Q14994 (NR1I3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear receptor subfamily 1 group I member 3 Alternative name(s): Constitutive activator of retinoid response Short name=Constitutive active response Constitutive androstane receptor Short name=CAR Orphan nuclear receptor MB67 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 352 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. Transactivates both the phenobarbital responsive element module of the human CYP2B6 gene and the CYP3A4 xenobiotic response element. |
| Subunit structure | Interacts with ECT2 By similarity. Heterodimer of NR1I3 and RXR. Interacts with PSMC4. Directly interacts with DNAJC7. The DNAJC7-NR1I3 complex may also include HSP90 By similarity. Ref.8 Ref.9 |
| Subcellular location | Nucleus. Cytoplasm. Cytoplasm › cytoskeleton. Note: Recruited to the cytoplasm by DNAJC7 By similarity. Ref.9 Ref.10 |
| Tissue specificity | Predominantly expressed in liver. |
| Induction | By dexamethasone. |
| Domain | Composed by a short N-terminal domain followed by the DNA binding, hinge, and ligand binding/dimerization domains. |
| Post-translational modification | Phosphorylated at Thr-38 by PKC, dephosphorylation of Thr-38 is required for nuclear translocation and activation. Ref.10 |
| Sequence similarities | Belongs to the nuclear hormone receptor family. NR1 subfamily. Contains 1 nuclear receptor DNA-binding domain. |
Ontologies
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q14994-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q14994-2) The sequence of this isoform differs from the canonical sequence as follows: 233-236: Missing. | ||||||
| Isoform 3 (identifier: Q14994-3) The sequence of this isoform differs from the canonical sequence as follows: 232-274: VSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSP → APYLT | ||||||
| Isoform 4 (identifier: Q14994-4) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS 232-274: Missing. | ||||||
| Isoform 5 (identifier: Q14994-5) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS 233-236: Missing. | ||||||
| Isoform 6 (identifier: Q14994-6) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS 233-236: Missing. 274-274: P → PAPYLT | ||||||
| Isoform 7 (identifier: Q14994-7) The sequence of this isoform differs from the canonical sequence as follows: 232-274: Missing. | ||||||
| Isoform 8 (identifier: Q14994-8) The sequence of this isoform differs from the canonical sequence as follows: 274-274: P → PAPYLT | ||||||
| Isoform 9 (identifier: Q14994-9) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS 233-236: Missing. 311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ | ||||||
| Isoform 10 (identifier: Q14994-10) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS 233-236: Missing. 274-274: P → PAPYLT 311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ | ||||||
| Isoform 11 (identifier: Q14994-11) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFF → MLPKRS 274-274: P → PAPYLT 311-352: FLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS → SPGTPWIHWSGKMLGPKIGPGSKGAQWLQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 352 | 352 | Nuclear receptor subfamily 1 group I member 3 | PRO_0000053552 | ||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 8 – 83 | 76 | Nuclear receptor | |||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 11 – 31 | 21 | NR C4-type | |||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 47 – 71 | 25 | NR C4-type | |||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 38 | 1 | Phosphothreonine; by PKC Ref.10 | |||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 35 | 35 | MASRE…CKGFF → MLPKRS in isoform 4, isoform 5, isoform 6, isoform 9, isoform 10 and isoform 11. | VSP_043730 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 232 – 274 | 43 | VSPTV…ALFSP → APYLT in isoform 3. | VSP_043144 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 232 – 274 | 43 | Missing in isoform 4 and isoform 7. | VSP_043731 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 233 – 236 | 4 | Missing in isoform 2, isoform 5, isoform 6, isoform 9 and isoform 10. | VSP_010634 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 274 | 1 | P → PAPYLT in isoform 6, isoform 8, isoform 10 and isoform 11. | VSP_043732 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 311 – 352 | 42 | FLYAK…QEICS → SPGTPWIHWSGKMLGPKIGP GSKGAQWLQ in isoform 9, isoform 10 and isoform 11. | VSP_046144 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 133 | 1 | V → G. Ref.12 | VAR_018344 | ||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 108 – 122 | 15 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 125 – 127 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 128 – 135 | 8 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 139 – 141 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 155 – 176 | 22 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 180 – 184 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 187 – 206 | 20 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 207 – 209 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 212 – 215 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 218 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 222 – 224 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 226 – 231 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 240 – 255 | 16 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 260 – 271 | 12 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 274 – 276 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 282 – 301 | 20 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 312 – 336 | 25 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 340 – 343 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 345 – 350 | 6 | ||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A new orphan member of the nuclear hormone receptor superfamily that interacts with a subset of retinoic acid response elements." Baes M., Gulick T., Choi H.S., Martinoli M.G., Simha D., Moore D.D. Mol. Cell. Biol. 14:1544-1552(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Liver. |
| [2] | "Expression of constitutive androstane receptor splice variants in human tissues and their functional consequences." Lamba J.K., Lamba V., Yasuda K., Lin Y.S., Assem M., Thompson E., Strom S., Schuetz E.G. J. Pharmacol. Exp. Ther. 311:811-821(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4; 5; 6 AND 7), NUCLEOTIDE SEQUENCE [MRNA] OF 1-288 (ISOFORM 9), NUCLEOTIDE SEQUENCE [MRNA] OF 1-293 (ISOFORM 10), NUCLEOTIDE SEQUENCE [MRNA] OF 1-297 (ISOFORM 11), ALTERNATIVE SPLICING. |
| [3] | Zhou G., Nong W., Li H., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Huang B., Lin L., Yang S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8). |
| [4] | "Isolation of cDNA coding for multiple human nuclear receptor clones." Kaighin V.A., Martin A.L., Aronstam R.S. Submitted (DEC-2010) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 7). Tissue: Eye and Small intestine. |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 7). |
| [8] | "A component of the 26S proteasome binds on orphan member of the nuclear hormone receptor superfamily." Choi H.S., Seol W., Moore D.D. J. Steroid Biochem. Mol. Biol. 56:23-30(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PSMC4. |
| [9] | "Cytoplasmic accumulation of the nuclear receptor CAR by a tetratricopeptide repeat protein in HepG2 cells." Kobayashi K., Sueyoshi T., Inoue K., Moore R., Negishi M. Mol. Pharmacol. 64:1069-1075(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DNAJC7, SUBCELLULAR LOCATION. |
| [10] | "Dephosphorylation of threonine 38 is required for nuclear translocation and activation of human xenobiotic receptor CAR (NR1I3)." Mutoh S., Osabe M., Inoue K., Moore R., Pedersen L., Perera L., Rebolloso Y., Sueyoshi T., Negishi M. J. Biol. Chem. 284:34785-34792(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-38, SUBCELLULAR LOCATION. |
| [11] | "A structural basis for constitutive activity in the human CAR/RXRalpha heterodimer." Xu R.X., Lambert M.H., Wisely B.B., Warren E.N., Weinert E.E., Waitt G.M., Williams J.D., Collins J.L., Moore L.B., Willson T.M., Moore J.T. Mol. Cell 16:919-928(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 103-352. |
| [12] | "Twenty-six novel single nucleotide polymorphisms and their frequencies of the NR1I3 (CAR) gene in a Japanese population." Ikeda S., Kurose K., Ozawa S., Sai K., Hasegawa R., Komamura K., Ueno K., Kamakura S., Kitakaze M., Tomoike H., Nakajima T., Matsumoto K., Saito H., Goto Y., Kimura H., Katoh M., Sugai K., Minami N. Sawada J.Drug Metab. Pharmacokinet. 18:413-418(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GLY-133. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Z30425 mRNA. Translation: CAA83016.1. AY572808 mRNA. Translation: AAT47161.1. AY572810 mRNA. Translation: AAT47163.1. AY572811 mRNA. Translation: AAT47164.1. AY572812 mRNA. Translation: AAT47165.1. AY572817 mRNA. Translation: AAT47170.1. AY572818 mRNA. Translation: AAT47171.1. AY572827 mRNA. Translation: AAT47180.1. DQ022681 mRNA. Translation: AAY56401.1. HQ692838 mRNA. Translation: ADZ17349.1. HQ692839 mRNA. Translation: ADZ17350.1. HQ692840 mRNA. Translation: ADZ17351.1. HQ692841 mRNA. Translation: ADZ17352.1. AL590714 Genomic DNA. Translation: CAH72153.1. AL590714 Genomic DNA. Translation: CAH72154.1. CH471121 Genomic DNA. Translation: EAW52608.1. CH471121 Genomic DNA. Translation: EAW52609.1. BC069626 mRNA. Translation: AAH69626.1. BC121120 mRNA. Translation: AAI21121.1. BC121121 mRNA. Translation: AAI21122.1. | ||||||||||||||||||
