Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14994

- NR1I3_HUMAN

UniProt

Q14994 - NR1I3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear receptor subfamily 1 group I member 3

Gene

NR1I3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. Transactivates both the phenobarbital responsive element module of the human CYP2B6 gene and the CYP3A4 xenobiotic response element.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi8 – 8376Nuclear receptorPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri11 – 3121NR C4-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri47 – 7125NR C4-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. androgen receptor activity Source: ProtInc
  2. DNA binding Source: ProtInc
  3. ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity Source: ProtInc
  4. RNA polymerase II regulatory region sequence-specific DNA binding Source: NTNU_SB
  5. RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: NTNU_SB
  6. sequence-specific DNA binding transcription factor activity Source: ProtInc
  7. thyroid hormone receptor activity Source: InterPro
  8. transcription coactivator activity Source: ProtInc
  9. zinc ion binding Source: InterPro

GO - Biological processi

  1. androgen receptor signaling pathway Source: GOC
  2. gene expression Source: Reactome
  3. intracellular receptor signaling pathway Source: GOC
  4. negative regulation of transcription, DNA-templated Source: Ensembl
  5. positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
  6. signal transduction Source: ProtInc
  7. transcription initiation from RNA polymerase II promoter Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Activator, Receptor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_15525. Nuclear Receptor transcription pathway.
SignaLinkiQ14994.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor subfamily 1 group I member 3
Alternative name(s):
Constitutive activator of retinoid response
Short name:
Constitutive active response
Constitutive androstane receptor
Short name:
CAR
Orphan nuclear receptor MB67
Gene namesi
Name:NR1I3
Synonyms:CAR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:7969. NR1I3.

Subcellular locationi

Nucleus. Cytoplasm. Cytoplasmcytoskeleton
Note: Recruited to the cytoplasm by DNAJC7.By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. cytoskeleton Source: UniProtKB-KW
  3. cytosol Source: Ensembl
  4. nucleoplasm Source: Reactome
  5. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA391.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 352352Nuclear receptor subfamily 1 group I member 3PRO_0000053552Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei38 – 381Phosphothreonine; by PKC1 Publication

Post-translational modificationi

Phosphorylated at Thr-38 by PKC, dephosphorylation of Thr-38 is required for nuclear translocation and activation.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ14994.
PRIDEiQ14994.

PTM databases

PhosphoSiteiQ14994.

Expressioni

Tissue specificityi

Predominantly expressed in liver.

Inductioni

By dexamethasone.

Gene expression databases

BgeeiQ14994.
CleanExiHS_NR1I3.
ExpressionAtlasiQ14994. baseline and differential.
GenevestigatoriQ14994.

Organism-specific databases

HPAiHPA051365.

Interactioni

Subunit structurei

Interacts with ECT2 (By similarity). Heterodimer of NR1I3 and RXR. Interacts with PSMC4. Directly interacts with DNAJC7. The DNAJC7-NR1I3 complex may also include HSP90 (By similarity).By similarity

Protein-protein interaction databases

BioGridi115295. 27 interactions.
IntActiQ14994. 7 interactions.
STRINGi9606.ENSP00000356959.

Structurei

Secondary structure

1
352
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi108 – 12215Combined sources
Beta strandi125 – 1273Combined sources
Helixi128 – 1358Combined sources
Helixi139 – 1413Combined sources
Helixi155 – 17622Combined sources
Helixi180 – 1845Combined sources
Helixi187 – 20620Combined sources
Helixi207 – 2093Combined sources
Turni212 – 2154Combined sources
Beta strandi216 – 2183Combined sources
Beta strandi222 – 2243Combined sources
Helixi226 – 2316Combined sources
Helixi240 – 25516Combined sources
Helixi260 – 27112Combined sources
Beta strandi274 – 2763Combined sources
Helixi282 – 30120Combined sources
Helixi312 – 33625Combined sources
Helixi340 – 3434Combined sources
Helixi345 – 3506Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1XV9X-ray2.70B/D103-352[»]
1XVPX-ray2.60B/D103-352[»]
ProteinModelPortaliQ14994.
SMRiQ14994. Positions 11-352.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14994.

Family & Domainsi

Domaini

Composed by a short N-terminal domain followed by the DNA binding, hinge, and ligand binding/dimerization domains.

