Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcolemmal membrane-associated protein

Gene

SLMAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role during myoblast fusion.By similarity

GO - Biological processi

  • muscle contraction Source: ProtInc
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcolemmal membrane-associated protein
Short name:
Sarcolemmal-associated protein
Gene namesi
Name:SLMAP
Synonyms:KIAA1601, SLAP
ORF Names:UNQ1847/PRO3577
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:16643. SLMAP.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 802802CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei803 – 82321Helical; Anchor for type IV membrane proteinSequence AnalysisAdd
BLAST
Topological domaini824 – 8285ExtracellularSequence Analysis

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • microtubule organizing center Source: UniProtKB-SubCell
  • sarcolemma Source: UniProtKB-SubCell
  • smooth endoplasmic reticulum Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

Orphaneti130. Brugada syndrome.
PharmGKBiPA38179.

Polymorphism and mutation databases

BioMutaiSLMAP.
DMDMi118597508.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 828828Sarcolemmal membrane-associated proteinPRO_0000259662Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei452 – 4521Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ14BN4.
PaxDbiQ14BN4.
PRIDEiQ14BN4.

PTM databases

PhosphoSiteiQ14BN4.

Expressioni

Gene expression databases

BgeeiQ14BN4.
ExpressionAtlasiQ14BN4. baseline and differential.
GenevestigatoriQ14BN4.

Organism-specific databases

HPAiHPA002357.
HPA002358.

Interactioni

Subunit structurei

Homodimer. Interacts with myosin (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
OPTNQ96CV92EBI-1043216,EBI-748974
STK3Q131886EBI-1043216,EBI-992580
STK4Q130437EBI-1043216,EBI-367376

Protein-protein interaction databases

BioGridi113620. 44 interactions.
IntActiQ14BN4. 45 interactions.
MINTiMINT-7006290.

Structurei

3D structure databases

ProteinModelPortaliQ14BN4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini28 – 8558FHAPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 163163Necessary for targeting to centrosomesBy similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili167 – 20236Sequence AnalysisAdd
BLAST
Coiled coili230 – 388159Sequence AnalysisAdd
BLAST
Coiled coili477 – 799323Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the SLMAP family.Curated
Contains 1 FHA domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1716.
GeneTreeiENSGT00530000063197.
HOVERGENiHBG082442.
InParanoidiQ14BN4.
OMAiLHINIEN.
OrthoDBiEOG7V1FQD.
PhylomeDBiQ14BN4.
TreeFamiTF318787.

Family and domain databases

Gene3Di2.60.200.20. 1 hit.
InterProiIPR000253. FHA_dom.
IPR030498. SLMAP.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR18889:SF8. PTHR18889:SF8. 1 hit.
PfamiPF00498. FHA. 1 hit.
[Graphical view]
SMARTiSM00240. FHA. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14BN4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSALAIFTC RPNSHPFQER HVYLDEPIKI GRSVARCRPA QNNATFDCKV
60 70 80 90 100
LSRNHALVWF DHKTGKFYLQ DTKSSNGTFI NSQRLSRGSE ESPPCEILSG
110 120 130 140 150
DIIQFGVDVT ENTRKVTHGC IVSTIKLFLP DGMEARLRSD VIHAPLPSPV
160 170 180 190 200
DKVAANTPSM YSQELFQLSQ YLQEALHREQ MLEQKLATLQ RLLAITQEAS
210 220 230 240 250
DTSWQALIDE DRLLSRLEVM GNQLQACSKN QTEDSLRKEL IALQEDKHNY
260 270 280 290 300
ETTAKESLRR VLQEKIEVVR KLSEVERSLS NTEDECTHLK EMNERTQEEL
310 320 330 340 350
RELANKYNGA VNEIKDLSDK LKVAEGKQEE IQQKGQAEKK ELQHKIDEME
360 370 380 390 400
EKEQELQAKI EALQADNDFT NERLTALQVR LEHLQEKTLK ECSSLEHLLS
410 420 430 440 450
KSGGDCTFIH QFIECQKKLI VEGHLTKAVE ETKLSKENQT RAKESDFSDT
460 470 480 490 500
LSPSKEKSSD DTTDAQMDEQ DLNEPLAKVS LLKDDLQGAQ SEIEAKQEIQ
510 520 530 540 550
HLRKELIEAQ ELARTSKQKC FELQALLEEE RKAYRNQVEE STKQIQVLQA
560 570 580 590 600
QLQRLHIDTE NLREEKDSEI TSTRDELLSA RDEILLLHQA AAKVASERDT
610 620 630 640 650
DIASLQEELK KVRAELERWR KAASEYEKEI TSLQNSFQLR CQQCEDQQRE
660 670 680 690 700
EATRLQGELE KLRKEWNALE TECHSLKREN VLLSSELQRQ EKELHNSQKQ
710 720 730 740 750
SLELTSDLSI LQMSRKELEN QVGSLKEQHL RDSADLKTLL SKAENQAKDV
760 770 780 790 800
QKEYEKTQTV LSELKLKFEM TEQEKQSITD ELKQCKNNLK LLREKGNNKP
810 820
WPWMPMLAAL VAVTAIVLYV PGLARASP
Length:828
Mass (Da):95,198
Last modified:August 22, 2006 - v1
Checksum:i20F5FA38174CA383
GO
Isoform 2 (identifier: Q14BN4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-417: VRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQK → E

