Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q14934

- NFAC4_HUMAN

UniProt

Q14934 - NFAC4_HUMAN

Protein

Nuclear factor of activated T-cells, cytoplasmic 4

Gene

NFATC4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 137 (01 Oct 2014)
      Sequence version 2 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 and IL-4. Transcriptionally repressed by estrogen receptors; this inhibition is further enhanced by estrogen. Increases the transcriptional activity of PPARG and has a direct role in adipocyte differentiation. May play an important role in myotube differentiation. May play a critical role in cardiac development and hypertrophy. May play a role in deafferentation-induced apoptosis of sensory neurons.4 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi430 – 4378

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. protein binding Source: IntAct
    3. sequence-specific DNA binding RNA polymerase II transcription factor activity Source: Ensembl
    4. transcription coactivator activity Source: ProtInc

    GO - Biological processi

    1. cellular respiration Source: Ensembl
    2. cellular response to lithium ion Source: Ensembl
    3. cellular response to UV Source: Ensembl
    4. heart development Source: Ensembl
    5. inflammatory response Source: ProtInc
    6. intrinsic apoptotic signaling pathway in response to DNA damage Source: Ensembl
    7. muscle cell development Source: Ensembl
    8. patterning of blood vessels Source: Ensembl
    9. positive regulation of apoptotic process Source: Ensembl
    10. positive regulation of apoptotic signaling pathway Source: Ensembl
    11. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    12. positive regulation of tumor necrosis factor production Source: Ensembl
    13. regulation of synaptic plasticity Source: Ensembl
    14. smooth muscle cell differentiation Source: Ensembl
    15. transcription from RNA polymerase II promoter Source: ProtInc

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Differentiation, Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear factor of activated T-cells, cytoplasmic 4
    Short name:
    NF-ATc4
    Short name:
    NFATc4
    Alternative name(s):
    T-cell transcription factor NFAT3
    Short name:
    NF-AT3
    Gene namesi
    Name:NFATC4
    Synonyms:NFAT3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:7778. NFATC4.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication
    Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. cytosol Source: Ensembl
    3. intermediate filament cytoskeleton Source: HPA
    4. nucleus Source: UniProtKB-SubCell
    5. transcription factor complex Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi168 – 1681S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-170. 1 Publication
    Mutagenesisi170 – 1701S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-168. 1 Publication
    Mutagenesisi213 – 2131S → A: Decreased transcriptional activity; when associated with A-217. 1 Publication
    Mutagenesisi217 – 2171S → A: Decreased transcriptional activity; when associated with A-213. 1 Publication

    Organism-specific databases

    PharmGKBiPA31584.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 902902Nuclear factor of activated T-cells, cytoplasmic 4PRO_0000205182Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei168 – 1681Phosphoserine; by MAPK7 and MAPK143 Publications
    Modified residuei170 – 1701Phosphoserine; by MAPK7 and MAPK143 Publications
    Modified residuei213 – 2131Phosphoserine; by MAPK8 and MAPK92 Publications
    Modified residuei217 – 2171Phosphoserine; by MAPK8 and MAPK92 Publications
    Modified residuei289 – 2891Phosphoserine; by RPS6KA32 Publications
    Modified residuei344 – 3441Phosphoserine; by RPS6KA32 Publications

    Post-translational modificationi

    Phosphorylated by NFATC-kinases; dephosphorylated by calcineurin. Phosphorylated on Ser-168 and Ser-170 by MTOR, IRAK1, MAPK7 and MAPK14, on Ser-213 and Ser-217 by MAPK8 and MAPK9, and on Ser-289 and Ser-344 by RPS6KA3. Phosphorylated by GSK3B.5 Publications
    Ubiquitinated, leading to its degradation by the proteasome and reduced transcriptional activity. Ubiquitination and reduction in transcriptional activity can be further facilitated through GSK3B-dependent phosphorylation. Polyubiquitin linkage is mainly through 'Lys-48'.1 Publication

    Keywords - PTMi

    Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ14934.
    PaxDbiQ14934.
    PRIDEiQ14934.

    PTM databases

    PhosphoSiteiQ14934.

    Expressioni

    Tissue specificityi

    Highly expressed in placenta, lung, kidney, testis and ovary. Weakly expressed in spleen and thymus. Not expressed in peripheral blood lymphocytes. Detected in hippocampus.1 Publication

    Gene expression databases

    ArrayExpressiQ14934.
    BgeeiQ14934.
    CleanExiHS_NFATC4.
    GenevestigatoriQ14934.

    Organism-specific databases

    HPAiCAB032859.
    HPA031641.