Sequence similaritiesi

Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri11 – 3121NR C4-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri47 – 7125NR C4-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiNOG251788.
GeneTreeiENSGT00760000118837.
HOGENOMiHOG000220844.
HOVERGENiHBG108655.
InParanoidiQ14994.
KOiK08541.
OMAiPRDRFLY.
PhylomeDBiQ14994.
TreeFamiTF316304.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR008946. Nucl_hormone_rcpt_ligand-bd.
IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
IPR001723. Str_hrmn_rcpt.
IPR001728. ThyrH_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
PR00546. THYROIDHORMR.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (15)i

Sequence statusi: Complete.

This entry describes 15 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q14994-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASREDELRN CVVCGDQATG YHFNALTCEG CKGFFRRTVS KSIGPTCPFA
60 70 80 90 100
GSCEVSKTQR RHCPACRLQK CLDAGMRKDM ILSAEALALR RAKQAQRRAQ
110 120 130 140 150
QTPVQLSKEQ EELIRTLLGA HTRHMGTMFE QFVQFRPPAH LFIHHQPLPT
160 170 180 190 200
LAPVLPLVTH FADINTFMVL QVIKFTKDLP VFRSLPIEDQ ISLLKGAAVE
210 220 230 240 250
ICHIVLNTTF CLQTQNFLCG PLRYTIEDGA RVSPTVGFQV EFLELLFHFH
260 270 280 290 300
GTLRKLQLQE PEYVLLAAMA LFSPDRPGVT QRDEIDQLQE EMALTLQSYI
310 320 330 340 350
KGQQRRPRDR FLYAKLLGLL AELRSINEAY GYQIQHIQGL SAMMPLLQEI

CS
Length:352
Mass (Da):39,942
Last modified:June 21, 2004 - v2
Checksum:i73B060FE4950D519
GO
Isoform 2 (identifier: Q14994-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-236: Missing.

Show »
Length:348
Mass (Da):39,558
Checksum:i92EAAD07D7DCB9DA
GO
Isoform 3 (identifier: Q14994-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-274: VSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSP → APYLT

Show »
Length:314
Mass (Da):35,588
Checksum:iEE9F842EF2B19A2E
GO
Isoform 4 (identifier: Q14994-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     232-274: Missing.

Show »
Length:280
Mass (Da):31,900
Checksum:i7F3BFA4F60A16FB1
GO
Isoform 5 (identifier: Q14994-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.

Show »
Length:319
Mass (Da):36,416
Checksum:iC41CFFC814E96E46
GO
Isoform 6 (identifier: Q14994-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.
     274-274: P → PAPYLT

Show »
Length:324
Mass (Da):36,961
Checksum:i32245F1A8C523B1E
GO
Isoform 7 (identifier: Q14994-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-274: Missing.

Show »
Length:309
Mass (Da):35,043
Checksum:i47BDCF4FC3777574
GO
Isoform 8 (identifier: Q14994-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     274-274: P → PAPYLT

Show »
Length:357
Mass (Da):40,488
Checksum:i1AF956D0A2759781
GO
Isoform 9 (identifier: Q14994-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:306
Mass (Da):34,778
Checksum:iEA8397560E3A2AC1
GO
Isoform 10 (identifier: Q14994-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     233-236: Missing.
     274-274: P → PAPYLT
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:311
Mass (Da):35,323
Checksum:i88A1BD387DDFFF8B
GO
Isoform 11 (identifier: Q14994-11) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     274-274: P → PAPYLT
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:315
Mass (Da):35,708
Checksum:iA90FF3A0E39D1305
GO
Isoform 12 (identifier: Q14994-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:339
Mass (Da):38,304
Checksum:iAEDAD58E1ECA2D6E
GO
Isoform 13 (identifier: Q14994-13) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-235: Missing.
     274-274: P → PAPYLT
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:340
Mass (Da):38,466
Checksum:iC13708F49C3A2145
GO
Isoform 14 (identifier: Q14994-15) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-274: Missing.
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:296
Mass (Da):33,405
Checksum:i3D8FC1261A54C270
GO
Isoform 15 (identifier: Q14994-16) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS
     232-274: Missing.
     311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ

Show »
Length:267
Mass (Da):30,262
Checksum:i97343837A4943EFE
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti133 – 1331V → G.1 Publication
VAR_018344

