Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q14994

- NR1I3_HUMAN

UniProt

Q14994 - NR1I3_HUMAN

Protein

Nuclear receptor subfamily 1 group I member 3

Gene

NR1I3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 147 (01 Oct 2014)
      Sequence version 2 (21 Jun 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. Transactivates both the phenobarbital responsive element module of the human CYP2B6 gene and the CYP3A4 xenobiotic response element.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi8 – 8376Nuclear receptorPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri11 – 3121NR C4-typePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri47 – 7125NR C4-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. androgen receptor activity Source: ProtInc
    2. DNA binding Source: ProtInc
    3. ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity Source: ProtInc
    4. RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
    5. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
    6. sequence-specific DNA binding transcription factor activity Source: ProtInc
    7. thyroid hormone receptor activity Source: InterPro
    8. transcription coactivator activity Source: ProtInc
    9. zinc ion binding Source: InterPro

    GO - Biological processi

    1. androgen receptor signaling pathway Source: GOC
    2. gene expression Source: Reactome
    3. intracellular receptor signaling pathway Source: GOC
    4. negative regulation of transcription, DNA-templated Source: Ensembl
    5. positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
    6. signal transduction Source: ProtInc
    7. transcription initiation from RNA polymerase II promoter Source: Reactome

    Keywords - Molecular functioni

    Activator, Receptor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_15525. Nuclear Receptor transcription pathway.
    SignaLinkiQ14994.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear receptor subfamily 1 group I member 3
    Alternative name(s):
    Constitutive activator of retinoid response
    Short name:
    Constitutive active response
    Constitutive androstane receptor
    Short name:
    CAR
    Orphan nuclear receptor MB67
    Gene namesi
    Name:NR1I3
    Synonyms:CAR
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:7969. NR1I3.

    Subcellular locationi

    Nucleus. Cytoplasm. Cytoplasmcytoskeleton
    Note: Recruited to the cytoplasm by DNAJC7.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytoskeleton Source: UniProtKB-SubCell
    3. cytosol Source: Ensembl
    4. nucleoplasm Source: Reactome
    5. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA391.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 352352Nuclear receptor subfamily 1 group I member 3PRO_0000053552Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei38 – 381Phosphothreonine; by PKC1 Publication

    Post-translational modificationi

    Phosphorylated at Thr-38 by PKC, dephosphorylation of Thr-38 is required for nuclear translocation and activation.1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ14994.
    PRIDEiQ14994.

    PTM databases

    PhosphoSiteiQ14994.

    Expressioni

    Tissue specificityi

    Predominantly expressed in liver.

    Inductioni

    By dexamethasone.

    Gene expression databases

    ArrayExpressiQ14994.
    BgeeiQ14994.
    CleanExiHS_NR1I3.
    GenevestigatoriQ14994.

    Organism-specific databases

    HPAiHPA051365.

    Interactioni

    Subunit structurei

    Interacts with ECT2 By similarity. Heterodimer of NR1I3 and RXR. Interacts with PSMC4. Directly interacts with DNAJC7. The DNAJC7-NR1I3 complex may also include HSP90 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi115295. 14 interactions.
    IntActiQ14994. 7 interactions.
    STRINGi9606.ENSP00000356959.

    Structurei

    Secondary structure

    1
    352
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi108 – 12215
    Beta strandi125 – 1273
    Helixi128 – 1358
    Helixi139 – 1413
    Helixi155 – 17622
    Helixi180 – 1845
    Helixi187 – 20620
    Helixi207 – 2093
    Turni212 – 2154
    Beta strandi216 – 2183
    Beta strandi222 – 2243
    Helixi226 – 2316
    Helixi240 – 25516
    Helixi260 – 27112
    Beta strandi274 – 2763
    Helixi282 – 30120
    Helixi312 – 33625
    Helixi340 – 3434
    Helixi345 – 3506

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1XV9X-ray2.70B/D103-352[»]
    1XVPX-ray2.60B/D103-352[»]
    ProteinModelPortaliQ14994.
    SMRiQ14994. Positions 11-352.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ14994.

