SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14BN4

- SLMAP_HUMAN

UniProt

Q14BN4 - SLMAP_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sarcolemmal membrane-associated protein

Gene
SLMAP, KIAA1601, SLAP, UNQ1847/PRO3577
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role during myoblast fusion By similarity.

GO - Molecular functioni

  1. protein binding Source: IntAct

GO - Biological processi

  1. muscle contraction Source: ProtInc
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcolemmal membrane-associated protein
Short name:
Sarcolemmal-associated protein
Gene namesi
Name:SLMAP
Synonyms:KIAA1601, SLAP
ORF Names:UNQ1847/PRO3577
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:16643. SLMAP.

Subcellular locationi

Cell membranesarcolemma; Single-pass type IV membrane protein By similarity. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome By similarity
Note: Membrane-associated. Distributed in the transverse tubules and near the junctional sarcoplasmic reticulum. Detected along the Z- and M-lines in cardiomyocytes. Centrosome. Localizes to the centrosomes in a microtubule- dependent manner By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 802802Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei803 – 82321Helical; Anchor for type IV membrane protein; Reviewed predictionAdd
BLAST
Topological domaini824 – 8285Extracellular Reviewed prediction

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. microtubule organizing center Source: UniProtKB-SubCell
  3. sarcolemma Source: UniProtKB-SubCell
  4. smooth endoplasmic reticulum Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38179.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 828828Sarcolemmal membrane-associated proteinPRO_0000259662Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei452 – 4521Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ14BN4.
PaxDbiQ14BN4.
PRIDEiQ14BN4.

PTM databases

PhosphoSiteiQ14BN4.

Expressioni

Gene expression databases

ArrayExpressiQ14BN4.
BgeeiQ14BN4.
GenevestigatoriQ14BN4.

Organism-specific databases

HPAiHPA002357.
HPA002358.

Interactioni

Subunit structurei

Homodimer. Interacts with myosin By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
OPTNQ96CV92EBI-1043216,EBI-748974
STK3Q131883EBI-1043216,EBI-992580
STK4Q130436EBI-1043216,EBI-367376

Protein-protein interaction databases

BioGridi113620. 35 interactions.
IntActiQ14BN4. 45 interactions.
MINTiMINT-7006290.

Structurei

3D structure databases

ProteinModelPortaliQ14BN4.
SMRiQ14BN4. Positions 60-85.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini28 – 8558FHAAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 163163Necessary for targeting to centrosomes By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili167 – 20236 Reviewed predictionAdd
BLAST
Coiled coili230 – 388159 Reviewed predictionAdd
BLAST
Coiled coili477 – 799323 Reviewed predictionAdd
BLAST

Sequence similaritiesi

Belongs to the SLMAP family.
Contains 1 FHA domain.

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1716.
HOVERGENiHBG082442.
OMAiCQKKLIV.
OrthoDBiEOG7V1FQD.
PhylomeDBiQ14BN4.
TreeFamiTF318787.