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3535MASRE…CKGFF → MLPKRS in isoform 4, isoform 5, isoform 6, isoform 9, isoform 10, isoform 11 and isoform 15. 1 PublicationVSP_043730Add
BLAST
Alternative sequencei232 – 27443VSPTV…ALFSP → APYLT in isoform 3. 2 PublicationsVSP_043144Add
BLAST
Alternative sequencei232 – 27443Missing in isoform 4, isoform 7, isoform 14 and isoform 15. 3 PublicationsVSP_043731Add
BLAST
Alternative sequencei232 – 2354Missing in isoform 13. 1 PublicationVSP_055180
Alternative sequencei233 – 2364Missing in isoform 2, isoform 5, isoform 6, isoform 9 and isoform 10. 3 PublicationsVSP_010634
Alternative sequencei274 – 2741P → PAPYLT in isoform 6, isoform 8, isoform 10, isoform 11 and isoform 13. 2 PublicationsVSP_043732
Alternative sequencei311 – 35242FLYAK…QEICS → SPGTPWIHWSGKMLGPKIGP GSKGAQWLQ in isoform 9, isoform 10, isoform 11, isoform 12, isoform 13, isoform 14 and isoform 15. 1 PublicationVSP_046144Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z30425 mRNA. Translation: CAA83016.1.
AY572806 mRNA. Translation: AAT47159.1.
AY572808 mRNA. Translation: AAT47161.1.
AY572810 mRNA. Translation: AAT47163.1.
AY572811 mRNA. Translation: AAT47164.1.
AY572812 mRNA. Translation: AAT47165.1.
AY572813 mRNA. Translation: AAT47166.1.
AY572816 mRNA. Translation: AAT47169.1.
AY572817 mRNA. Translation: AAT47170.1.
AY572818 mRNA. Translation: AAT47171.1.
AY572819 mRNA. Translation: AAT47172.1.
AY572827 mRNA. Translation: AAT47180.1.
DQ022681 mRNA. Translation: AAY56401.1.
HQ692838 mRNA. Translation: ADZ17349.1.
HQ692839 mRNA. Translation: ADZ17350.1.
HQ692840 mRNA. Translation: ADZ17351.1.
HQ692841 mRNA. Translation: ADZ17352.1.
AL590714 Genomic DNA. Translation: CAH72153.1.
AL590714 Genomic DNA. Translation: CAH72154.1.
CH471121 Genomic DNA. Translation: EAW52608.1.
CH471121 Genomic DNA. Translation: EAW52609.1.
BC069626 mRNA. Translation: AAH69626.1.
BC121120 mRNA. Translation: AAI21121.1.
BC121121 mRNA. Translation: AAI21122.1.
CCDSiCCDS1228.1. [Q14994-2]
CCDS41427.1. [Q14994-6]
CCDS41428.1. [Q14994-3]
CCDS41429.1. [Q14994-8]
CCDS41430.1. [Q14994-1]
CCDS44260.1. [Q14994-12]
CCDS44261.1. [Q14994-13]
CCDS44262.1. [Q14994-7]
CCDS53405.1. [Q14994-15]
CCDS53406.1. [Q14994-16]
CCDS53407.1. [Q14994-4]
CCDS53408.1. [Q14994-9]
CCDS53409.1. [Q14994-5]
CCDS53410.1. [Q14994-10]
CCDS53411.1. [Q14994-11]
PIRiA56197.
RefSeqiNP_001070937.1. NM_001077469.2. [Q14994-13]
NP_001070938.1. NM_001077470.2. [Q14994-4]
NP_001070939.1. NM_001077471.2. [Q14994-7]
NP_001070940.1. NM_001077472.2. [Q14994-6]
NP_001070941.1. NM_001077473.2. [Q14994-11]
NP_001070942.1. NM_001077474.2. [Q14994-15]
NP_001070943.1. NM_001077475.2. [Q14994-16]
NP_001070944.1. NM_001077476.2. [Q14994-10]
NP_001070945.1. NM_001077477.2. [Q14994-9]
NP_001070946.1. NM_001077478.2. [Q14994-12]
NP_001070947.1. NM_001077479.2. [Q14994-5]
NP_001070948.1. NM_001077480.2. [Q14994-1]
NP_001070949.1. NM_001077481.2. [Q14994-3]
NP_001070950.1. NM_001077482.2. [Q14994-8]
NP_005113.1. NM_005122.4. [Q14994-2]
UniGeneiHs.349642.