    Family & Domainsi

    Domaini

    Composed by a short N-terminal domain followed by the DNA binding, hinge, and ligand binding/dimerization domains.

    Sequence similaritiesi

    Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri11 – 3121NR C4-typePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri47 – 7125NR C4-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Zinc-finger

    Phylogenomic databases

    eggNOGiNOG251788.
    HOGENOMiHOG000220844.
    HOVERGENiHBG108655.
    KOiK08541.
    OMAiPRDRFLY.
    PhylomeDBiQ14994.
    TreeFamiTF316304.

    Family and domain databases

    Gene3Di1.10.565.10. 1 hit.
    3.30.50.10. 1 hit.
    InterProiIPR008946. Nucl_hormone_rcpt_ligand-bd.
    IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
    IPR001723. Str_hrmn_rcpt.
    IPR001728. ThyrH_rcpt.
    IPR001628. Znf_hrmn_rcpt.
    IPR013088. Znf_NHR/GATA.
    [Graphical view]
    PfamiPF00104. Hormone_recep. 1 hit.
    PF00105. zf-C4. 1 hit.
    [Graphical view]
    PRINTSiPR00398. STRDHORMONER.
    PR00047. STROIDFINGER.
    PR00546. THYROIDHORMR.
    SMARTiSM00430. HOLI. 1 hit.
    SM00399. ZnF_C4. 1 hit.
    [Graphical view]
    SUPFAMiSSF48508. SSF48508. 1 hit.
    PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
    PS51030. NUCLEAR_REC_DBD_2. 1 hit.
    [Graphical view]

    Sequences (15)i

    Sequence statusi: Complete.

    This entry describes 15 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q14994-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASREDELRN CVVCGDQATG YHFNALTCEG CKGFFRRTVS KSIGPTCPFA    50
    GSCEVSKTQR RHCPACRLQK CLDAGMRKDM ILSAEALALR RAKQAQRRAQ 100
    QTPVQLSKEQ EELIRTLLGA HTRHMGTMFE QFVQFRPPAH LFIHHQPLPT 150
    LAPVLPLVTH FADINTFMVL QVIKFTKDLP VFRSLPIEDQ ISLLKGAAVE 200
    ICHIVLNTTF CLQTQNFLCG PLRYTIEDGA RVSPTVGFQV EFLELLFHFH 250
    GTLRKLQLQE PEYVLLAAMA LFSPDRPGVT QRDEIDQLQE EMALTLQSYI 300
    KGQQRRPRDR FLYAKLLGLL AELRSINEAY GYQIQHIQGL SAMMPLLQEI 350
    CS 352
    Length:352
    Mass (Da):39,942
    Last modified:June 21, 2004 - v2
    Checksum:i73B060FE4950D519
    GO
    Isoform 2 (identifier: Q14994-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         233-236: Missing.

    Show »
    Length:348
    Mass (Da):39,558
    Checksum:i92EAAD07D7DCB9DA
    GO
    Isoform 3 (identifier: Q14994-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         232-274: VSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSP → APYLT

    Show »
    Length:314
    Mass (Da):35,588
    Checksum:iEE9F842EF2B19A2E
    GO
    Isoform 4 (identifier: Q14994-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
         232-274: Missing.

    Show »
    Length:280
    Mass (Da):31,900
    Checksum:i7F3BFA4F60A16FB1
    GO
    Isoform 5 (identifier: Q14994-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
         233-236: Missing.

    Show »
    Length:319
    Mass (Da):36,416
    Checksum:iC41CFFC814E96E46
    GO
    Isoform 6 (identifier: Q14994-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
         233-236: Missing.
         274-274: P → PAPYLT

    Show »
    Length:324
    Mass (Da):36,961
    Checksum:i32245F1A8C523B1E
    GO
    Isoform 7 (identifier: Q14994-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         232-274: Missing.

    Show »
    Length:309
    Mass (Da):35,043
    Checksum:i47BDCF4FC3777574
    GO
    Isoform 8 (identifier: Q14994-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         274-274: P → PAPYLT

    Show »
    Length:357
    Mass (Da):40,488
    Checksum:i1AF956D0A2759781
    GO
    Isoform 9 (identifier: Q14994-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
         233-236: Missing.
         311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

    Show »
    Length:306
    Mass (Da):34,778
    Checksum:iEA8397560E3A2AC1
    GO
    Isoform 10 (identifier: Q14994-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
         233-236: Missing.
         274-274: P → PAPYLT
         311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

    Show »
    Length:311
    Mass (Da):35,323
    Checksum:i88A1BD387DDFFF8B
    GO
    Isoform 11 (identifier: Q14994-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
         274-274: P → PAPYLT
         311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

    Show »
    Length:315
    Mass (Da):35,708
    Checksum:iA90FF3A0E39D1305
    GO
    Isoform 12 (identifier: Q14994-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

    Show »
    Length:339
    Mass (Da):38,304
    Checksum:iAEDAD58E1ECA2D6E
    GO
    Isoform 13 (identifier: Q14994-13) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         232-235: Missing.
         274-274: P → PAPYLT
         311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

    Show »
    Length:340
    Mass (Da):38,466
    Checksum:iC13708F49C3A2145
    GO
    Isoform 14 (identifier: Q14994-15) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         232-274: Missing.
         311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

    Show »
    Length:296
    Mass (Da):33,405
    Checksum:i3D8FC1261A54C270
    GO
    Isoform 15 (identifier: Q14994-16) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
         232-274: Missing.
         311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

    Show »
    Length:267
    Mass (Da):30,262
    Checksum:i97343837A4943EFE
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti133 – 1331V → G.1 Publication
    VAR_018344

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3535MASRE…CKGFF → MLPKRS in isoform 4, isoform 5, isoform 6, isoform 9, isoform 10, isoform 11 and isoform 15. 1 PublicationVSP_043730Add
    BLAST
    Alternative sequencei232 – 27443VSPTV…ALFSP → APYLT in isoform 3. 2 PublicationsVSP_043144Add
    BLAST
    Alternative sequencei232 – 27443Missing in isoform 4, isoform 7, isoform 14 and isoform 15. 3 PublicationsVSP_043731Add
    BLAST
    Alternative sequencei232 – 2354Missing in isoform 13. 1 PublicationVSP_055180
    Alternative sequencei233 – 2364Missing in isoform 2, isoform 5, isoform 6, isoform 9 and isoform 10. 3 PublicationsVSP_010634
    Alternative sequencei274 – 2741P → PAPYLT in isoform 6, isoform 8, isoform 10, isoform 11 and isoform 13. 2 PublicationsVSP_043732
    Alternative sequencei311 – 35242FLYAK…QEICS → SPGTPWIHWSGKMLGPKIGP GSKGAQWLQ in isoform 9, isoform 10, isoform 11, isoform 12, isoform 13, isoform 14 and isoform 15. 1 PublicationVSP_046144Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z30425 mRNA. Translation: CAA83016.1.
    AY572806 mRNA. Translation: AAT47159.1.
    AY572808 mRNA. Translation: AAT47161.1.
    AY572810 mRNA. Translation: AAT47163.1.
    AY572811 mRNA. Translation: AAT47164.1.
    AY572812 mRNA. Translation: AAT47165.1.
    AY572813 mRNA. Translation: AAT47166.1.
    AY572816 mRNA. Translation: AAT47169.1.
    AY572817 mRNA. Translation: AAT47170.1.
    AY572818 mRNA. Translation: AAT47171.1.
    AY572819 mRNA. Translation: AAT47172.1.
    AY572827 mRNA. Translation: AAT47180.1.
    DQ022681 mRNA. Translation: AAY56401.1.
    HQ692838 mRNA. Translation: ADZ17349.1.
    HQ692839 mRNA. Translation: ADZ17350.1.
    HQ692840 mRNA. Translation: ADZ17351.1.
    HQ692841 mRNA. Translation: ADZ17352.1.
    AL590714 Genomic DNA. Translation: CAH72153.1.
    AL590714 Genomic DNA. Translation: CAH72154.1.
    CH471121 Genomic DNA. Translation: EAW52608.1.
    CH471121 Genomic DNA. Translation: EAW52609.1.
    BC069626 mRNA. Translation: AAH69626.1.
    BC121120 mRNA. Translation: AAI21121.1.
    BC121121 mRNA. Translation: AAI21122.1.
    CCDSiCCDS1228.1. [Q14994-2]
    CCDS41427.1. [Q14994-6]
    CCDS41428.1. [Q14994-3]
    CCDS41429.1. [Q14994-8]
    CCDS41430.1. [Q14994-1]
    CCDS44260.1. [Q14994-12]
    CCDS44261.1. [Q14994-13]
    CCDS44262.1. [Q14994-7]
    CCDS53405.1. [Q14994-15]
    CCDS53406.1. [Q14994-16]
    CCDS53407.1. [Q14994-4]
    CCDS53408.1. [Q14994-9]
    CCDS53409.1. [Q14994-5]
    CCDS53410.1. [Q14994-10]
    CCDS53411.1. [Q14994-11]
    PIRiA56197.
    RefSeqiNP_001070937.1. NM_001077469.2.
    NP_001070938.1. NM_001077470.2. [Q14994-4]
    NP_001070939.1. NM_001077471.2. [Q14994-7]
    NP_001070940.1. NM_001077472.2. [Q14994-6]
    NP_001070941.1. NM_001077473.2. [Q14994-11]
    NP_001070942.1. NM_001077474.2.
    NP_001070943.1. NM_001077475.2.
    NP_001070944.1. NM_001077476.2. [Q14994-10]
    NP_001070945.1. NM_001077477.2. [Q14994-9]
    NP_001070946.1. NM_001077478.2.
    NP_001070947.1. NM_001077479.2. [Q14994-5]
    NP_001070948.1. NM_001077480.2. [Q14994-1]
    NP_001070949.1. NM_001077481.2. [Q14994-3]
    NP_001070950.1. NM_001077482.2. [Q14994-8]
    NP_005113.1. NM_005122.4. [Q14994-2]
    UniGeneiHs.349642.

