358410 mRNA. Translation: AAQ88776.1. Different initiation.
AK124200 mRNA. Translation: BAC85803.1.
AL834538 mRNA. Translation: CAD39194.1.
CR627321 mRNA. Translation: CAH10369.1. Different initiation.
BC114627 mRNA. Translation: AAI14628.1.
BC115701 mRNA. Translation: AAI15702.1.
AB046821 mRNA. Translation: BAB13427.1.
CCDSiCCDS33774.1. [Q14BN4-3]
CCDS77757.1. [Q14BN4-1]
CCDS77758.1. [Q14BN4-2]
RefSeqiNP_001291349.1. NM_001304420.2. [Q14BN4-1]
NP_001291350.1. NM_001304421.2. [Q14BN4-2]
NP_001298107.1. NM_001311178.1. [Q14BN4-5]
NP_001298108.1. NM_001311179.1. [Q14BN4-8]
NP_009090.2. NM_007159.4. [Q14BN4-3]
XP_005265518.1. XM_005265461.3. [Q14BN4-1]
XP_005265523.1. XM_005265466.3. [Q14BN4-3]
XP_005265528.1. XM_005265471.3. [Q14BN4-2]
XP_016862659.1. XM_017007170.1. [Q14BN4-5]
UniGeneiHs.476432.
Hs.574978.

3D structure databases

ProteinModelPortaliQ14BN4.
SMRiQ14BN4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113620. 65 interactors.
IntActiQ14BN4. 49 interactors.
MINTiMINT-7006290.
STRINGi9606.ENSP00000295951.

PTM databases

iPTMnetiQ14BN4.
PhosphoSitePlusiQ14BN4.

Polymorphism and mutation databases

BioMutaiSLMAP.
DMDMi118597508.

Proteomic databases

EPDiQ14BN4.
MaxQBiQ14BN4.
PaxDbiQ14BN4.
PeptideAtlasiQ14BN4.
PRIDEiQ14BN4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295951; ENSP00000295951; ENSG00000163681. [Q14BN4-3]
ENST00000295952; ENSP00000295952; ENSG00000163681. [Q14BN4-3]
ENST00000383718; ENSP00000373224; ENSG00000163681. [Q14BN4-6]
ENST00000428312; ENSP00000398661; ENSG00000163681. [Q14BN4-1]
ENST00000449503; ENSP00000412945; ENSG00000163681. [Q14BN4-2]
GeneIDi7871.
KEGGihsa:7871.
UCSCiuc003djc.2. human. [Q14BN4-1]

Organism-specific databases

CTDi7871.
DisGeNETi7871.
GeneCardsiSLMAP.
H-InvDBHIX0003396.
HGNCiHGNC:16643. SLMAP.
HPAiHPA002357.
HPA002358.
MalaCardsiSLMAP.
MIMi602701. gene.
neXtProtiNX_Q14BN4.
OpenTargetsiENSG00000163681.
Orphaneti130. Brugada syndrome.
PharmGKBiPA38179.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3872. Eukaryota.
COG1716. LUCA.
GeneTreeiENSGT00530000063197.
HOVERGENiHBG082442.
InParanoidiQ14BN4.
OMAiFIECQQK.
OrthoDBiEOG091G081W.
PhylomeDBiQ14BN4.
TreeFamiTF318787.

Miscellaneous databases

ChiTaRSiSLMAP. human.
GeneWikiiSLMAP.
GenomeRNAii7871.
PROiQ14BN4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163681.
ExpressionAtlasiQ14BN4. baseline and differential.
GenevisibleiQ14BN4. HS.

Family and domain databases

Gene3Di2.60.200.20. 1 hit.
InterProiIPR000253. FHA_dom.
IPR030498. SLMAP.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR15715:SF22. PTHR15715:SF22. 1 hit.
PfamiPF00498. FHA. 1 hit.
[Graphical view]
SMARTiSM00240. FHA. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSLMAP_HUMAN
AccessioniPrimary (citable) accession number: Q14BN4
Secondary accession number(s): Q14C95
, Q6AI54, Q6UXC9, Q6ZVQ8, Q8NCW9, Q9H297, Q9HCH1, Q9Y681
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: August 22, 2006
Last modified: November 2, 2016
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.