Genome annotation databases

EnsembliENST00000367979; ENSP00000356958; ENSG00000143257. [Q14994-8]
ENST00000367980; ENSP00000356959; ENSG00000143257. [Q14994-8]
ENST00000367981; ENSP00000356960; ENSG00000143257. [Q14994-6]
ENST00000367982; ENSP00000356961; ENSG00000143257. [Q14994-1]
ENST00000367983; ENSP00000356962; ENSG00000143257. [Q14994-2]
ENST00000367984; ENSP00000356963; ENSG00000143257. [Q14994-7]
ENST00000367985; ENSP00000356965; ENSG00000143257. [Q14994-3]
ENST00000412844; ENSP00000399361; ENSG00000143257. [Q14994-11]
ENST00000428574; ENSP00000412672; ENSG00000143257. [Q14994-13]
ENST00000437437; ENSP00000407446; ENSG00000143257. [Q14994-9]
ENST00000442691; ENSP00000406493; ENSG00000143257. [Q14994-12]
ENST00000504010; ENSP00000424345; ENSG00000143257. [Q14994-4]
ENST00000505005; ENSP00000424934; ENSG00000143257. [Q14994-15]
ENST00000508740; ENSP00000423666; ENSG00000143257. [Q14994-10]
ENST00000511676; ENSP00000427175; ENSG00000143257. [Q14994-5]
ENST00000512372; ENSP00000425417; ENSG00000143257. [Q14994-16]
GeneIDi9970.
KEGGihsa:9970.
UCSCiuc001fzh.3. human. [Q14994-6]
uc001fzj.3. human. [Q14994-5]
uc001fzl.3. human. [Q14994-4]
uc001fzp.3. human.
uc001fzx.3. human. [Q14994-1]
uc001fzy.3. human. [Q14994-2]
uc001fzz.3. human. [Q14994-3]
uc001gab.3. human. [Q14994-7]

Polymorphism databases

DMDMi49066046.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z30425 mRNA. Translation: CAA83016.1 .
AY572806 mRNA. Translation: AAT47159.1 .
AY572808 mRNA. Translation: AAT47161.1 .
AY572810 mRNA. Translation: AAT47163.1 .
AY572811 mRNA. Translation: AAT47164.1 .
AY572812 mRNA. Translation: AAT47165.1 .
AY572813 mRNA. Translation: AAT47166.1 .
AY572816 mRNA. Translation: AAT47169.1 .
AY572817 mRNA. Translation: AAT47170.1 .
AY572818 mRNA. Translation: AAT47171.1 .
AY572819 mRNA. Translation: AAT47172.1 .
AY572827 mRNA. Translation: AAT47180.1 .
DQ022681 mRNA. Translation: AAY56401.1 .
HQ692838 mRNA. Translation: ADZ17349.1 .
HQ692839 mRNA. Translation: ADZ17350.1 .
HQ692840 mRNA. Translation: ADZ17351.1 .
HQ692841 mRNA. Translation: ADZ17352.1 .
AL590714 Genomic DNA. Translation: CAH72153.1 .
AL590714 Genomic DNA. Translation: CAH72154.1 .
CH471121 Genomic DNA. Translation: EAW52608.1 .
CH471121 Genomic DNA. Translation: EAW52609.1 .
BC069626 mRNA. Translation: AAH69626.1 .
BC121120 mRNA. Translation: AAI21121.1 .
BC121121 mRNA. Translation: AAI21122.1 .
CCDSi CCDS1228.1. [Q14994-2 ]
CCDS41427.1. [Q14994-6 ]
CCDS41428.1. [Q14994-3 ]
CCDS41429.1. [Q14994-8 ]
CCDS41430.1. [Q14994-1 ]
CCDS44260.1. [Q14994-12 ]
CCDS44261.1. [Q14994-13 ]
CCDS44262.1. [Q14994-7 ]
CCDS53405.1. [Q14994-15 ]
CCDS53406.1. [Q14994-16 ]
CCDS53407.1. [Q14994-4 ]
CCDS53408.1. [Q14994-9 ]
CCDS53409.1. [Q14994-5 ]
CCDS53410.1. [Q14994-10 ]
CCDS53411.1. [Q14994-11 ]
PIRi A56197.
RefSeqi NP_001070937.1. NM_001077469.2. [Q14994-13 ]
NP_001070938.1. NM_001077470.2. [Q14994-4 ]
NP_001070939.1. NM_001077471.2. [Q14994-7 ]
NP_001070940.1. NM_001077472.2. [Q14994-6 ]
NP_001070941.1. NM_001077473.2. [Q14994-11 ]
NP_001070942.1. NM_001077474.2. [Q14994-15 ]
NP_001070943.1. NM_001077475.2. [Q14994-16 ]
NP_001070944.1. NM_001077476.2. [Q14994-10 ]
NP_001070945.1. NM_001077477.2. [Q14994-9 ]
NP_001070946.1. NM_001077478.2. [Q14994-12 ]
NP_001070947.1. NM_001077479.2. [Q14994-5 ]
NP_001070948.1. NM_001077480.2. [Q14994-1 ]
NP_001070949.1. NM_001077481.2. [Q14994-3 ]
NP_001070950.1. NM_001077482.2. [Q14994-8 ]
NP_005113.1. NM_005122.4. [Q14994-2 ]
UniGenei Hs.349642.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1XV9 X-ray 2.70 B/D 103-352 [» ]
1XVP X-ray 2.60 B/D 103-352 [» ]
ProteinModelPortali Q14994.
SMRi Q14994. Positions 11-352.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115295. 27 interactions.
IntActi Q14994. 7 interactions.
STRINGi 9606.ENSP00000356959.