| IPI | IPI00001687. IPI00418379. IPI00434598. IPI00815775. IPI00815841. IPI00816112. IPI00816473. IPI00816486. IPI00816695. IPI00816828. | ||||||||||||||||||
| PIR | A56197. | ||||||||||||||||||
| RefSeq | NP_001070938.1. NM_001077470.2. NP_001070939.1. NM_001077471.2. NP_001070940.1. NM_001077472.2. NP_001070941.1. NM_001077473.2. NP_001070944.1. NM_001077476.2. NP_001070945.1. NM_001077477.2. NP_001070947.1. NM_001077479.2. NP_001070948.1. NM_001077480.2. NP_001070949.1. NM_001077481.2. NP_001070950.1. NM_001077482.2. NP_005113.1. NM_005122.4. | ||||||||||||||||||
| UniGene | Hs.349642. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q14994. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q14994. 7 interactions. | ||||||||||||||||||
| STRING | 9606.ENSP00000356959. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q14994. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 49066046. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q14994. | ||||||||||||||||||
| PRIDE | Q14994. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 9970. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000367979; ENSP00000356958; ENSG00000143257. ENST00000367980; ENSP00000356959; ENSG00000143257. ENST00000367981; ENSP00000356960; ENSG00000143257. ENST00000367982; ENSP00000356961; ENSG00000143257. ENST00000367983; ENSP00000356962; ENSG00000143257. ENST00000367984; ENSP00000356963; ENSG00000143257. ENST00000367985; ENSP00000356965; ENSG00000143257. ENST00000412844; ENSP00000399361; ENSG00000143257. ENST00000437437; ENSP00000407446; ENSG00000143257. ENST00000504010; ENSP00000424345; ENSG00000143257. ENST00000508740; ENSP00000423666; ENSG00000143257. ENST00000511676; ENSP00000427175; ENSG00000143257. | ||||||||||||||||||
| GeneID | 9970. | ||||||||||||||||||
| KEGG | hsa:9970. | ||||||||||||||||||
| UCSC | uc001fzx.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 9970. | ||||||||||||||||||
| GeneCards | GC01M161199. | ||||||||||||||||||
| HGNC | HGNC:7969. NR1I3. | ||||||||||||||||||
| HPA | HPA051365. | ||||||||||||||||||
| MIM | 603881. gene. | ||||||||||||||||||
| neXtProt | NX_Q14994. | ||||||||||||||||||
| PharmGKB | PA391. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG251788. | ||||||||||||||||||
| HOGENOM | HOG000220844. | ||||||||||||||||||
| HOVERGEN | HBG108655. | ||||||||||||||||||
| KO | K08541. | ||||||||||||||||||
| OMA | PRDRFLY. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_71. Gene Expression. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q14994. | ||||||||||||||||||
| Bgee | Q14994. | ||||||||||||||||||
| CleanEx | HS_NR1I3. | ||||||||||||||||||
| Genevestigator | Q14994. | ||||||||||||||||||
| GermOnline | ENSG00000143257. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.10.565.10. 1 hit. 3.30.50.10. 1 hit. | ||||||||||||||||||
| InterPro | IPR008946. Nucl_hormone_rcpt_ligand-bd. IPR000536. Nucl_hrmn_rcpt_lig-bd_core. IPR001723. Str_hrmn_rcpt. IPR001728. ThyrH_rcpt. IPR001628. Znf_hrmn_rcpt. IPR013088. Znf_NHR/GATA. [Graphical view] | ||||||||||||||||||
| Pfam | PF00104. Hormone_recep. 1 hit. PF00105. zf-C4. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00398. STRDHORMONER. PR00047. STROIDFINGER. PR00546. THYROIDHORMR. | ||||||||||||||||||
| SMART | SM00430. HOLI. 1 hit. SM00399. ZnF_C4. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF48508. Str_ncl_receptor. 1 hit. | ||||||||||||||||||
| PROSITE | PS00031. NUCLEAR_REC_DBD_1. 1 hit. PS51030. NUCLEAR_REC_DBD_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| BindingDB | Q14994. | ||||||||||||||||||
| ChEMBL | CHEMBL5503. | ||||||||||||||||||
| EvolutionaryTrace | Q14994. | ||||||||||||||||||
| GenomeRNAi | 9970. | ||||||||||||||||||
| NextBio | 37626. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | NR1I3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14994 Secondary accession number(s): E9PGH6 Q6GZ87 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