Family and domain databases

Gene3Di2.60.200.20. 1 hit.
InterProiIPR000253. FHA_dom.
IPR008984. SMAD_FHA_domain.
[Graphical view]
PfamiPF00498. FHA. 1 hit.
[Graphical view]
SMARTiSM00240. FHA. 1 hit.
[Graphical view]
SUPFAMiSSF49879. SSF49879. 1 hit.
PROSITEiPS50006. FHA_DOMAIN. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q14BN4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPSALAIFTC RPNSHPFQER HVYLDEPIKI GRSVARCRPA QNNATFDCKV    50
LSRNHALVWF DHKTGKFYLQ DTKSSNGTFI NSQRLSRGSE ESPPCEILSG 100
DIIQFGVDVT ENTRKVTHGC IVSTIKLFLP DGMEARLRSD VIHAPLPSPV 150
DKVAANTPSM YSQELFQLSQ YLQEALHREQ MLEQKLATLQ RLLAITQEAS 200
DTSWQALIDE DRLLSRLEVM GNQLQACSKN QTEDSLRKEL IALQEDKHNY 250
ETTAKESLRR VLQEKIEVVR KLSEVERSLS NTEDECTHLK EMNERTQEEL 300
RELANKYNGA VNEIKDLSDK LKVAEGKQEE IQQKGQAEKK ELQHKIDEME 350
EKEQELQAKI EALQADNDFT NERLTALQVR LEHLQEKTLK ECSSLEHLLS 400
KSGGDCTFIH QFIECQKKLI VEGHLTKAVE ETKLSKENQT RAKESDFSDT 450
LSPSKEKSSD DTTDAQMDEQ DLNEPLAKVS LLKDDLQGAQ SEIEAKQEIQ 500
HLRKELIEAQ ELARTSKQKC FELQALLEEE RKAYRNQVEE STKQIQVLQA 550
QLQRLHIDTE NLREEKDSEI TSTRDELLSA RDEILLLHQA AAKVASERDT 600
DIASLQEELK KVRAELERWR KAASEYEKEI TSLQNSFQLR CQQCEDQQRE 650
EATRLQGELE KLRKEWNALE TECHSLKREN VLLSSELQRQ EKELHNSQKQ 700
SLELTSDLSI LQMSRKELEN QVGSLKEQHL RDSADLKTLL SKAENQAKDV 750
QKEYEKTQTV LSELKLKFEM TEQEKQSITD ELKQCKNNLK LLREKGNNKP 800
WPWMPMLAAL VAVTAIVLYV PGLARASP 828
Length:828
Mass (Da):95,198
Last modified:August 22, 2006 - v1
Checksum:i20F5FA38174CA383
GO
Isoform 2 (identifier: Q14BN4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-417: VRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQK → E

Show »
Length:790
Mass (Da):90,829
Checksum:i2A5F92ECEF240518
GO
Isoform 3 (identifier: Q14BN4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     379-395: Missing.

Note: Incomplete sequence.

Show »
Length:811
Mass (Da):93,203
Checksum:i17BCE2C5B6243F6C
GO
Isoform 4 (identifier: Q14BN4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-348: Missing.
     379-436: Missing.
     798-798: N → NPSILQPVPARIHRPIPGFPDMVIRSIVERK

Show »
Length:452
Mass (Da):52,228
Checksum:i28B281416FD23FCD
GO
Isoform 5 (identifier: Q14BN4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     799-828: KPWPWMPMLAALVAVTAIVLYVPGLARASP → PSILQPVPAVFIGLFLAFLFWCFGPLW

Show »
Length:359
Mass (Da):41,896
Checksum:iDAEFBF630F5C6443
GO
Isoform 6 (identifier: Q14BN4-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-417: EHLLSKSGGDCTFIHQFIECQK → GIQVDDFLPKINGSTEKE
     484-510: DDLQGAQSEIEAKQEIQHLRKELIEAQ → GTLTCFYDIVNQGIKSPFAIKSVLDIM
     511-828: Missing.

Show »
Length:506
Mass (Da):57,531
Checksum:i2A77ABF7E61C8418
GO
Isoform 7 (identifier: Q14BN4-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-428: EHLLSKSGGDCTFIHQFIECQKKLIVEGHLTKA → ADRRRASNQSGRRNKAFKRFVFCFSMFFDSSFG
     429-828: Missing.

Note: No experimental confirmation available.

Show »
Length:428
Mass (Da):49,177
Checksum:i103B2A7E6103D7DF
GO
Isoform 8 (identifier: Q14BN4-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-466: Missing.
     484-524: Missing.
     754-778: YEKTQTVLSELKLKFEMTEQEKQSI → VKRKDIMSPIMVGLKAKSKSDIHAS
     779-828: Missing.

Note: No experimental confirmation available.

Show »
Length:271
Mass (Da):31,437
Checksum:i84CA2BC512502DF9
GO

Sequence cautioni

The sequence AAQ88776.1 differs from that shown. Reason: Erroneous initiation.
The sequence CAH10369.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 466466Missing in isoform 5 and isoform 8. VSP_021499Add
BLAST
Alternative sequencei1 – 348348Missing in isoform 4. VSP_021500Add
BLAST
Alternative sequencei379 – 43658Missing in isoform 4. VSP_021501Add
BLAST
Alternative sequencei379 – 41739VRLEH…IECQK → E in isoform 2. VSP_021502Add
BLAST
Alternative sequencei379 – 39517Missing in isoform 3. VSP_021503Add
BLAST
Alternative sequencei396 – 42833EHLLS…HLTKA → ADRRRASNQSGRRNKAFKRF VFCFSMFFDSSFG in isoform 7. VSP_021504Add
BLAST
Alternative sequencei396 – 41722EHLLS…IECQK → GIQVDDFLPKINGSTEKE in isoform 6. VSP_021505Add
BLAST
Alternative sequencei429 – 828400Missing in isoform 7. VSP_021506Add
BLAST
Alternative sequencei484 – 52441Missing in isoform 8. VSP_021507Add
BLAST
Alternative sequencei484 – 51027DDLQG…LIEAQ → GTLTCFYDIVNQGIKSPFAI KSVLDIM in isoform 6. VSP_021508Add
BLAST
Alternative sequencei511 – 828318Missing in isoform 6. VSP_021509Add
BLAST
Alternative sequencei754 – 77825YEKTQ…EKQSI → VKRKDIMSPIMVGLKAKSKS DIHAS in isoform 8. VSP_021510Add
BLAST
Alternative sequencei779 – 82850Missing in isoform 8. VSP_021511Add
BLAST
Alternative sequencei798 – 7981N → NPSILQPVPARIHRPIPGFP DMVIRSIVERK in isoform 4. VSP_021512
Alternative sequencei799 – 82830KPWPW…ARASP → PSILQPVPAVFIGLFLAFLF WCFGPLW in isoform 5. VSP_021513Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti493 – 4931I → T in AAG41949. 1 Publication
Sequence conflicti515 – 5151T → A in AAG41949. 1 Publication
Sequence conflicti812 – 8121A → Q in AAD43014. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF304450 mRNA. Translation: AAG41949.1.
AF100750 mRNA. Translation: AAD43014.1.
AY358410 mRNA. Translation: AAQ88776.1. Different initiation.
AK124200 mRNA. Translation: BAC85803.1.
AL834538 mRNA. Translation: CAD39194.1.
CR627321 mRNA. Translation: CAH10369.1. Different initiation.
BC114627 mRNA. Translation: AAI14628.1.
BC115701 mRNA. Translation: AAI15702.1.
AB046821 mRNA. Translation: BAB13427.1.
CCDSiCCDS33774.1. [Q14BN4-3]
RefSeqiNP_009090.2. NM_007159.2. [Q14BN4-3]
XP_005265518.1. XM_005265461.2. [Q14BN4-1]
XP_005265523.1. XM_005265466.2. [Q14BN4-3]
XP_005265528.1. XM_005265471.2. [Q14BN4-2]
UniGeneiHs.476432.

Genome annotation databases

EnsembliENST00000295951; ENSP00000295951; ENSG00000163681. [Q14BN4-3]
ENST00000295952; ENSP00000295952; ENSG00000163681. [Q14BN4-3]
ENST00000383718; ENSP00000373224; ENSG00000163681. [Q14BN4-6]
ENST00000416870; ENSP00000412342; ENSG00000163681. [Q14BN4-8]
ENST00000428312; ENSP00000398661; ENSG00000163681. [Q14BN4-1]
ENST00000449503; ENSP00000412945; ENSG00000163681. [Q14BN4-2]
GeneIDi7871.
KEGGihsa:7871.
UCSCiuc003djc.1. human. [Q14BN4-6]
uc003djd.1. human. [Q14BN4-3]
uc003dje.1. human. [Q14BN4-1]
uc003djf.1. human. [Q14BN4-2]
uc003djh.3. human. [Q14BN4-8]
uc003dji.1. human. [Q14BN4-5]

Polymorphism databases

DMDMi118597508.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF304450 mRNA. Translation: AAG41949.1 .
AF100750 mRNA. Translation: AAD43014.1 .
AY358410 mRNA. Translation: AAQ88776.1 . Different initiation.
AK124200 mRNA. Translation: BAC85803.1 .
AL834538 mRNA. Translation: CAD39194.1 .
CR627321 mRNA. Translation: CAH10369.1 . Different initiation.
BC114627 mRNA. Translation: AAI14628.1 .
BC115701 mRNA. Translation: AAI15702.1 .
AB046821 mRNA. Translation: BAB13427.1 .
CCDSi CCDS33774.1. [Q14BN4-3 ]
RefSeqi NP_009090.2. NM_007159.2. [Q14BN4-3 ]
XP_005265518.1. XM_005265461.2. [Q14BN4-1 ]
XP_005265523.1. XM_005265466.2. [Q14BN4-3 ]
XP_005265528.1. XM_005265471.2. [Q14BN4-2 ]
UniGenei Hs.476432.

3D structure databases

ProteinModelPortali Q14BN4.
SMRi Q14BN4. Positions 60-85.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113620. 35 interactions.
IntActi Q14BN4. 45 interactions.
MINTi MINT-7006290.

PTM databases

PhosphoSitei Q14BN4.

Polymorphism databases

DMDMi 118597508.

Proteomic databases

MaxQBi Q14BN4.
PaxDbi Q14BN4.
PRIDEi Q14BN4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000295951 ; ENSP00000295951 ; ENSG00000163681 . [Q14BN4-3 ]
ENST00000295952 ; ENSP00000295952 ; ENSG00000163681 . [Q14BN4-3 ]
ENST00000383718 ; ENSP00000373224 ; ENSG00000163681 . [Q14BN4-6 ]
ENST00000416870 ; ENSP00000412342 ; ENSG00000163681 . [Q14BN4-8 ]
ENST00000428312 ; ENSP00000398661 ; ENSG00000163681 . [Q14BN4-1 ]
ENST00000449503 ; ENSP00000412945 ; ENSG00000163681 . [Q14BN4-2 ]
GeneIDi 7871.
KEGGi hsa:7871.
UCSCi uc003djc.1. human. [Q14BN4-6 ]
uc003djd.1. human. [Q14BN4-3 ]
uc003dje.1. human. [Q14BN4-1 ]
uc003djf.1. human. [Q14BN4-2 ]
uc003djh.3. human. [Q14BN4-8 ]
uc003dji.1. human. [Q14BN4-5 ]

Organism-specific databases

CTDi 7871.
GeneCardsi GC03P057802.
H-InvDB HIX0003396.
HGNCi HGNC:16643. SLMAP.
HPAi HPA002357.
HPA002358.
MIMi 602701. gene.
neXtProti NX_Q14BN4.
PharmGKBi PA38179.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1716.
HOVERGENi HBG082442.
OMAi CQKKLIV.
OrthoDBi EOG7V1FQD.
PhylomeDBi Q14BN4.
TreeFami TF318787.

Miscellaneous databases

ChiTaRSi SLMAP. human.
GeneWikii SLMAP.
GenomeRNAii 7871.
NextBioi 30324.
PROi Q14BN4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q14BN4.
Bgeei Q14BN4.
Genevestigatori Q14BN4.

Family and domain databases

Gene3Di 2.60.200.20. 1 hit.
InterProi IPR000253. FHA_dom.
IPR008984. SMAD_FHA_domain.
[Graphical view ]
Pfami PF00498. FHA. 1 hit.
[Graphical view ]
SMARTi SM00240. FHA. 1 hit.
[Graphical view ]
SUPFAMi SSF49879. SSF49879. 1 hit.
PROSITEi PS50006. FHA_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Alternative splicing, expression, and genomic structure of the 3' region of the gene encoding the sarcolemmal-associated proteins (SLAPs) defines a novel class of coiled-coil tail-anchored membrane proteins."
    Wielowieyski P.A., Sevinc S., Guzzo R., Salih M., Wigle J.T., Tuana B.S.
    J. Biol. Chem. 275:38474-38481(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), ALTERNATIVE SPLICING.
    Tissue: Heart.
  2. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Umbilical cord blood.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Thymus.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 528-828.
    Tissue: Fetal liver and Uterus.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  7. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 122-828 (ISOFORM 3).
    Tissue: Brain.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-452, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSLMAP_HUMAN
AccessioniPrimary (citable) accession number: Q14BN4
Secondary accession number(s): Q14C95
, Q6AI54, Q6UXC9, Q6ZVQ8, Q8NCW9, Q9H297, Q9HCH1, Q9Y681
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: August 22, 2006
Last modified: July 9, 2014
This is version 76 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi