Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q14BN4 (SLMAP_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 73. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sarcolemmal membrane-associated protein

Short name=Sarcolemmal-associated protein
Gene names
Name:SLMAP
Synonyms:KIAA1601, SLAP
ORF Names:UNQ1847/PRO3577
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length828 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role during myoblast fusion By similarity.

Subunit structure

Homodimer. Interacts with myosin By similarity.

Subcellular location

Cell membranesarcolemma; Single-pass type IV membrane protein By similarity. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome By similarity. Note: Membrane-associated. Distributed in the transverse tubules and near the junctional sarcoplasmic reticulum. Detected along the Z- and M-lines in cardiomyocytes. Centrosome. Localizes to the centrosomes in a microtubule- dependent manner By similarity.

Sequence similarities

Belongs to the SLMAP family.

Contains 1 FHA domain.

Sequence caution

The sequence AAQ88776.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAH10369.1 differs from that shown. Reason: Erroneous initiation.

Binary interactions

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q14BN4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q14BN4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     379-417: VRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQK → E
Isoform 3 (identifier: Q14BN4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     379-395: Missing.
Note: Incomplete sequence.
Isoform 4 (identifier: Q14BN4-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-348: Missing.
     379-436: Missing.
     798-798: N → NPSILQPVPARIHRPIPGFPDMVIRSIVERK
Isoform 5 (identifier: Q14BN4-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     799-828: KPWPWMPMLAALVAVTAIVLYVPGLARASP → PSILQPVPAVFIGLFLAFLFWCFGPLW
Isoform 6 (identifier: Q14BN4-6)

The sequence of this isoform differs from the canonical sequence as follows:
     396-417: EHLLSKSGGDCTFIHQFIECQK → GIQVDDFLPKINGSTEKE
     484-510: DDLQGAQSEIEAKQEIQHLRKELIEAQ → GTLTCFYDIVNQGIKSPFAIKSVLDIM
     511-828: Missing.
Isoform 7 (identifier: Q14BN4-7)

The sequence of this isoform differs from the canonical sequence as follows:
     396-428: EHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKA → ADRRRASNQSGRRNKAFKRFVFCFSMFFDSSFG
     429-828: Missing.
Note: No experimental confirmation available.
Isoform 8 (identifier: Q14BN4-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     484-524: Missing.
     754-778: YEKTQTVLSELKLKFEMTEQEKQSI → VKRKDIMSPIMVGLKAKSKSDIHAS
     779-828: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 828828Sarcolemmal membrane-associated protein
PRO_0000259662

Regions

Topological domain1 – 802802Cytoplasmic Potential
Transmembrane803 – 82321Helical; Anchor for type IV membrane protein; Potential
Topological domain824 – 8285Extracellular Potential
Domain28 – 8558FHA
Region1 – 163163Necessary for targeting to centrosomes By similarity
Coiled coil167 – 20236 Potential
Coiled coil230 – 388159 Potential
Coiled coil477 – 799323 Potential

Amino acid modifications

Modified residue4521Phosphoserine Ref.8 Ref.9

Natural variations

Alternative sequence1 – 466466Missing in isoform 5 and isoform 8.
VSP_021499
Alternative sequence1 – 348348Missing in isoform 4.
VSP_021500
Alternative sequence379 – 43658Missing in isoform 4.
VSP_021501
Alternative sequence379 – 41739VRLEH…IECQK → E in isoform 2.
VSP_021502
Alternative sequence379 – 39517Missing in isoform 3.
VSP_021503
Alternative sequence396 – 42833EHLLS…HLTKA → ADRRRASNQSGRRNKAFKRF VFCFSMFFDSSFG in isoform 7.
VSP_021504
Alternative sequence396 – 41722EHLLS…IECQK → GIQVDDFLPKINGSTEKE in isoform 6.
VSP_021505
Alternative sequence429 – 828400Missing in isoform 7.
VSP_021506
Alternative sequence484 – 52441Missing in isoform 8.
VSP_021507
Alternative sequence484 – 51027DDLQG…LIEAQ → GTLTCFYDIVNQGIKSPFAI KSVLDIM in isoform 6.
VSP_021508
Alternative sequence511 – 828318Missing in isoform 6.
VSP_021509
Alternative sequence754 – 77825YEKTQ…EKQSI → VKRKDIMSPIMVGLKAKSKS DIHAS in isoform 8.
VSP_021510
Alternative sequence779 – 82850Missing in isoform 8.
VSP_021511
Alternative sequence7981N → NPSILQPVPARIHRPIPGFP DMVIRSIVERK in isoform 4.
VSP_021512
Alternative sequence799 – 82830KPWPW…ARASP → PSILQPVPAVFIGLFLAFLF WCFGPLW in isoform 5.
VSP_021513

Experimental info

Sequence conflict4931I → T in AAG41949. Ref.1
Sequence conflict5151T → A in AAG41949. Ref.1
Sequence conflict8121A → Q in AAD43014. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 22, 2006. Version 1.
Checksum: 20F5FA38174CA383

FASTA82895,198
        10         20         30         40         50         60 
MPSALAIFTC RPNSHPFQER HVYLDEPIKI GRSVARCRPA QNNATFDCKV LSRNHALVWF 

        70         80         90        100        110        120 
DHKTGKFYLQ DTKSSNGTFI NSQRLSRGSE ESPPCEILSG DIIQFGVDVT ENTRKVTHGC 

       130        140        150        160        170        180 
IVSTIKLFLP DGMEARLRSD VIHAPLPSPV DKVAANTPSM YSQELFQLSQ YLQEALHREQ 

       190        200        210        220        230        240 
MLEQKLATLQ RLLAITQEAS DTSWQALIDE DRLLSRLEVM GNQLQACSKN QTEDSLRKEL 

       250        260        270        280        290        300 
IALQEDKHNY ETTAKESLRR VLQEKIEVVR KLSEVERSLS NTEDECTHLK EMNERTQEEL 

       310        320        330        340        350        360 
RELANKYNGA VNEIKDLSDK LKVAEGKQEE IQQKGQAEKK ELQHKIDEME EKEQELQAKI 

       370        380        390        400        410        420 
EALQADNDFT NERLTALQVR LEHLQEKTLK ECSSLEHLLS KSGGDCTFIH QFIECQKKLI 

       430        440        450        460        470        480 
VEGHLTKAVE ETKLSKENQT RAKESDFSDT LSPSKEKSSD DTTDAQMDEQ DLNEPLAKVS 

       490        500        510        520        530        540 
LLKDDLQGAQ SEIEAKQEIQ HLRKELIEAQ ELARTSKQKC FELQALLEEE RKAYRNQVEE 

       550        560        570        580        590        600 
STKQIQVLQA QLQRLHIDTE NLREEKDSEI TSTRDELLSA RDEILLLHQA AAKVASERDT 

       610        620        630        640        650        660 
DIASLQEELK KVRAELERWR KAASEYEKEI TSLQNSFQLR CQQCEDQQRE EATRLQGELE 

       670        680        690        700        710        720 
KLRKEWNALE TECHSLKREN VLLSSELQRQ EKELHNSQKQ SLELTSDLSI LQMSRKELEN 

       730        740        750        760        770        780 
QVGSLKEQHL RDSADLKTLL SKAENQAKDV QKEYEKTQTV LSELKLKFEM TEQEKQSITD 

       790        800        810        820 
ELKQCKNNLK LLREKGNNKP WPWMPMLAAL VAVTAIVLYV PGLARASP 

« Hide

Isoform 2 [UniParc].

Checksum: 2A5F92ECEF240518
Show »

FASTA79090,829
Isoform 3 [UniParc].

Checksum: 17BCE2C5B6243F6C
Show »

FASTA81193,203
Isoform 4 [UniParc].

Checksum: 28B281416FD23FCD
Show »

FASTA45252,228
Isoform 5 [UniParc].

Checksum: DAEFBF630F5C6443
Show »

FASTA35941,896
Isoform 6 [UniParc].

Checksum: 2A77ABF7E61C8418
Show »

FASTA50657,531
Isoform 7 [UniParc].

Checksum: 103B2A7E6103D7DF
Show »

FASTA42849,177
Isoform 8 [UniParc].