    Interactioni

    Subunit structurei

    Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers. Interacts with CREBBP, GATA4, IRAK1, MAPK8, MAPK9 and RPS6KA3.4 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    UBCP0CG483EBI-3905796,EBI-3390054

    Protein-protein interaction databases

    BioGridi110849. 13 interactions.
    IntActiQ14934. 10 interactions.
    MINTiMINT-1535456.

    Structurei

    Secondary structure

    1
    902
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi587 – 5948
    Beta strandi602 – 6109
    Beta strandi616 – 6205
    Turni638 – 6403
    Beta strandi645 – 6495
    Beta strandi662 – 6698
    Beta strandi671 – 6733
    Beta strandi679 – 6846
    Beta strandi687 – 6893

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2YRPNMR-A585-691[»]
    ProteinModelPortaliQ14934.
    SMRiQ14934. Positions 405-691.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ14934.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati213 – 22917SP 1Add
    BLAST
    Repeati277 – 29317SP 2; approximateAdd
    BLAST
    Domaini401 – 582182RHDPROSITE-ProRule annotationAdd
    BLAST
    Domaini586 – 68398IPT/TIGAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni114 – 1196Calcineurin-binding
    Regioni213 – 293812 approximate SP repeatsAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi268 – 2703Nuclear localization signal
    Motifi672 – 6743Nuclear localization signal

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi41 – 327287Pro-richAdd
    BLAST
    Compositional biasi717 – 836120Pro-richAdd
    BLAST

    Domaini

    Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.By similarity

    Sequence similaritiesi

    Contains 1 IPT/TIG domain.Curated
    Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG70055.
    HOVERGENiHBG104364.
    InParanoidiQ14934.
    KOiK17334.
    OMAiWTPDDPW.
    OrthoDBiEOG79PJND.
    PhylomeDBiQ14934.
    TreeFamiTF326480.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    2.60.40.340. 1 hit.
    InterProiIPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR008366. NFAT.
    IPR008967. p53-like_TF_DNA-bd.
    IPR011539. RHD.
    [Graphical view]
    PANTHERiPTHR12533. PTHR12533. 1 hit.
    PfamiPF00554. RHD. 1 hit.
    PF01833. TIG. 1 hit.
    [Graphical view]
    PRINTSiPR01789. NUCFACTORATC.
    SMARTiSM00429. IPT. 1 hit.
    [Graphical view]
    SUPFAMiSSF49417. SSF49417. 1 hit.
    SSF81296. SSF81296. 1 hit.
    PROSITEiPS50254. REL_2. 1 hit.
    [Graphical view]

    Sequences (24)i

    Sequence statusi: Complete.

    This entry describes 24 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q14934-1) [UniParc]FASTAAdd to Basket

    Also known as: ID-IXL

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGAASCEDEE LEFKLVFGEE KEAPPLGAGG LGEELDSEDA PPCCRLALGE    50
    PPPYGAAPIG IPRPPPPRPG MHSPPPRPAP SPGTWESQPA RSVRLGGPGG 100
    GAGGAGGGRV LECPSIRITS ISPTPEPPAA LEDNPDAWGD GSPRDYPPPE 150
    GFGGYREAGG QGGGAFFSPS PGSSSLSSWS FFSDASDEAA LYAACDEVES 200
    ELNEAASRFG LGSPLPSPRA SPRPWTPEDP WSLYGPSPGG RGPEDSWLLL 250
    SAPGPTPASP RPASPCGKRR YSSSGTPSSA SPALSRRGSL GEEGSEPPPP 300
    PPLPLARDPG SPGPFDYVGA PPAESIPQKT RRTSSEQAVA LPRSEEPASC 350
    NGKLPLGAEE SVAPPGGSRK EVAGMDYLAV PSPLAWSKAR IGGHSPIFRT 400
    SALPPLDWPL PSQYEQLELR IEVQPRAHHR AHYETEGSRG AVKAAPGGHP 450
    VVKLLGYSEK PLTLQMFIGT ADERNLRPHA FYQVHRITGK MVATASYEAV 500
    VSGTKVLEMT LLPENNMAAN IDCAGILKLR NSDIELRKGE TDIGRKNTRV 550
    RLVFRVHVPQ GGGKVVSVQA ASVPIECSQR SAQELPQVEA YSPSACSVRG 600
    GEELVLTGSN FLPDSKVVFI ERGPDGKLQW EEEATVNRLQ SNEVTLTLTV 650
    PEYSNKRVSR PVQVYFYVSN GRRKRSPTQS FRFLPVICKE EPLPDSSLRG 700
    FPSASATPFG TDMDFSPPRP PYPSYPHEDP ACETPYLSEG FGYGMPPLYP 750
    QTGPPPSYRP GLRMFPETRG TTGCAQPPAV SFLPRPFPSD PYGGRGSSFS 800
    LGLPFSPPAP FRPPPLPASP PLEGPFPSQS DVHPLPAEGY NKVGPGYGPG 850
    EGAPEQEKSR GGYSSGFRDS VPIQGITLEE VSEIIGRDLS GFPAPPGEEP 900
    PA 902
    Length:902
    Mass (Da):95,449
    Last modified:November 25, 2008 - v2
    Checksum:iAE94C5D1325D24D7
    GO
    Isoform 2 (identifier: Q14934-2) [UniParc]FASTAAdd to Basket

    Also known as: IA-IXL

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM

    Show »
    Length:965
    Mass (Da):101,680
    Checksum:i977A42276D24A2DD
    GO
    Isoform 3 (identifier: Q14934-3) [UniParc]FASTAAdd to Basket

    Also known as: IA-IXi

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM
         881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

    Note: Due to an intron retention.

    Show »
    Length:964
    Mass (Da):101,513
    Checksum:i91DDEA6EACD24AD1
    GO
    Isoform 4 (identifier: Q14934-4) [UniParc]FASTAAdd to Basket

    Also known as: IC-IXL

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM

    Show »
    Length:934
    Mass (Da):98,436
    Checksum:iE72E379E8F1087A2
    GO
    Isoform 5 (identifier: Q14934-5) [UniParc]FASTAAdd to Basket

    Also known as: IC-IXi

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM
         881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

    Note: Due to an intron retention.

    Show »
    Length:933
    Mass (Da):98,269
    Checksum:iB5A8538C98F73584
    GO
    Isoform 6 (identifier: Q14934-6) [UniParc]FASTAAdd to Basket

    Also known as: IB-IXL

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLSGRDLGAPAGSM

    Show »
    Length:915
    Mass (Da):96,662
    Checksum:i36C042AAF575636D
    GO
    Isoform 7 (identifier: Q14934-7) [UniParc]FASTAAdd to Basket

    Also known as: IB-IXi

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLSGRDLGAPAGSM
         881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

    Note: Due to an intron retention.

    Show »
    Length:914
    Mass (Da):96,495
    Checksum:iCBDD67F6FD13FA0B
    GO
    Isoform 8 (identifier: Q14934-8) [UniParc]FASTAAdd to Basket

    Also known as: ID-IXi

    The sequence of this isoform differs from the canonical sequence as follows:
         881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

    Note: Due to an intron retention.

    Show »
    Length:901
    Mass (Da):95,282
    Checksum:i2F5A1C31D55440FA
    GO
    Isoform 9 (identifier: Q14934-9) [UniParc]FASTAAdd to Basket

    Also known as: IE-IXL

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS

    Show »
    Length:890
    Mass (Da):94,146
    Checksum:iCD0C3EF25B5761B6
    GO
    Isoform 10 (identifier: Q14934-10) [UniParc]FASTAAdd to Basket

    Also known as: IE-IXi

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS
         881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

    Note: Due to an intron retention.

    Show »
    Length:889
    Mass (Da):93,978
    Checksum:iE7A13F58DF1121B1
    GO
    Isoform 11 (identifier: Q14934-11) [UniParc]FASTAAdd to Basket

    Also known as: IA-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM
         773-880: Missing.

    Show »
    Length:857
    Mass (Da):90,525
    Checksum:iAA5ED1F6E0713077
    GO
    Isoform 12 (identifier: Q14934-12) [UniParc]FASTAAdd to Basket

    Also known as: IEi-IXL

    The sequence of this isoform differs from the canonical sequence as follows:
         1-70: Missing.

    Note: Due to an intron retention.

    Show »
    Length:832
    Mass (Da):88,270
    Checksum:i22978126C7D764DB
    GO
    Isoform 13 (identifier: Q14934-13) [UniParc]FASTAAdd to Basket

    Also known as: IEi-IXi

    The sequence of this isoform differs from the canonical sequence as follows:
         1-70: Missing.
         881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

    Note: Due to an intron retention.

    Show »
    Length:831
    Mass (Da):88,103
    Checksum:iCC1EEBC45F144C10
    GO
    Isoform 14 (identifier: Q14934-14) [UniParc]FASTAAdd to Basket

    Also known as: IC-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM
         773-880: Missing.

    Show »
    Length:826
    Mass (Da):87,282
    Checksum:i4BF3996D8C2BA62C
    GO
    Isoform 15 (identifier: Q14934-15) [UniParc]FASTAAdd to Basket

    Also known as: IB-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLSGRDLGAPAGSM
         773-880: Missing.