Show »
Length:790
Mass (Da):90,829
Checksum:i2A5F92ECEF240518
GO
Isoform 3 (identifier: Q14BN4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-395: Missing.

Note: Incomplete sequence.

Show »
Length:811
Mass (Da):93,203
Checksum:i17BCE2C5B6243F6C
GO
Isoform 4 (identifier: Q14BN4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-348: Missing.
     379-436: Missing.
     798-798: N → NPSILQPVPARIHRPIPGFPDMVIRSIVERK

Show »
Length:452
Mass (Da):52,228
Checksum:i28B281416FD23FCD
GO
Isoform 5 (identifier: Q14BN4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     799-828: KPWPWMPMLAALVAVTAIVLYVPGLARASP → PSILQPVPAVFIGLFLAFLFWCFGPLW

Show »
Length:359
Mass (Da):41,896
Checksum:iDAEFBF630F5C6443
GO
Isoform 6 (identifier: Q14BN4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-417: EHLLSKSGGDCTFIHQFIECQK → GIQVDDFLPKINGSTEKE
     484-510: DDLQGAQSEIEAKQEIQHLRKELIEAQ → GTLTCFYDIVNQGIKSPFAIKSVLDIM
     511-828: Missing.

Show »
Length:506
Mass (Da):57,531
Checksum:i2A77ABF7E61C8418
GO
Isoform 7 (identifier: Q14BN4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-428: EHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKA → ADRRRASNQSGRRNKAFKRFVFCFSMFFDSSFG
     429-828: Missing.

Note: No experimental confirmation available.

Show »
Length:428
Mass (Da):49,177
Checksum:i103B2A7E6103D7DF
GO
Isoform 8 (identifier: Q14BN4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     484-524: Missing.
     754-778: YEKTQTVLSELKLKFEMTEQEKQSI → VKRKDIMSPIMVGLKAKSKSDIHAS
     779-828: Missing.

Note: No experimental confirmation available.

Show »
Length:271
Mass (Da):31,437
Checksum:i84CA2BC512502DF9
GO

Sequence cautioni

The sequence AAQ88776.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAH10369.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti493 – 4931I → T in AAG41949 (PubMed:10986292).Curated
Sequence conflicti515 – 5151T → A in AAG41949 (PubMed:10986292).Curated
Sequence conflicti812 – 8121A → Q in AAD43014 (PubMed:11042152).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 466466Missing in isoform 5 and isoform 8. 2 PublicationsVSP_021499Add
BLAST
Alternative sequencei1 – 348348Missing in isoform 4. 1 PublicationVSP_021500Add
BLAST
Alternative sequencei379 – 43658Missing in isoform 4. 1 PublicationVSP_021501Add
BLAST
Alternative sequencei379 – 41739VRLEH…IECQK → E in isoform 2. 1 PublicationVSP_021502Add
BLAST
Alternative sequencei379 – 39517Missing in isoform 3. 1 PublicationVSP_021503Add
BLAST
Alternative sequencei396 – 42833EHLLS…HLTKA → ADRRRASNQSGRRNKAFKRF VFCFSMFFDSSFG in isoform 7. 1 PublicationVSP_021504Add
BLAST
Alternative sequencei396 – 41722EHLLS…IECQK → GIQVDDFLPKINGSTEKE in isoform 6. 1 PublicationVSP_021505Add
BLAST
Alternative sequencei429 – 828400Missing in isoform 7. 1 PublicationVSP_021506Add
BLAST
Alternative sequencei484 – 52441Missing in isoform 8. 1 PublicationVSP_021507Add
BLAST
Alternative sequencei484 – 51027DDLQG…LIEAQ → GTLTCFYDIVNQGIKSPFAI KSVLDIM in isoform 6. 1 PublicationVSP_021508Add
BLAST
Alternative sequencei511 – 828318Missing in isoform 6. 1 PublicationVSP_021509Add
BLAST
Alternative sequencei754 – 77825YEKTQ…EKQSI → VKRKDIMSPIMVGLKAKSKS DIHAS in isoform 8. 1 PublicationVSP_021510Add
BLAST
Alternative sequencei779 – 82850Missing in isoform 8. 1 PublicationVSP_021511Add
BLAST
Alternative sequencei798 – 7981N → NPSILQPVPARIHRPIPGFP DMVIRSIVERK in isoform 4. 1 PublicationVSP_021512
Alternative sequencei799 – 82830KPWPW…ARASP → PSILQPVPAVFIGLFLAFLF WCFGPLW in isoform 5. 1 PublicationVSP_021513Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF304450 mRNA. Translation: AAG41949.1.
AF100750 mRNA. Translation: AAD43014.1.
AY358410 mRNA. Translation: AAQ88776.1. Different initiation.
AK124200 mRNA. Translation: BAC85803.1.
AL834538 mRNA. Translation: CAD39194.1.
CR627321 mRNA. Translation: CAH10369.1. Different initiation.
BC114627 mRNA. Translation: AAI14628.1.
BC115701 mRNA. Translation: AAI15702.1.
AB046821 mRNA. Translation: BAB13427.1.
CCDSiCCDS33774.1. [Q14BN4-3]
RefSeqiNP_009090.2. NM_007159.3. [Q14BN4-3]
XP_005265518.1. XM_005265461.3. [Q14BN4-1]
XP_005265523.1. XM_005265466.3. [Q14BN4-3]
XP_005265528.1. XM_005265471.3. [Q14BN4-2]
UniGeneiHs.476432.
Hs.574978.

Genome annotation databases

EnsembliENST00000295951; ENSP00000295951; ENSG00000163681. [Q14BN4-3]
ENST00000295952; ENSP00000295952; ENSG00000163681. [Q14BN4-3]
ENST00000383718; ENSP00000373224; ENSG00000163681. [Q14BN4-6]
ENST00000428312; ENSP00000398661; ENSG00000163681. [Q14BN4-1]
ENST00000449503; ENSP00000412945; ENSG00000163681. [Q14BN4-2]
GeneIDi7871.
KEGGihsa:7871.
UCSCiuc003djc.1. human. [Q14BN4-6]
uc003djd.1. human. [Q14BN4-3]
uc003dje.1. human. [Q14BN4-1]
uc003djf.1. human. [Q14BN4-2]
uc003djh.3. human. [Q14BN4-8]
uc003dji.1. human. [Q14BN4-5]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF304450 mRNA. Translation: AAG41949.1.
AF100750 mRNA. Translation: AAD43014.1.
AY358410 mRNA. Translation: AAQ88776.1. Different initiation.
AK124200 mRNA. Translation: BAC85803.1.
AL834538 mRNA. Translation: CAD39194.1.
CR627321 mRNA. Translation: CAH10369.1. Different initiation.
BC114627 mRNA. Translation: AAI14628.1.
BC115701 mRNA. Translation: AAI15702.1.
AB046821 mRNA. Translation: BAB13427.1.
CCDSiCCDS33774.1. [Q14BN4-3]
RefSeqiNP_009090.2. NM_007159.3. [Q14BN4-3]
XP_005265518.1. XM_005265461.3. [Q14BN4-1]
XP_005265523.1. XM_005265466.3. [Q14BN4-3]
XP_005265528.1. XM_005265471.3. [Q14BN4-2]
UniGeneiHs.476432.
Hs.574978.

3D structure databases

ProteinModelPortaliQ14BN4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113620. 44 interactions.
IntActiQ14BN4. 45 interactions.
MINTiMINT-7006290.

PTM databases

PhosphoSiteiQ14BN4.

Polymorphism and mutation databases

BioMutaiSLMAP.
DMDMi118597508.

Proteomic databases

MaxQBiQ14BN4.
PaxDbiQ14BN4.
PRIDEiQ14BN4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295951; ENSP00000295951; ENSG00000163681. [Q14BN4-3]
ENST00000295952; ENSP00000295952; ENSG00000163681. [Q14BN4-3]
ENST00000383718; ENSP00000373224; ENSG00000163681. [Q14BN4-6]
ENST00000428312; ENSP00000398661; ENSG00000163681. [Q14BN4-1]
ENST00000449503; ENSP00000412945; ENSG00000163681. [Q14BN4-2]
GeneIDi7871.
KEGGihsa:7871.
UCSCiuc003djc.1. human. [Q14BN4-6]
uc003djd.1. human. [Q14BN4-3]
uc003dje.1. human. [Q14BN4-1]
uc003djf.1. human. [Q14BN4-2]
uc003djh.3. human. [Q14BN4-8]
uc003dji.1. human. [Q14BN4-5]

Organism-specific databases

CTDi7871.
GeneCardsiGC03P057802.
H-InvDBHIX0003396.
HGNCiHGNC:16643. SLMAP.
HPAiHPA002357.
HPA002358.
MIMi602701. gene.
neXtProtiNX_Q14BN4.
Orphaneti130. Brugada syndrome.
PharmGKBiPA38179.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1716.
GeneTreeiENSGT00530000063197.
HOVERGENiHBG082442.
InParanoidiQ14BN4.
OMAiLHINIEN.
OrthoDBiEOG7V1FQD.
PhylomeDBiQ14BN4.
TreeFamiTF318787.

Miscellaneous databases

ChiTaRSiSLMAP. human.
GeneWikiiSLMAP.
GenomeRNAii7871.
NextBioi30324.
PROiQ14BN4.
SOURCEiSearch...

Gene expression databases

BgeeiQ14BN4.
ExpressionAtlasiQ14BN4. baseline and differential.
GenevestigatoriQ14BN4.

Family and domain databases

Gene3Di2.60.200.20. 1 hit.
InterProiIPR000253. FHA_dom.
IPR030498. SLMAP.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PANTHERiPTHR18889:SF8. PTHR18889:SF8. 1 hit.
PfamiPF00498. FHA. 1 hit.
[Graphical view]
SMARTiSM00240. FHA. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Alternative splicing, expression, and genomic structure of the 3' region of the gene encoding the sarcolemmal-associated proteins (SLAPs) defines a novel class of coiled-coil tail-anchored membrane proteins."
    Wielowieyski P.A., Sevinc S., Guzzo R., Salih M., Wigle J.T., Tuana B.S.
    J. Biol. Chem. 275:38474-38481(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING.
    Tissue: Heart.
  2. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Umbilical cord blood.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Thymus.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 528-828.
    Tissue: Fetal liver and Uterus.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  7. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 122-828 (ISOFORM 3).
    Tissue: Brain.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSLMAP_HUMAN
AccessioniPrimary (citable) accession number: Q14BN4
Secondary accession number(s): Q14C95
, Q6AI54, Q6UXC9, Q6ZVQ8, Q8NCW9, Q9H297, Q9HCH1, Q9Y681
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: August 22, 2006
Last modified: April 29, 2015
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.