    Genome annotation databases

    EnsembliENST00000367979; ENSP00000356958; ENSG00000143257. [Q14994-8]
    ENST00000367980; ENSP00000356959; ENSG00000143257. [Q14994-8]
    ENST00000367981; ENSP00000356960; ENSG00000143257. [Q14994-6]
    ENST00000367982; ENSP00000356961; ENSG00000143257. [Q14994-1]
    ENST00000367983; ENSP00000356962; ENSG00000143257. [Q14994-2]
    ENST00000367984; ENSP00000356963; ENSG00000143257. [Q14994-7]
    ENST00000367985; ENSP00000356965; ENSG00000143257. [Q14994-3]
    ENST00000412844; ENSP00000399361; ENSG00000143257. [Q14994-11]
    ENST00000428574; ENSP00000412672; ENSG00000143257. [Q14994-13]
    ENST00000437437; ENSP00000407446; ENSG00000143257. [Q14994-9]
    ENST00000442691; ENSP00000406493; ENSG00000143257. [Q14994-12]
    ENST00000504010; ENSP00000424345; ENSG00000143257. [Q14994-4]
    ENST00000505005; ENSP00000424934; ENSG00000143257. [Q14994-15]
    ENST00000508740; ENSP00000423666; ENSG00000143257. [Q14994-10]
    ENST00000511676; ENSP00000427175; ENSG00000143257. [Q14994-5]
    ENST00000512372; ENSP00000425417; ENSG00000143257. [Q14994-16]
    GeneIDi9970.
    KEGGihsa:9970.
    UCSCiuc001fzh.3. human. [Q14994-6]
    uc001fzj.3. human. [Q14994-5]
    uc001fzl.3. human. [Q14994-4]
    uc001fzp.3. human.
    uc001fzx.3. human. [Q14994-1]
    uc001fzy.3. human. [Q14994-2]
    uc001fzz.3. human. [Q14994-3]
    uc001gab.3. human. [Q14994-7]

    Polymorphism databases

    DMDMi49066046.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Z30425 mRNA. Translation: CAA83016.1 .
    AY572806 mRNA. Translation: AAT47159.1 .
    AY572808 mRNA. Translation: AAT47161.1 .
    AY572810 mRNA. Translation: AAT47163.1 .
    AY572811 mRNA. Translation: AAT47164.1 .
    AY572812 mRNA. Translation: AAT47165.1 .
    AY572813 mRNA. Translation: AAT47166.1 .
    AY572816 mRNA. Translation: AAT47169.1 .
    AY572817 mRNA. Translation: AAT47170.1 .
    AY572818 mRNA. Translation: AAT47171.1 .
    AY572819 mRNA. Translation: AAT47172.1 .
    AY572827 mRNA. Translation: AAT47180.1 .
    DQ022681 mRNA. Translation: AAY56401.1 .
    HQ692838 mRNA. Translation: ADZ17349.1 .
    HQ692839 mRNA. Translation: ADZ17350.1 .
    HQ692840 mRNA. Translation: ADZ17351.1 .
    HQ692841 mRNA. Translation: ADZ17352.1 .
    AL590714 Genomic DNA. Translation: CAH72153.1 .
    AL590714 Genomic DNA. Translation: CAH72154.1 .
    CH471121 Genomic DNA. Translation: EAW52608.1 .
    CH471121 Genomic DNA. Translation: EAW52609.1 .
    BC069626 mRNA. Translation: AAH69626.1 .
    BC121120 mRNA. Translation: AAI21121.1 .
    BC121121 mRNA. Translation: AAI21122.1 .
    CCDSi CCDS1228.1. [Q14994-2 ]
    CCDS41427.1. [Q14994-6 ]
    CCDS41428.1. [Q14994-3 ]
    CCDS41429.1. [Q14994-8 ]
    CCDS41430.1. [Q14994-1 ]
    CCDS44260.1. [Q14994-12 ]
    CCDS44261.1. [Q14994-13 ]
    CCDS44262.1. [Q14994-7 ]
    CCDS53405.1. [Q14994-15 ]
    CCDS53406.1. [Q14994-16 ]
    CCDS53407.1. [Q14994-4 ]
    CCDS53408.1. [Q14994-9 ]
    CCDS53409.1. [Q14994-5 ]
    CCDS53410.1. [Q14994-10 ]
    CCDS53411.1. [Q14994-11 ]
    PIRi A56197.
    RefSeqi NP_001070937.1. NM_001077469.2.
    NP_001070938.1. NM_001077470.2. [Q14994-4 ]
    NP_001070939.1. NM_001077471.2. [Q14994-7 ]
    NP_001070940.1. NM_001077472.2. [Q14994-6 ]
    NP_001070941.1. NM_001077473.2. [Q14994-11 ]
    NP_001070942.1. NM_001077474.2.
    NP_001070943.1. NM_001077475.2.
    NP_001070944.1. NM_001077476.2. [Q14994-10 ]
    NP_001070945.1. NM_001077477.2. [Q14994-9 ]
    NP_001070946.1. NM_001077478.2.
    NP_001070947.1. NM_001077479.2. [Q14994-5 ]
    NP_001070948.1. NM_001077480.2. [Q14994-1 ]
    NP_001070949.1. NM_001077481.2. [Q14994-3 ]
    NP_001070950.1. NM_001077482.2. [Q14994-8 ]
    NP_005113.1. NM_005122.4. [Q14994-2 ]
    UniGenei Hs.349642.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1XV9 X-ray 2.70 B/D 103-352 [» ]
    1XVP X-ray 2.60 B/D 103-352 [» ]
    ProteinModelPortali Q14994.
    SMRi Q14994. Positions 11-352.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115295. 14 interactions.
    IntActi Q14994. 7 interactions.
    STRINGi 9606.ENSP00000356959.

    Chemistry

    BindingDBi Q14994.
    ChEMBLi CHEMBL5503.
    GuidetoPHARMACOLOGYi 607.

    PTM databases

    PhosphoSitei Q14994.

    Polymorphism databases

    DMDMi 49066046.

    Proteomic databases

    PaxDbi Q14994.
    PRIDEi Q14994.

    Protocols and materials databases

    DNASUi 9970.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000367979 ; ENSP00000356958 ; ENSG00000143257 . [Q14994-8 ]
    ENST00000367980 ; ENSP00000356959 ; ENSG00000143257 . [Q14994-8 ]
    ENST00000367981 ; ENSP00000356960 ; ENSG00000143257 . [Q14994-6 ]
    ENST00000367982 ; ENSP00000356961 ; ENSG00000143257 . [Q14994-1 ]
    ENST00000367983 ; ENSP00000356962 ; ENSG00000143257 . [Q14994-2 ]
    ENST00000367984 ; ENSP00000356963 ; ENSG00000143257 . [Q14994-7 ]
    ENST00000367985 ; ENSP00000356965 ; ENSG00000143257 . [Q14994-3 ]
    ENST00000412844 ; ENSP00000399361 ; ENSG00000143257 . [Q14994-11 ]
    ENST00000428574 ; ENSP00000412672 ; ENSG00000143257 . [Q14994-13 ]
    ENST00000437437 ; ENSP00000407446 ; ENSG00000143257 . [Q14994-9 ]
    ENST00000442691 ; ENSP00000406493 ; ENSG00000143257 . [Q14994-12 ]
    ENST00000504010 ; ENSP00000424345 ; ENSG00000143257 . [Q14994-4 ]
    ENST00000505005 ; ENSP00000424934 ; ENSG00000143257 . [Q14994-15 ]
    ENST00000508740 ; ENSP00000423666 ; ENSG00000143257 . [Q14994-10 ]
    ENST00000511676 ; ENSP00000427175 ; ENSG00000143257 . [Q14994-5 ]
    ENST00000512372 ; ENSP00000425417 ; ENSG00000143257 . [Q14994-16 ]
    GeneIDi 9970.
    KEGGi hsa:9970.
    UCSCi uc001fzh.3. human. [Q14994-6 ]
    uc001fzj.3. human. [Q14994-5 ]
    uc001fzl.3. human. [Q14994-4 ]
    uc001fzp.3. human.
    uc001fzx.3. human. [Q14994-1 ]
    uc001fzy.3. human. [Q14994-2 ]
    uc001fzz.3. human. [Q14994-3 ]
    uc001gab.3. human. [Q14994-7 ]

    Organism-specific databases

    CTDi 9970.
    GeneCardsi GC01M161199.
    HGNCi HGNC:7969. NR1I3.
    HPAi HPA051365.
    MIMi 603881. gene.
    neXtProti NX_Q14994.
    PharmGKBi PA391.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG251788.
    HOGENOMi HOG000220844.
    HOVERGENi HBG108655.
    KOi K08541.
    OMAi PRDRFLY.
    PhylomeDBi Q14994.
    TreeFami TF316304.

    Enzyme and pathway databases

    Reactomei REACT_15525. Nuclear Receptor transcription pathway.
    SignaLinki Q14994.

    Miscellaneous databases

    EvolutionaryTracei Q14994.
    GeneWikii Constitutive_androstane_receptor.
    GenomeRNAii 9970.
    NextBioi 37626.
    PROi Q14994.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q14994.
    Bgeei Q14994.
    CleanExi HS_NR1I3.
    Genevestigatori Q14994.

    Family and domain databases

    Gene3Di 1.10.565.10. 1 hit.
    3.30.50.10. 1 hit.
    InterProi IPR008946. Nucl_hormone_rcpt_ligand-bd.
    IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
    IPR001723. Str_hrmn_rcpt.
    IPR001728. ThyrH_rcpt.
    IPR001628. Znf_hrmn_rcpt.
    IPR013088. Znf_NHR/GATA.
    [Graphical view ]
    Pfami PF00104. Hormone_recep. 1 hit.
    PF00105. zf-C4. 1 hit.
    [Graphical view ]
    PRINTSi PR00398. STRDHORMONER.
    PR00047. STROIDFINGER.
    PR00546. THYROIDHORMR.
    SMARTi SM00430. HOLI. 1 hit.
    SM00399. ZnF_C4. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48508. SSF48508. 1 hit.
    PROSITEi PS00031. NUCLEAR_REC_DBD_1. 1 hit.
    PS51030. NUCLEAR_REC_DBD_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A new orphan member of the nuclear hormone receptor superfamily that interacts with a subset of retinoic acid response elements."
      Baes M., Gulick T., Choi H.S., Martinoli M.G., Simha D., Moore D.D.
      Mol. Cell. Biol. 14:1544-1552(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Liver.
    2. "Expression of constitutive androstane receptor splice variants in human tissues and their functional consequences."
      Lamba J.K., Lamba V., Yasuda K., Lin Y.S., Assem M., Thompson E., Strom S., Schuetz E.G.
      J. Pharmacol. Exp. Ther. 311:811-821(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4; 5; 6 AND 7), NUCLEOTIDE SEQUENCE [MRNA] OF 1-288 (ISOFORM 9), NUCLEOTIDE SEQUENCE [MRNA] OF 1-293 (ISOFORM 10), NUCLEOTIDE SEQUENCE [MRNA] OF 1-297 (ISOFORM 11), NUCLEOTIDE SEQUENCE [MRNA] OF 1-321 (ISOFORM 12), NUCLEOTIDE SEQUENCE [MRNA] OF 1-322 (ISOFORM 13), NUCLEOTIDE SEQUENCE [MRNA] OF 1-279 (ISOFORM 14), NUCLEOTIDE SEQUENCE [MRNA] OF 1-266 (ISOFORM 15), ALTERNATIVE SPLICING.
    3. Zhou G., Nong W., Li H., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Huang B., Lin L., Yang S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8).
    4. "Isolation of cDNA coding for multiple human nuclear receptor clones."
      Kaighin V.A., Martin A.L., Aronstam R.S.
      Submitted (DEC-2010) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 7).
      Tissue: Eye and Small intestine.
    5. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 7).
    8. "A component of the 26S proteasome binds on orphan member of the nuclear hormone receptor superfamily."
      Choi H.S., Seol W., Moore D.D.
      J. Steroid Biochem. Mol. Biol. 56:23-30(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH PSMC4.
    9. "Cytoplasmic accumulation of the nuclear receptor CAR by a tetratricopeptide repeat protein in HepG2 cells."
      Kobayashi K., Sueyoshi T., Inoue K., Moore R., Negishi M.
      Mol. Pharmacol. 64:1069-1075(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH DNAJC7, SUBCELLULAR LOCATION.
    10. "Dephosphorylation of threonine 38 is required for nuclear translocation and activation of human xenobiotic receptor CAR (NR1I3)."
      Mutoh S., Osabe M., Inoue K., Moore R., Pedersen L., Perera L., Rebolloso Y., Sueyoshi T., Negishi M.
      J. Biol. Chem. 284:34785-34792(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT THR-38, SUBCELLULAR LOCATION.
    11. "A structural basis for constitutive activity in the human CAR/RXRalpha heterodimer."
      Xu R.X., Lambert M.H., Wisely B.B., Warren E.N., Weinert E.E., Waitt G.M., Williams J.D., Collins J.L., Moore L.B., Willson T.M., Moore J.T.
      Mol. Cell 16:919-928(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 103-352.
    12. Cited for: VARIANT GLY-133.

    Entry informationi

    Entry nameiNR1I3_HUMAN
    AccessioniPrimary (citable) accession number: Q14994
    Secondary accession number(s): E9PB75
    , E9PC13, E9PDU3, E9PGH6, E9PH10, E9PHC8, E9PHN4, F1D8Q0, F1D8Q1, Q0VAC9, Q4U0F0, Q5VTW5, Q5VTW6, Q6GZ68, Q6GZ76, Q6GZ77, Q6GZ78, Q6GZ79, Q6GZ82, Q6GZ83, Q6GZ84, Q6GZ85, Q6GZ87, Q6GZ89
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1999
    Last sequence update: June 21, 2004
    Last modified: October 1, 2014
    This is version 147 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3