    Show »
    Length:807
    Mass (Da):85,508
    Checksum:iF9035684E3A5FE7E
    GO
    Isoform 16 (identifier: Q14934-16) [UniParc]FASTAAdd to Basket

    Also known as: ID-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         773-880: Missing.

    Show »
    Length:794
    Mass (Da):84,294
    Checksum:i8378E0D0BB0888D2
    GO
    Isoform 17 (identifier: Q14934-17) [UniParc]FASTAAdd to Basket

    Also known as: IE-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS
         773-880: Missing.

    Show »
    Length:782
    Mass (Da):82,991
    Checksum:i4B73A89F510DC96E
    GO
    Isoform 18 (identifier: Q14934-18) [UniParc]FASTAAdd to Basket

    Also known as: IEi-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         1-70: Missing.
         773-880: Missing.

    Note: Due to an intron retention.

    Show »
    Length:724
    Mass (Da):77,115
    Checksum:iE589F6754CC1B54C
    GO
    Isoform 19 (identifier: Q14934-19) [UniParc]FASTAAdd to Basket

    Also known as: IV-IXL

    The sequence of this isoform differs from the canonical sequence as follows:
         1-465: Missing.

    Show »
    Length:437
    Mass (Da):47,373
    Checksum:iEEA72B2EDFA7E67A
    GO
    Isoform 20 (identifier: Q14934-20) [UniParc]FASTAAdd to Basket

    Also known as: IV-IXi

    The sequence of this isoform differs from the canonical sequence as follows:
         1-465: Missing.
         881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

    Note: Due to an intron retention.

    Show »
    Length:436
    Mass (Da):47,206
    Checksum:iACB4E3DC2F96ED8B
    GO
    Isoform 21 (identifier: Q14934-21) [UniParc]FASTAAdd to Basket

    Also known as: IV-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         1-465: Missing.
         773-880: Missing.

    Show »
    Length:329
    Mass (Da):36,219
    Checksum:i043037F5F05D38C5
    GO
    Isoform 22 (identifier: Q14934-22) [UniParc]FASTAAdd to Basket

    Also known as: VI-IXL

    The sequence of this isoform differs from the canonical sequence as follows:
         1-712: Missing.

    Show »
    Length:190
    Mass (Da):20,104
    Checksum:i3B4512C612A69FDF
    GO
    Isoform 23 (identifier: Q14934-23) [UniParc]FASTAAdd to Basket

    Also known as: VI-IXi

    The sequence of this isoform differs from the canonical sequence as follows:
         1-712: Missing.
         881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

    Note: Due to an intron retention.

    Show »
    Length:189
    Mass (Da):19,937
    Checksum:iCE8D0B112EEF4803
    GO
    Isoform 24 (identifier: Q14934-24) [UniParc]FASTAAdd to Basket

    Also known as: VI-IXS

    The sequence of this isoform differs from the canonical sequence as follows:
         1-712: Missing.
         773-880: Missing.

    Show »
    Length:82
    Mass (Da):8,950
    Checksum:iDC673A88B52B383F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti359 – 3591E → K in BAG56726. (PubMed:14702039)Curated
    Sequence conflicti646 – 6461L → P in BAG63617. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti160 – 1601G → A.2 Publications
    Corresponds to variant rs2229309 [ dbSNP | Ensembl ].
    VAR_046985
    Natural varianti246 – 2461S → N.
    Corresponds to variant rs2228231 [ dbSNP | Ensembl ].
    VAR_046986
    Natural varianti800 – 8001S → P.2 Publications
    Corresponds to variant rs7149586 [ dbSNP | Ensembl ].
    VAR_046987

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 712712Missing in isoform 22, isoform 23 and isoform 24. 1 PublicationVSP_036697Add
    BLAST
    Alternative sequencei1 – 465465Missing in isoform 19, isoform 20 and isoform 21. 1 PublicationVSP_036698Add
    BLAST
    Alternative sequencei1 – 7070Missing in isoform 12, isoform 13 and isoform 18. 2 PublicationsVSP_036699Add
    BLAST
    Alternative sequencei1 – 3232MGAAS…AGGLG → MPASISSIFPGPTLLLSCGS in isoform 9, isoform 10 and isoform 17. 1 PublicationVSP_036700Add
    BLAST
    Alternative sequencei1 – 11M → MITTLPSLLPASLASISHRV TNLPSNSLSHNPGLSKPDFP GNSSPGLPSSSSPGRDLGAP AGSM in isoform 2, isoform 3 and isoform 11. 1 PublicationVSP_036701
    Alternative sequencei1 – 11M → MADGGADSAAQRLPEGPGRV APGRDLGAPAGSM in isoform 4, isoform 5 and isoform 14. 1 PublicationVSP_036702
    Alternative sequencei1 – 11M → MLSGRDLGAPAGSM in isoform 6, isoform 7 and isoform 15. 1 PublicationVSP_036703
    Alternative sequencei773 – 880108Missing in isoform 11, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 21 and isoform 24. 2 PublicationsVSP_036704Add
    BLAST
    Alternative sequencei881 – 90222VSEII…EEPPA → GGCGTGGCECECVQEIALHV C in isoform 3, isoform 5, isoform 7, isoform 8, isoform 10, isoform 13, isoform 20 and isoform 23. 1 PublicationVSP_036705Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L41066 mRNA. Translation: AAA79175.1.
    EU887632 mRNA. Translation: ACG55652.1.
    EU887633 mRNA. Translation: ACG55653.1.
    EU887634 mRNA. Translation: ACG55654.1.
    EU887635 mRNA. Translation: ACG55655.1.
    EU887636 mRNA. Translation: ACG55656.1.
    EU887637 mRNA. Translation: ACG55657.1.
    EU887638 mRNA. Translation: ACG55658.1.
    EU887639 mRNA. Translation: ACG55659.1.
    EU887640 mRNA. Translation: ACG55660.1.
    EU887641 mRNA. Translation: ACG55661.1.
    EU887642 mRNA. Translation: ACG55662.1.
    EU887643 mRNA. Translation: ACG55663.1.
    EU887644 mRNA. Translation: ACG55664.1.
    EU887645 mRNA. Translation: ACG55665.1.
    EU887646 mRNA. Translation: ACG55666.1.
    EU887647 mRNA. Translation: ACG55667.1.
    EU887648 mRNA. Translation: ACG55668.1.
    EU887649 mRNA. Translation: ACG55669.1.
    EU887650 mRNA. Translation: ACG55670.1.
    EU887651 mRNA. Translation: ACG55671.1.
    EU887652 mRNA. Translation: ACG55672.1.
    EU887653 mRNA. Translation: ACG55673.1.
    EU887654 mRNA. Translation: ACG55674.1.
    EU887655 mRNA. Translation: ACG55675.1.
    AK293185 mRNA. Translation: BAG56726.1.
    AK302271 mRNA. Translation: BAG63617.1.
    BC008857 mRNA. Translation: AAH08857.2.
    BC053855 mRNA. Translation: AAH53855.1.
    CCDSiCCDS45089.1. [Q14934-3]
    CCDS55909.1. [Q14934-11]
    CCDS55910.1. [Q14934-16]
    CCDS55911.1. [Q14934-12]
    CCDS9629.1. [Q14934-1]
    RefSeqiNP_001129494.1. NM_001136022.2. [Q14934-3]
    NP_001185894.1. NM_001198965.1. [Q14934-16]
    NP_001185895.1. NM_001198966.2. [Q14934-12]
    NP_001185896.1. NM_001198967.2. [Q14934-11]
    NP_001275731.1. NM_001288802.1. [Q14934-10]
    NP_004545.2. NM_004554.4. [Q14934-1]
    UniGeneiHs.77810.

    Genome annotation databases

    EnsembliENST00000250373; ENSP00000250373; ENSG00000100968. [Q14934-1]
    ENST00000413692; ENSP00000388910; ENSG00000100968. [Q14934-3]
    ENST00000422617; ENSP00000396788; ENSG00000100968. [Q14934-10]
    ENST00000424781; ENSP00000388668; ENSG00000100968. [Q14934-7]
    ENST00000539237; ENSP00000439350; ENSG00000100968. [Q14934-5]
    ENST00000553469; ENSP00000451502; ENSG00000100968. [Q14934-14]
    ENST00000553708; ENSP00000450590; ENSG00000100968. [Q14934-8]
    ENST00000553879; ENSP00000452349; ENSG00000100968. [Q14934-12]
    ENST00000554050; ENSP00000451151; ENSG00000100968. [Q14934-16]
    ENST00000554344; ENSP00000450469; ENSG00000100968. [Q14934-12]
    ENST00000554473; ENSP00000450810; ENSG00000100968. [Q14934-21]
    ENST00000554591; ENSP00000452039; ENSG00000100968. [Q14934-11]
    ENST00000554661; ENSP00000450733; ENSG00000100968. [Q14934-18]
    ENST00000554966; ENSP00000450644; ENSG00000100968. [Q14934-15]
    ENST00000555167; ENSP00000451395; ENSG00000100968. [Q14934-20]
    ENST00000555393; ENSP00000451801; ENSG00000100968. [Q14934-23]
    ENST00000555453; ENSP00000450686; ENSG00000100968. [Q14934-9]
    ENST00000555590; ENSP00000451224; ENSG00000100968. [Q14934-6]
    ENST00000555802; ENSP00000451590; ENSG00000100968. [Q14934-22]
    ENST00000556169; ENSP00000451454; ENSG00000100968. [Q14934-17]
    ENST00000556279; ENSP00000452270; ENSG00000100968. [Q14934-4]
    ENST00000556759; ENSP00000451183; ENSG00000100968. [Q14934-19]
    ENST00000557451; ENSP00000451284; ENSG00000100968. [Q14934-13]
    ENST00000557767; ENSP00000451496; ENSG00000100968. [Q14934-24]
    GeneIDi4776.
    KEGGihsa:4776.
    UCSCiuc001wpc.3. human. [Q14934-1]
    uc001wpd.3. human. [Q14934-19]
    uc010alr.3. human. [Q14934-11]
    uc010alt.3. human. [Q14934-5]
    uc010alv.3. human. [Q14934-10]
    uc010tok.2. human. [Q14934-3]
    uc010tol.2. human. [Q14934-2]
    uc010tom.2. human. [Q14934-7]
    uc010ton.2. human. [Q14934-6]
    uc010too.2. human. [Q14934-15]
    uc010top.2. human. [Q14934-4]
    uc010toq.2. human. [Q14934-14]
    uc010tor.2. human. [Q14934-16]
    uc010tot.2. human. [Q14934-9]
    uc010tov.2. human. [Q14934-17]
    uc010tow.2. human. [Q14934-18]
    uc010tox.2. human. [Q14934-13]
    uc010toy.2. human. [Q14934-21]
    uc010toz.2. human. [Q14934-20]
    uc010tpa.2. human. [Q14934-22]
    uc010tpb.2. human. [Q14934-23]

    Polymorphism databases

    DMDMi215274090.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L41066 mRNA. Translation: AAA79175.1 .
    EU887632 mRNA. Translation: ACG55652.1 .
    EU887633 mRNA. Translation: ACG55653.1 .
    EU887634 mRNA. Translation: ACG55654.1 .
    EU887635 mRNA. Translation: ACG55655.1 .
    EU887636 mRNA. Translation: ACG55656.1 .
    EU887637 mRNA. Translation: ACG55657.1 .
    EU887638 mRNA. Translation: ACG55658.1 .
    EU887639 mRNA. Translation: ACG55659.1 .
    EU887640 mRNA. Translation: ACG55660.1 .
    EU887641 mRNA. Translation: ACG55661.1 .
    EU887642 mRNA. Translation: ACG55662.1 .
    EU887643 mRNA. Translation: ACG55663.1 .
    EU887644 mRNA. Translation: ACG55664.1 .
    EU887645 mRNA. Translation: ACG55665.1 .
    EU887646 mRNA. Translation: ACG55666.1 .
    EU887647 mRNA. Translation: ACG55667.1 .
    EU887648 mRNA. Translation: ACG55668.1 .
    EU887649 mRNA. Translation: ACG55669.1 .
    EU887650 mRNA. Translation: ACG55670.1 .
    EU887651 mRNA. Translation: ACG55671.1 .
    EU887652 mRNA. Translation: ACG55672.1 .
    EU887653 mRNA. Translation: ACG55673.1 .
    EU887654 mRNA. Translation: ACG55674.1 .
    EU887655 mRNA. Translation: ACG55675.1 .
    AK293185 mRNA. Translation: BAG56726.1 .
    AK302271 mRNA. Translation: BAG63617.1 .
    BC008857 mRNA. Translation: AAH08857.2 .
    BC053855 mRNA. Translation: AAH53855.1 .
    CCDSi CCDS45089.1. [Q14934-3 ]
    CCDS55909.1. [Q14934-11 ]
    CCDS55910.1. [Q14934-16 ]
    CCDS55911.1. [Q14934-12 ]
    CCDS9629.1. [Q14934-1 ]
    RefSeqi NP_001129494.1. NM_001136022.2. [Q14934-3 ]
    NP_001185894.1. NM_001198965.1. [Q14934-16 ]
    NP_001185895.1. NM_001198966.2. [Q14934-12 ]
    NP_001185896.1. NM_001198967.2. [Q14934-11 ]
    NP_001275731.1. NM_001288802.1. [Q14934-10 ]
    NP_004545.2. NM_004554.4. [Q14934-1 ]
    UniGenei Hs.77810.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2YRP NMR - A 585-691 [» ]
    ProteinModelPortali Q14934.
    SMRi Q14934. Positions 405-691.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110849. 13 interactions.
    IntActi Q14934. 10 interactions.
    MINTi MINT-1535456.

    PTM databases

    PhosphoSitei Q14934.

    Polymorphism databases

    DMDMi 215274090.

    Proteomic databases

    MaxQBi Q14934.
    PaxDbi Q14934.
    PRIDEi Q14934.

    Protocols and materials databases

    DNASUi 4776.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000250373 ; ENSP00000250373 ; ENSG00000100968 . [Q14934-1 ]
    ENST00000413692 ; ENSP00000388910 ; ENSG00000100968 . [Q14934-3 ]
    ENST00000422617 ; ENSP00000396788 ; ENSG00000100968 . [Q14934-10 ]
    ENST00000424781 ; ENSP00000388668 ; ENSG00000100968 . [Q14934-7 ]
    ENST00000539237 ; ENSP00000439350 ; ENSG00000100968 . [Q14934-5 ]
    ENST00000553469 ; ENSP00000451502 ; ENSG00000100968 . [Q14934-14 ]
    ENST00000553708 ; ENSP00000450590 ; ENSG00000100968 . [Q14934-8 ]
    ENST00000553879 ; ENSP00000452349 ; ENSG00000100968 . [Q14934-12 ]
    ENST00000554050 ; ENSP00000451151 ; ENSG00000100968 . [Q14934-16 ]
    ENST00000554344 ; ENSP00000450469 ; ENSG00000100968 . [Q14934-12 ]
    ENST00000554473 ; ENSP00000450810 ; ENSG00000100968 . [Q14934-21 ]
    ENST00000554591 ; ENSP00000452039 ; ENSG00000100968 . [Q14934-11 ]
    ENST00000554661 ; ENSP00000450733 ; ENSG00000100968 . [Q14934-18 ]
    ENST00000554966 ; ENSP00000450644 ; ENSG00000100968 . [Q14934-15 ]
    ENST00000555167 ; ENSP00000451395 ; ENSG00000100968 . [Q14934-20 ]
    ENST00000555393 ; ENSP00000451801 ; ENSG00000100968 . [Q14934-23 ]
    ENST00000555453 ; ENSP00000450686 ; ENSG00000100968 . [Q14934-9 ]
    ENST00000555590 ; ENSP00000451224 ; ENSG00000100968 . [Q14934-6 ]
    ENST00000555802 ; ENSP00000451590 ; ENSG00000100968 . [Q14934-22 ]
    ENST00000556169 ; ENSP00000451454 ; ENSG00000100968 . [Q14934-17 ]
    ENST00000556279 ; ENSP00000452270 ; ENSG00000100968 . [Q14934-4 ]
    ENST00000556759 ; ENSP00000451183 ; ENSG00000100968 . [Q14934-19 ]
    ENST00000557451 ; ENSP00000451284 ; ENSG00000100968 . [Q14934-13 ]
    ENST00000557767 ; ENSP00000451496 ; ENSG00000100968 . [Q14934-24 ]
    GeneIDi 4776.
    KEGGi hsa:4776.
    UCSCi uc001wpc.3. human. [Q14934-1 ]
    uc001wpd.3. human. [Q14934-19 ]
    uc010alr.3. human. [Q14934-11 ]
    uc010alt.3. human. [Q14934-5 ]
    uc010alv.3. human. [Q14934-10 ]
    uc010tok.2. human. [Q14934-3 ]
    uc010tol.2. human. [Q14934-2 ]
    uc010tom.2. human. [Q14934-7 ]
    uc010ton.2. human. [Q14934-6 ]
    uc010too.2. human. [Q14934-15 ]
    uc010top.2. human. [Q14934-4 ]
    uc010toq.2. human. [Q14934-14 ]
    uc010tor.2. human. [Q14934-16 ]
    uc010tot.2. human. [Q14934-9 ]
    uc010tov.2. human. [Q14934-17 ]
    uc010tow.2. human. [Q14934-18 ]
    uc010tox.2. human. [Q14934-13 ]
    uc010toy.2. human. [Q14934-21 ]
    uc010toz.2. human. [Q14934-20 ]
    uc010tpa.2. human. [Q14934-22 ]
    uc010tpb.2. human. [Q14934-23 ]

    Organism-specific databases

    CTDi 4776.
    GeneCardsi GC14P024834.
    HGNCi HGNC:7778. NFATC4.
    HPAi CAB032859.
    HPA031641.
    MIMi 602699. gene.
    neXtProti NX_Q14934.
    PharmGKBi PA31584.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG70055.
    HOVERGENi HBG104364.
    InParanoidi Q14934.
    KOi K17334.
    OMAi WTPDDPW.
    OrthoDBi EOG79PJND.
    PhylomeDBi Q14934.
    TreeFami TF326480.

    Miscellaneous databases

    EvolutionaryTracei Q14934.
    GeneWikii NFATC4.
    GenomeRNAii 4776.
    NextBioi 18420.
    PROi Q14934.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q14934.
    Bgeei Q14934.
    CleanExi HS_NFATC4.
    Genevestigatori Q14934.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    2.60.40.340. 1 hit.
    InterProi IPR013783. Ig-like_fold.
    IPR014756. Ig_E-set.
    IPR002909. IPT.
    IPR008366. NFAT.
    IPR008967. p53-like_TF_DNA-bd.
    IPR011539. RHD.
    [Graphical view ]
    PANTHERi PTHR12533. PTHR12533. 1 hit.
    Pfami PF00554. RHD. 1 hit.
    PF01833. TIG. 1 hit.
    [Graphical view ]
    PRINTSi PR01789. NUCFACTORATC.
    SMARTi SM00429. IPT. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49417. SSF49417. 1 hit.
    SSF81296. SSF81296. 1 hit.
    PROSITEi PS50254. REL_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation of two new members of the NF-AT gene family and functional characterization of the NF-AT proteins."
      Hoey T., Sun Y.-L., Williamson K., Xu X.
      Immunity 2:461-472(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANTS ALA-160 AND PRO-800.
      Tissue: T-cell.
    2. "Alternative splicing and expression of human and mouse NFAT genes."
      Vihma H., Pruunsild P., Timmusk T.
      Genomics 92:279-291(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20; 21; 22; 23 AND 24), TISSUE SPECIFICITY.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 12 AND 16).
      Tissue: Adrenal gland and Testis.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 61-902 (ISOFORMS 1/2/4/6), VARIANTS ALA-160 AND PRO-800.
      Tissue: Ovary and Rhabdomyosarcoma.
    5. "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT."
      Crabtree G.R.
      Cell 96:611-614(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: REVIEW.
    6. "Requirement of two NFATc4 transactivation domains for CBP potentiation."
      Yang T.T.C., Davis R.J., Chow C.-W.
      J. Biol. Chem. 276:39569-39576(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CREBBP.
    7. "Phosphorylation of NFATc4 by p38 mitogen-activated protein kinases."
      Yang T.T.C., Xiong Q., Enslen H., Davis R.J., Chow C.-W.
      Mol. Cell. Biol. 22:3892-3904(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, PHOSPHORYLATION AT SER-168 AND SER-170, MUTAGENESIS OF SER-168 AND SER-170.
    8. "Nuclear factor of activated T3 is a negative regulator of Ras-JNK1/2-AP-1 induced cell transformation."
      Yao K., Cho Y.-Y., Bergen H.R. III, Madden B.J., Choi B.Y., Ma W.-Y., Bode A.M., Dong Z.
      Cancer Res. 67:8725-8735(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MAPK8 AND MAPK9, PHOSPHORYLATION AT SER-213 AND SER-217, MUTAGENESIS OF SER-213 AND SER-217.
    9. Cited for: FUNCTION, INTERACTION WITH RPS6KA3, PHOSPHORYLATION AT SER-289 AND SER-344.
    10. Cited for: FUNCTION.
    11. "Regulation of the stability and transcriptional activity of NFATc4 by ubiquitination."
      Fan Y., Xie P., Zhang T., Zhang H., Gu D., She M., Li H.
      FEBS Lett. 582:4008-4014(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION, UBIQUITINATION.
    12. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Integration of protein kinases mTOR and extracellular signal-regulated kinase 5 in regulating nucleocytoplasmic localization of NFATc4."
      Yang T.T.C., Yu R.Y.L., Agadir A., Gao G.-J., Campos-Gonzalez R., Tournier C., Chow C.-W.
      Mol. Cell. Biol. 28:3489-3501(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-168 AND SER-170.
    14. "The interleukin-1 receptor associated kinase 1 contributes to the regulation of NFAT."
      Wang D., Fasciano S., Li L.
      Mol. Immunol. 45:3902-3908(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH IRAK1.
    15. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    16. "Solution structure of the TIG domain from human nuclear factor of activated T-cells, cytoplasmic 4."
      RIKEN structural genomics initiative (RSGI)
      Submitted (FEB-2008) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 585-691.

    Entry informationi

    Entry nameiNFAC4_HUMAN
    AccessioniPrimary (citable) accession number: Q14934
    Secondary accession number(s): B4DDG5
    , B4DY55, B5B2U7, B5B2U8, B5B2U9, B5B2V0, B5B2V1, B5B2V2, B5B2V3, B5B2V4, B5B2V5, B5B2V7, B5B2V8, B5B2V9, B5B2W0, B5B2W1, B5B2W2, B5B2W3, B5B2W4, B5B2W5, B5B2W6, B5B2W7, B5B2W8, B5B2W9, B5B2X0, Q7Z598, Q96H68
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 137 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3