Checksum: 84CA2BC512502DF9
Show »

FASTA27131,437

References

« Hide 'large scale' references
[1]"Alternative splicing, expression, and genomic structure of the 3' region of the gene encoding the sarcolemmal-associated proteins (SLAPs) defines a novel class of coiled-coil tail-anchored membrane proteins."
Wielowieyski P.A., Sevinc S., Guzzo R., Salih M., Wigle J.T., Tuana B.S.
J. Biol. Chem. 275:38474-38481(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING.
Tissue: Heart.
[2]"Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. expand/collapse author list , Gu J., Chen S.-J., Chen Z.
Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Umbilical cord blood.
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
Tissue: Thymus.
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 528-828.
Tissue: Fetal liver and Uterus.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
[7]"Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 122-828 (ISOFORM 3).
Tissue: Brain.
[8]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF304450 mRNA. Translation: AAG41949.1.
AF100750 mRNA. Translation: AAD43014.1.
AY358410 mRNA. Translation: AAQ88776.1. Different initiation.
AK124200 mRNA. Translation: BAC85803.1.
AL834538 mRNA. Translation: CAD39194.1.
CR627321 mRNA. Translation: CAH10369.1. Different initiation.
BC114627 mRNA. Translation: AAI14628.1.
BC115701 mRNA. Translation: AAI15702.1.
AB046821 mRNA. Translation: BAB13427.1.
RefSeqNP_009090.2. NM_007159.2.
XP_005265518.1. XM_005265461.2.
XP_005265523.1. XM_005265466.2.
XP_005265528.1. XM_005265471.2.
UniGeneHs.476432.

3D structure databases

ProteinModelPortalQ14BN4.
SMRQ14BN4. Positions 20-109.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid113620. 35 interactions.
IntActQ14BN4. 45 interactions.
MINTMINT-7006290.

PTM databases

PhosphoSiteQ14BN4.

Polymorphism databases

DMDM118597508.

Proteomic databases

PaxDbQ14BN4.
PRIDEQ14BN4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000295951; ENSP00000295951; ENSG00000163681. [Q14BN4-3]
ENST00000295952; ENSP00000295952; ENSG00000163681. [Q14BN4-3]
ENST00000383718; ENSP00000373224; ENSG00000163681. [Q14BN4-6]
ENST00000416870; ENSP00000412342; ENSG00000163681. [Q14BN4-8]
ENST00000428312; ENSP00000398661; ENSG00000163681. [Q14BN4-1]
ENST00000449503; ENSP00000412945; ENSG00000163681. [Q14BN4-2]
GeneID7871.
KEGGhsa:7871.
UCSCuc003djc.1. human. [Q14BN4-6]
uc003djd.1. human. [Q14BN4-3]
uc003dje.1. human. [Q14BN4-1]
uc003djf.1. human. [Q14BN4-2]
uc003djh.3. human. [Q14BN4-8]
uc003dji.1. human. [Q14BN4-5]

Organism-specific databases

CTD7871.
GeneCardsGC03P057802.
H-InvDBHIX0003396.
HGNCHGNC:16643. SLMAP.
HPAHPA002357.
HPA002358.
MIM602701. gene.
neXtProtNX_Q14BN4.
PharmGKBPA38179.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1716.
HOVERGENHBG082442.
OMACQKKLIV.
OrthoDBEOG7V1FQD.
PhylomeDBQ14BN4.
TreeFamTF318787.

Gene expression databases

ArrayExpressQ14BN4.
BgeeQ14BN4.
GenevestigatorQ14BN4.

Family and domain databases

Gene3D2.60.200.20. 1 hit.
InterProIPR000253. FHA_dom.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PfamPF00498. FHA. 1 hit.
[Graphical view]
SMARTSM00240. FHA. 1 hit.
[Graphical view]
SUPFAMSSF49879. SSF49879. 1 hit.
PROSITEPS50006. FHA_DOMAIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSLMAP. human.
GeneWikiSLMAP.
GenomeRNAi7871.
NextBio30324.
PROQ14BN4.
SOURCESearch...

Entry information

Entry nameSLMAP_HUMAN
AccessionPrimary (citable) accession number: Q14BN4
Secondary accession number(s): Q14C95 expand/collapse secondary AC list , Q6AI54, Q6UXC9, Q6ZVQ8, Q8NCW9, Q9H297, Q9HCH1, Q9Y681
Entry history
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: August 22, 2006
Last modified: April 16, 2014
This is version 73 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM