Q14BN4 (SLMAP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sarcolemmal membrane-associated protein Short name=Sarcolemmal-associated protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 828 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role during myoblast fusion By similarity. |
| Subunit structure | Homodimer. Interacts with myosin By similarity. |
| Subcellular location | Cell membrane › sarcolemma; Single-pass type IV membrane protein By similarity. Cytoplasm › cytoskeleton › centrosome By similarity. Note: Membrane-associated. Distributed in the transverse tubules and near the junctional sarcoplasmic reticulum. Detected along the Z- and M-lines in cardiomyocytes. Centrosome. Localizes to the centrosomes in a microtubule-dependent manner By similarity. |
| Sequence similarities | Belongs to the SLMAP family. Contains 1 FHA domain. |
| Sequence caution | The sequence AAQ88776.1 differs from that shown. Reason: Erroneous initiation. The sequence CAH10369.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Cytoplasm Cytoskeleton Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Transmembrane Transmembrane helix |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | muscle contraction Traceable author statement PubMed 9405447. Source: ProtInc protein foldingInferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to plasma membrane Traceable author statement PubMed 9405447. Source: ProtInc microtubule organizing centerInferred from electronic annotation. Source: UniProtKB-SubCell prefoldin complexInferred from electronic annotation. Source: InterPro sarcolemmaInferred from electronic annotation. Source: UniProtKB-SubCell smooth endoplasmic reticulumTraceable author statement PubMed 9405447. Source: ProtInc |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| OPTN | Q96CV9 | 2 | EBI-1043216,EBI-748974 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q14BN4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q14BN4-2) The sequence of this isoform differs from the canonical sequence as follows: 379-417: VRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQK → E | ||||||
| Isoform 3 (identifier: Q14BN4-3) The sequence of this isoform differs from the canonical sequence as follows: 379-395: Missing. | ||||||
| Note: Incomplete sequence. | ||||||
| Isoform 4 (identifier: Q14BN4-4) The sequence of this isoform differs from the canonical sequence as follows: 1-348: Missing. 379-436: Missing. 798-798: N → NPSILQPVPARIHRPIPGFPDMVIRSIVERK | ||||||
| Isoform 5 (identifier: Q14BN4-5) The sequence of this isoform differs from the canonical sequence as follows: 1-466: Missing. 799-828: KPWPWMPMLAALVAVTAIVLYVPGLARASP → PSILQPVPAVFIGLFLAFLFWCFGPLW | ||||||
| Isoform 6 (identifier: Q14BN4-6) The sequence of this isoform differs from the canonical sequence as follows: 396-417: EHLLSKSGGDCTFIHQFIECQK → GIQVDDFLPKINGSTEKE 484-510: DDLQGAQSEIEAKQEIQHLRKELIEAQ → GTLTCFYDIVNQGIKSPFAIKSVLDIM 511-828: Missing. | ||||||
| Isoform 7 (identifier: Q14BN4-7) The sequence of this isoform differs from the canonical sequence as follows: 396-428: EHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKA → ADRRRASNQSGRRNKAFKRFVFCFSMFFDSSFG 429-828: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 8 (identifier: Q14BN4-8) The sequence of this isoform differs from the canonical sequence as follows: 1-466: Missing. 484-524: Missing. 754-778: YEKTQTVLSELKLKFEMTEQEKQSI → VKRKDIMSPIMVGLKAKSKSDIHAS 779-828: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 828 | 828 | Sarcolemmal membrane-associated protein | PRO_0000259662 | |||||
Regions | |||||||||
| Topological domain | 1 – 802 | 802 | Cytoplasmic Potential | ||||||
| Transmembrane | 803 – 823 | 21 | Helical; Anchor for type IV membrane protein; Potential | ||||||
| Topological domain | 824 – 828 | 5 | Extracellular Potential | ||||||
| Domain | 28 – 85 | 58 | FHA | ||||||
| Region | 1 – 163 | 163 | Necessary for targeting to centrosomes By similarity | ||||||
| Coiled coil | 167 – 202 | 36 | Potential | ||||||
| Coiled coil | 230 – 388 | 159 | Potential | ||||||
| Coiled coil | 477 – 799 | 323 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 452 | 1 | Phosphoserine Ref.8 Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 466 | 466 | Missing in isoform 5 and isoform 8. | VSP_021499 | |||||
| Alternative sequence | 1 – 348 | 348 | Missing in isoform 4. | VSP_021500 | |||||
| Alternative sequence | 379 – 436 | 58 | Missing in isoform 4. | VSP_021501 | |||||
| Alternative sequence | 379 – 417 | 39 | VRLEH…IECQK → E in isoform 2. | VSP_021502 | |||||
| Alternative sequence | 379 – 395 | 17 | Missing in isoform 3. | VSP_021503 | |||||
| Alternative sequence | 396 – 428 | 33 | EHLLS…HLTKA → ADRRRASNQSGRRNKAFKRF VFCFSMFFDSSFG in isoform 7. | VSP_021504 | |||||
| Alternative sequence | 396 – 417 | 22 | EHLLS…IECQK → GIQVDDFLPKINGSTEKE in isoform 6. | VSP_021505 | |||||
| Alternative sequence | 429 – 828 | 400 | Missing in isoform 7. | VSP_021506 | |||||
| Alternative sequence | 484 – 524 | 41 | Missing in isoform 8. | VSP_021507 | |||||
| Alternative sequence | 484 – 510 | 27 | DDLQG…LIEAQ → GTLTCFYDIVNQGIKSPFAI KSVLDIM in isoform 6. | VSP_021508 | |||||
| Alternative sequence | 511 – 828 | 318 | Missing in isoform 6. | VSP_021509 | |||||
| Alternative sequence | 754 – 778 | 25 | YEKTQ…EKQSI → VKRKDIMSPIMVGLKAKSKS DIHAS in isoform 8. | VSP_021510 | |||||
| Alternative sequence | 779 – 828 | 50 | Missing in isoform 8. | VSP_021511 | |||||
| Alternative sequence | 798 | 1 | N → NPSILQPVPARIHRPIPGFP DMVIRSIVERK in isoform 4. | VSP_021512 | |||||
| Alternative sequence | 799 – 828 | 30 | KPWPW…ARASP → PSILQPVPAVFIGLFLAFLF WCFGPLW in isoform 5. | VSP_021513 | |||||
Experimental info | |||||||||
| Sequence conflict | 493 | 1 | I → T in AAG41949. Ref.1 | ||||||
| Sequence conflict | 515 | 1 | T → A in AAG41949. Ref.1 | ||||||
| Sequence conflict | 812 | 1 | A → Q in AAD43014. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Alternative splicing, expression, and genomic structure of the 3' region of the gene encoding the sarcolemmal-associated proteins (SLAPs) defines a novel class of coiled-coil tail-anchored membrane proteins." Wielowieyski P.A., Sevinc S., Guzzo R., Salih M., Wigle J.T., Tuana B.S. J. Biol. Chem. 275:38474-38481(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING. Tissue: Heart. |
| [2] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Umbilical cord blood. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). Tissue: Thymus. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 528-828. Tissue: Fetal liver and Uterus. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). |
| [7] | "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 122-828 (ISOFORM 3). Tissue: Brain. |
| [8] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF304450 mRNA. Translation: AAG41949.1. AF100750 mRNA. Translation: AAD43014.1. AY358410 mRNA. Translation: AAQ88776.1. Different initiation. AK124200 mRNA. Translation: BAC85803.1. AL834538 mRNA. Translation: CAD39194.1. CR627321 mRNA. Translation: CAH10369.1. Different initiation. BC114627 mRNA. Translation: AAI14628.1. BC115701 mRNA. Translation: AAI15702.1. AB046821 mRNA. Translation: BAB13427.1. |
| IPI | IPI00026691. IPI00030531. IPI00432472. IPI00446339. IPI00791574. IPI00794462. IPI00794566. IPI00795406. |
| RefSeq | NP_009090.2. NM_007159.2. |
| UniGene | Hs.476432. |
3D structure databases | |
| ProteinModelPortal | Q14BN4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q14BN4. 18 interactions. |
| MINT | MINT-7006290. |
PTM databases | |
| PhosphoSite | Q14BN4. |
Polymorphism databases | |
| DMDM | 118597508. |
Proteomic databases | |
| PaxDb | Q14BN4. |
| PRIDE | Q14BN4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000295951; ENSP00000295951; ENSG00000163681. ENST00000295952; ENSP00000295952; ENSG00000163681. ENST00000383718; ENSP00000373224; ENSG00000163681. ENST00000416870; ENSP00000412342; ENSG00000163681. ENST00000428312; ENSP00000398661; ENSG00000163681. ENST00000449503; ENSP00000412945; ENSG00000163681. |
| GeneID | 7871. |
| KEGG | hsa:7871. |
| UCSC | uc003djc.1. human. uc003djd.1. human. uc003dje.1. human. uc003djf.1. human. uc003djg.1. human. uc003djh.3. human. uc003dji.1. human. |
Organism-specific databases | |
| CTD | 7871. |
| GeneCards | GC03P057802. |
| H-InvDB | HIX0003396. |
| HGNC | HGNC:16643. SLMAP. |
| HPA | HPA002357. HPA002358. |
| MIM | 602701. gene. |
| neXtProt | NX_Q14BN4. |
| PharmGKB | PA38179. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1716. |
| HOVERGEN | HBG082442. |
| OMA | RTSKQKC. |
Gene expression databases | |
| ArrayExpress | Q14BN4. |
| Bgee | Q14BN4. |
| Genevestigator | Q14BN4. |
Family and domain databases | |
| Gene3D | 2.60.200.20. 1 hit. |
| InterPro | IPR000253. FHA_dom. IPR002777. PFD_beta-like. IPR008984. SMAD_FHA_domain. [Graphical view] |
| Pfam | PF00498. FHA. 1 hit. PF01920. Prefoldin_2. 1 hit. [Graphical view] |
| SMART | SM00240. FHA. 1 hit. [Graphical view] |
| SUPFAM | SSF49879. SMAD_FHA. 1 hit. |
| PROSITE | PS50006. FHA_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SLMAP. human. |
| GenomeRNAi | 7871. |
| NextBio | 30324. |
| SOURCE | Search... |
Entry information
| Entry name | SLMAP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14BN4 Secondary accession number(s): Q14C95 Q9Y681 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