Chemistry

BindingDBi Q14994.
ChEMBLi CHEMBL5503.
GuidetoPHARMACOLOGYi 607.

PTM databases

PhosphoSitei Q14994.

Polymorphism databases

DMDMi 49066046.

Proteomic databases

PaxDbi Q14994.
PRIDEi Q14994.

Protocols and materials databases

DNASUi 9970.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000367979 ; ENSP00000356958 ; ENSG00000143257 . [Q14994-8 ]
ENST00000367980 ; ENSP00000356959 ; ENSG00000143257 . [Q14994-8 ]
ENST00000367981 ; ENSP00000356960 ; ENSG00000143257 . [Q14994-6 ]
ENST00000367982 ; ENSP00000356961 ; ENSG00000143257 . [Q14994-1 ]
ENST00000367983 ; ENSP00000356962 ; ENSG00000143257 . [Q14994-2 ]
ENST00000367984 ; ENSP00000356963 ; ENSG00000143257 . [Q14994-7 ]
ENST00000367985 ; ENSP00000356965 ; ENSG00000143257 . [Q14994-3 ]
ENST00000412844 ; ENSP00000399361 ; ENSG00000143257 . [Q14994-11 ]
ENST00000428574 ; ENSP00000412672 ; ENSG00000143257 . [Q14994-13 ]
ENST00000437437 ; ENSP00000407446 ; ENSG00000143257 . [Q14994-9 ]
ENST00000442691 ; ENSP00000406493 ; ENSG00000143257 . [Q14994-12 ]
ENST00000504010 ; ENSP00000424345 ; ENSG00000143257 . [Q14994-4 ]
ENST00000505005 ; ENSP00000424934 ; ENSG00000143257 . [Q14994-15 ]
ENST00000508740 ; ENSP00000423666 ; ENSG00000143257 . [Q14994-10 ]
ENST00000511676 ; ENSP00000427175 ; ENSG00000143257 . [Q14994-5 ]
ENST00000512372 ; ENSP00000425417 ; ENSG00000143257 . [Q14994-16 ]
GeneIDi 9970.
KEGGi hsa:9970.
UCSCi uc001fzh.3. human. [Q14994-6 ]
uc001fzj.3. human. [Q14994-5 ]
uc001fzl.3. human. [Q14994-4 ]
uc001fzp.3. human.
uc001fzx.3. human. [Q14994-1 ]
uc001fzy.3. human. [Q14994-2 ]
uc001fzz.3. human. [Q14994-3 ]
uc001gab.3. human. [Q14994-7 ]

Organism-specific databases

CTDi 9970.
GeneCardsi GC01M161199.
HGNCi HGNC:7969. NR1I3.
HPAi HPA051365.
MIMi 603881. gene.
neXtProti NX_Q14994.
PharmGKBi PA391.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG251788.
GeneTreei ENSGT00760000118837.
HOGENOMi HOG000220844.
HOVERGENi HBG108655.
InParanoidi Q14994.
KOi K08541.
OMAi PRDRFLY.
PhylomeDBi Q14994.
TreeFami TF316304.

Enzyme and pathway databases

Reactomei REACT_15525. Nuclear Receptor transcription pathway.
SignaLinki Q14994.

Miscellaneous databases

EvolutionaryTracei Q14994.
GeneWikii Constitutive_androstane_receptor.
GenomeRNAii 9970.
NextBioi 37626.
PROi Q14994.
SOURCEi Search...

Gene expression databases

Bgeei Q14994.
CleanExi HS_NR1I3.
ExpressionAtlasi Q14994. baseline and differential.
Genevestigatori Q14994.

Family and domain databases

Gene3Di 1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProi IPR008946. Nucl_hormone_rcpt_ligand-bd.
IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
IPR001723. Str_hrmn_rcpt.
IPR001728. ThyrH_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view ]
Pfami PF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view ]
PRINTSi PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
PR00546. THYROIDHORMR.
SMARTi SM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view ]
SUPFAMi SSF48508. SSF48508. 1 hit.
PROSITEi PS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A new orphan member of the nuclear hormone receptor superfamily that interacts with a subset of retinoic acid response elements."
    Baes M., Gulick T., Choi H.S., Martinoli M.G., Simha D., Moore D.D.
    Mol. Cell. Biol. 14:1544-1552(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Liver.
  2. "Expression of constitutive androstane receptor splice variants in human tissues and their functional consequences."
    Lamba J.K., Lamba V., Yasuda K., Lin Y.S., Assem M., Thompson E., Strom S., Schuetz E.G.
    J. Pharmacol. Exp. Ther. 311:811-821(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4; 5; 6 AND 7), NUCLEOTIDE SEQUENCE [MRNA] OF 1-288 (ISOFORM 9), NUCLEOTIDE SEQUENCE [MRNA] OF 1-293 (ISOFORM 10), NUCLEOTIDE SEQUENCE [MRNA] OF 1-297 (ISOFORM 11), NUCLEOTIDE SEQUENCE [MRNA] OF 1-321 (ISOFORM 12), NUCLEOTIDE SEQUENCE [MRNA] OF 1-322 (ISOFORM 13), NUCLEOTIDE SEQUENCE [MRNA] OF 1-279 (ISOFORM 14), NUCLEOTIDE SEQUENCE [MRNA] OF 1-266 (ISOFORM 15), ALTERNATIVE SPLICING.
  3. Zhou G., Nong W., Li H., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Huang B., Lin L., Yang S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8).
  4. "Isolation of cDNA coding for multiple human nuclear receptor clones."
    Kaighin V.A., Martin A.L., Aronstam R.S.
    Submitted (DEC-2010) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 7).
    Tissue: Eye and Small intestine.
  5. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 7).
  8. "A component of the 26S proteasome binds on orphan member of the nuclear hormone receptor superfamily."
    Choi H.S., Seol W., Moore D.D.
    J. Steroid Biochem. Mol. Biol. 56:23-30(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PSMC4.
  9. "Cytoplasmic accumulation of the nuclear receptor CAR by a tetratricopeptide repeat protein in HepG2 cells."
    Kobayashi K., Sueyoshi T., Inoue K., Moore R., Negishi M.
    Mol. Pharmacol. 64:1069-1075(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DNAJC7, SUBCELLULAR LOCATION.
  10. "Dephosphorylation of threonine 38 is required for nuclear translocation and activation of human xenobiotic receptor CAR (NR1I3)."
    Mutoh S., Osabe M., Inoue K., Moore R., Pedersen L., Perera L., Rebolloso Y., Sueyoshi T., Negishi M.
    J. Biol. Chem. 284:34785-34792(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT THR-38, SUBCELLULAR LOCATION.
  11. "A structural basis for constitutive activity in the human CAR/RXRalpha heterodimer."
    Xu R.X., Lambert M.H., Wisely B.B., Warren E.N., Weinert E.E., Waitt G.M., Williams J.D., Collins J.L., Moore L.B., Willson T.M., Moore J.T.
    Mol. Cell 16:919-928(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 103-352.
  12. Cited for: VARIANT GLY-133.

Entry informationi

Entry nameiNR1I3_HUMAN
AccessioniPrimary (citable) accession number: Q14994
Secondary accession number(s): E9PB75
, E9PC13, E9PDU3, E9PGH6, E9PH10, E9PHC8, E9PHN4, F1D8Q0, F1D8Q1, Q0VAC9, Q4U0F0, Q5VTW5, Q5VTW6, Q6GZ68, Q6GZ76, Q6GZ77, Q6GZ78, Q6GZ79, Q6GZ82, Q6GZ83, Q6GZ84, Q6GZ85, Q6GZ87, Q6GZ89
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 21, 2004
Last modified: November 26, 2014
This is version 149 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3