Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14934

- NFAC4_HUMAN

UniProt

Q14934 - NFAC4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear factor of activated T-cells, cytoplasmic 4

Gene

NFATC4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 and IL-4. Transcriptionally repressed by estrogen receptors; this inhibition is further enhanced by estrogen. Increases the transcriptional activity of PPARG and has a direct role in adipocyte differentiation. May play an important role in myotube differentiation. May play a critical role in cardiac development and hypertrophy. May play a role in deafferentation-induced apoptosis of sensory neurons.4 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi430 – 4378

GO - Molecular functioni

  1. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: Ensembl
  2. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription Source: Ensembl
  3. transcription coactivator activity Source: ProtInc

GO - Biological processi

  1. cellular respiration Source: Ensembl
  2. cellular response to lithium ion Source: Ensembl
  3. cellular response to UV Source: Ensembl
  4. heart development Source: Ensembl
  5. inflammatory response Source: ProtInc
  6. intrinsic apoptotic signaling pathway in response to DNA damage Source: Ensembl
  7. muscle cell development Source: Ensembl
  8. patterning of blood vessels Source: Ensembl
  9. positive regulation of apoptotic process Source: Ensembl
  10. positive regulation of apoptotic signaling pathway Source: Ensembl
  11. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  12. positive regulation of tumor necrosis factor production Source: Ensembl
  13. regulation of synaptic plasticity Source: Ensembl
  14. smooth muscle cell differentiation Source: Ensembl
  15. transcription from RNA polymerase II promoter Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Differentiation, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 4
Short name:
NF-ATc4
Short name:
NFATc4
Alternative name(s):
T-cell transcription factor NFAT3
Short name:
NF-AT3
Gene namesi
Name:NFATC4
Synonyms:NFAT3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:7778. NFATC4.

Subcellular locationi

Cytoplasm 1 Publication. Nucleus 1 Publication
Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. cytosol Source: Ensembl
  3. intermediate filament cytoskeleton Source: HPA
  4. nucleus Source: UniProtKB-KW
  5. transcription factor complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi168 – 1681S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-170. 1 Publication
Mutagenesisi170 – 1701S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-168. 1 Publication
Mutagenesisi213 – 2131S → A: Decreased transcriptional activity; when associated with A-217. 1 Publication
Mutagenesisi217 – 2171S → A: Decreased transcriptional activity; when associated with A-213. 1 Publication

Organism-specific databases

PharmGKBiPA31584.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 902902Nuclear factor of activated T-cells, cytoplasmic 4PRO_0000205182Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei168 – 1681Phosphoserine; by MAPK7 and MAPK142 Publications
Modified residuei170 – 1701Phosphoserine; by MAPK7 and MAPK142 Publications
Modified residuei213 – 2131Phosphoserine; by MAPK8 and MAPK91 Publication
Modified residuei217 – 2171Phosphoserine; by MAPK8 and MAPK91 Publication
Modified residuei289 – 2891Phosphoserine; by RPS6KA31 Publication
Modified residuei344 – 3441Phosphoserine; by RPS6KA31 Publication

Post-translational modificationi

Phosphorylated by NFATC-kinases; dephosphorylated by calcineurin. Phosphorylated on Ser-168 and Ser-170 by MTOR, IRAK1, MAPK7 and MAPK14, on Ser-213 and Ser-217 by MAPK8 and MAPK9, and on Ser-289 and Ser-344 by RPS6KA3. Phosphorylated by GSK3B.5 Publications
Ubiquitinated, leading to its degradation by the proteasome and reduced transcriptional activity. Ubiquitination and reduction in transcriptional activity can be further facilitated through GSK3B-dependent phosphorylation. Polyubiquitin linkage is mainly through 'Lys-48'.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ14934.
PaxDbiQ14934.
PRIDEiQ14934.

PTM databases

PhosphoSiteiQ14934.

Expressioni

Tissue specificityi

Highly expressed in placenta, lung, kidney, testis and ovary. Weakly expressed in spleen and thymus. Not expressed in peripheral blood lymphocytes. Detected in hippocampus.1 Publication

Gene expression databases

BgeeiQ14934.
CleanExiHS_NFATC4.
ExpressionAtlasiQ14934. baseline and differential.
GenevestigatoriQ14934.

Organism-specific databases

HPAiCAB032859.
HPA031641.

Interactioni

Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers. Interacts with CREBBP, GATA4, IRAK1, MAPK8, MAPK9 and RPS6KA3.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
UBCP0CG483EBI-3905796,EBI-3390054

Protein-protein interaction databases

BioGridi110849. 15 interactions.
IntActiQ14934. 10 interactions.
MINTiMINT-1535456.

Structurei

Secondary structure

1
902
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi587 – 5948
Beta strandi602 – 6109
Beta strandi616 – 6205
Turni638 – 6403
Beta strandi645 – 6495
Beta strandi662 – 6698
Beta strandi671 – 6733
Beta strandi679 – 6846
Beta strandi687 – 6893

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2YRPNMR-A585-691[»]
ProteinModelPortaliQ14934.
SMRiQ14934. Positions 405-691.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14934.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati213 – 22917SP 1Add
BLAST
Repeati277 – 29317SP 2; approximateAdd
BLAST
Domaini401 – 582182RHDPROSITE-ProRule annotationAdd
BLAST
Domaini586 – 68398IPT/TIGAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni114 – 1196Calcineurin-binding
Regioni213 – 293812 approximate SP repeatsAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi268 – 2703Nuclear localization signal
Motifi672 – 6743Nuclear localization signal

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi41 – 327287Pro-richAdd
BLAST
Compositional biasi717 – 836120Pro-richAdd
BLAST

Domaini

Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.By similarity

Sequence similaritiesi

Contains 1 IPT/TIG domain.Curated
Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG70055.
GeneTreeiENSGT00550000074562.
HOVERGENiHBG104364.
InParanoidiQ14934.
KOiK17334.
OMAiWTPDDPW.
OrthoDBiEOG79PJND.
PhylomeDBiQ14934.
TreeFamiTF326480.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR011539. RHD.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PfamiPF00554. RHD. 1 hit.
PF01833. TIG. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]

Sequences (24)i

Sequence statusi: Complete.

This entry describes 24 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q14934) [UniParc]FASTAAdd to Basket

Also known as: ID-IXL

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAASCEDEE LEFKLVFGEE KEAPPLGAGG LGEELDSEDA PPCCRLALGE
60 70 80 90 100
PPPYGAAPIG IPRPPPPRPG MHSPPPRPAP SPGTWESQPA RSVRLGGPGG
110 120 130 140 150
GAGGAGGGRV LECPSIRITS ISPTPEPPAA LEDNPDAWGD GSPRDYPPPE
160 170 180 190 200
GFGGYREAGG QGGGAFFSPS PGSSSLSSWS FFSDASDEAA LYAACDEVES
210 220 230 240 250
ELNEAASRFG LGSPLPSPRA SPRPWTPEDP WSLYGPSPGG RGPEDSWLLL
260 270 280 290 300
SAPGPTPASP RPASPCGKRR YSSSGTPSSA SPALSRRGSL GEEGSEPPPP
310 320 330 340 350
PPLPLARDPG SPGPFDYVGA PPAESIPQKT RRTSSEQAVA LPRSEEPASC
360 370 380 390 400
NGKLPLGAEE SVAPPGGSRK EVAGMDYLAV PSPLAWSKAR IGGHSPIFRT
410 420 430 440 450
SALPPLDWPL PSQYEQLELR IEVQPRAHHR AHYETEGSRG AVKAAPGGHP
460 470 480 490 500
VVKLLGYSEK PLTLQMFIGT ADERNLRPHA FYQVHRITGK MVATASYEAV
510 520 530 540 550
VSGTKVLEMT LLPENNMAAN IDCAGILKLR NSDIELRKGE TDIGRKNTRV
560 570 580 590 600
RLVFRVHVPQ GGGKVVSVQA ASVPIECSQR SAQELPQVEA YSPSACSVRG
610 620 630 640 650
GEELVLTGSN FLPDSKVVFI ERGPDGKLQW EEEATVNRLQ SNEVTLTLTV
660 670 680 690 700
PEYSNKRVSR PVQVYFYVSN GRRKRSPTQS FRFLPVICKE EPLPDSSLRG
710 720 730 740 750
FPSASATPFG TDMDFSPPRP PYPSYPHEDP ACETPYLSEG FGYGMPPLYP
760 770 780 790 800
QTGPPPSYRP GLRMFPETRG TTGCAQPPAV SFLPRPFPSD PYGGRGSSFS
810 820 830 840 850
LGLPFSPPAP FRPPPLPASP PLEGPFPSQS DVHPLPAEGY NKVGPGYGPG
860 870 880 890 900
EGAPEQEKSR GGYSSGFRDS VPIQGITLEE VSEIIGRDLS GFPAPPGEEP

PA
Length:902
Mass (Da):95,449
Last modified:November 25, 2008 - v2
Checksum:iAE94C5D1325D24D7
GO
Isoform 2 (identifier: Q14934-2) [UniParc]FASTAAdd to Basket

Also known as: IA-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM

Show »
Length:965
Mass (Da):101,680
Checksum:i977A42276D24A2DD
GO
Isoform 3 (identifier: Q14934-3) [UniParc]FASTAAdd to Basket

Also known as: IA-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.

Show »
Length:964
Mass (Da):101,513
Checksum:i91DDEA6EACD24AD1
GO
Isoform 4 (identifier: Q14934-4) [UniParc]FASTAAdd to Basket

Also known as: IC-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM

Show »
Length:934
Mass (Da):98,436
Checksum:iE72E379E8F1087A2
GO
Isoform 5 (identifier: Q14934-5) [UniParc]FASTAAdd to Basket

Also known as: IC-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.

Show »
Length:933
Mass (Da):98,269
Checksum:iB5A8538C98F73584
GO
Isoform 6 (identifier: Q14934-6) [UniParc]FASTAAdd to Basket

Also known as: IB-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGRDLGAPAGSM

Show »
Length:915
Mass (Da):96,662
Checksum:i36C042AAF575636D
GO
Isoform 7 (identifier: Q14934-7) [UniParc]FASTAAdd to Basket

Also known as: IB-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGRDLGAPAGSM
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.

Show »
Length:914
Mass (Da):96,495
Checksum:iCBDD67F6FD13FA0B
GO
Isoform 8 (identifier: Q14934-8) [UniParc]FASTAAdd to Basket

Also known as: ID-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.

Show »
Length:901
Mass (Da):95,282
Checksum:i2F5A1C31D55440FA
GO
Isoform 9 (identifier: Q14934-9) [UniParc]FASTAAdd to Basket

Also known as: IE-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS

Show »
Length:890
Mass (Da):94,146
Checksum:iCD0C3EF25B5761B6
GO
Isoform 10 (identifier: Q14934-10) [UniParc]FASTAAdd to Basket

Also known as: IE-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.

Show »
Length:889
Mass (Da):93,978
Checksum:iE7A13F58DF1121B1
GO
Isoform 11 (identifier: Q14934-11) [UniParc]FASTAAdd to Basket

Also known as: IA-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM
     773-880: Missing.

Show »
Length:857
Mass (Da):90,525
Checksum:iAA5ED1F6E0713077
GO
Isoform 12 (identifier: Q14934-12) [UniParc]FASTAAdd to Basket

Also known as: IEi-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Note: Due to an intron retention.

Show »
Length:832
Mass (Da):88,270
Checksum:i22978126C7D764DB
GO
Isoform 13 (identifier: Q14934-13) [UniParc]FASTAAdd to Basket

Also known as: IEi-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.

Show »
Length:831
Mass (Da):88,103
Checksum:iCC1EEBC45F144C10
GO
Isoform 14 (identifier: Q14934-14) [UniParc]FASTAAdd to Basket

Also known as: IC-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM
     773-880: Missing.

Show »
Length:826
Mass (Da):87,282
Checksum:i4BF3996D8C2BA62C
GO
Isoform 15 (identifier: Q14934-15) [UniParc]FASTAAdd to Basket

Also known as: IB-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGRDLGAPAGSM
     773-880: Missing.

Show »
Length:807
Mass (Da):85,508
Checksum:iF9035684E3A5FE7E
GO
Isoform 16 (identifier: Q14934-16) [UniParc]FASTAAdd to Basket

Also known as: ID-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     773-880: Missing.

Show »
Length:794
Mass (Da):84,294
Checksum:i8378E0D0BB0888D2
GO
Isoform 17 (identifier: Q14934-17) [UniParc]FASTAAdd to Basket

Also known as: IE-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS
     773-880: Missing.

Show »
Length:782
Mass (Da):82,991
Checksum:i4B73A89F510DC96E
GO
Isoform 18 (identifier: Q14934-18) [UniParc]FASTAAdd to Basket

Also known as: IEi-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     773-880: Missing.

Note: Due to an intron retention.

Show »
Length:724
Mass (Da):77,115
Checksum:iE589F6754CC1B54C
GO
Isoform 19 (identifier: Q14934-19) [UniParc]FASTAAdd to Basket

Also known as: IV-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-465: Missing.

Show »
Length:437
Mass (Da):47,373
Checksum:iEEA72B2EDFA7E67A
GO
Isoform 20 (identifier: Q14934-20) [UniParc]FASTAAdd to Basket

Also known as: IV-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-465: Missing.
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.

Show »
Length:436
Mass (Da):47,206
Checksum:iACB4E3DC2F96ED8B
GO
Isoform 21 (identifier: Q14934-21) [UniParc]FASTAAdd to Basket

Also known as: IV-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-465: Missing.
     773-880: Missing.

Show »
Length:329
Mass (Da):36,219
Checksum:i043037F5F05D38C5
GO
Isoform 22 (identifier: Q14934-22) [UniParc]FASTAAdd to Basket

Also known as: VI-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-712: Missing.

Show »
Length:190
Mass (Da):20,104
Checksum:i3B4512C612A69FDF
GO
Isoform 23 (identifier: Q14934-23) [UniParc]FASTAAdd to Basket

Also known as: VI-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-712: Missing.
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.

Show »
Length:189
Mass (Da):19,937
Checksum:iCE8D0B112EEF4803
GO
Isoform 24 (identifier: Q14934-24) [UniParc]FASTAAdd to Basket

Also known as: VI-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-712: Missing.
     773-880: Missing.

Show »
Length:82
Mass (Da):8,950
Checksum:iDC673A88B52B383F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti359 – 3591E → K in BAG56726. (PubMed:14702039)Curated
Sequence conflicti646 – 6461L → P in BAG63617. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti160 – 1601G → A.2 Publications
Corresponds to variant rs2229309 [ dbSNP | Ensembl ].
VAR_046985
Natural varianti246 – 2461S → N.
Corresponds to variant rs2228231 [ dbSNP | Ensembl ].
VAR_046986
Natural varianti800 – 8001S → P.2 Publications
Corresponds to variant rs7149586 [ dbSNP | Ensembl ].
VAR_046987

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 712712Missing in isoform 22, isoform 23 and isoform 24. 1 PublicationVSP_036697Add
BLAST
Alternative sequencei1 – 465465Missing in isoform 19, isoform 20 and isoform 21. 1 PublicationVSP_036698Add
BLAST
Alternative sequencei1 – 7070Missing in isoform 12, isoform 13 and isoform 18. 2 PublicationsVSP_036699Add
BLAST
Alternative sequencei1 – 3232MGAAS…AGGLG → MPASISSIFPGPTLLLSCGS in isoform 9, isoform 10 and isoform 17. 1 PublicationVSP_036700Add
BLAST
Alternative sequencei1 – 11M → MITTLPSLLPASLASISHRV TNLPSNSLSHNPGLSKPDFP GNSSPGLPSSSSPGRDLGAP AGSM in isoform 2, isoform 3 and isoform 11. 1 PublicationVSP_036701
Alternative sequencei1 – 11M → MADGGADSAAQRLPEGPGRV APGRDLGAPAGSM in isoform 4, isoform 5 and isoform 14. 1 PublicationVSP_036702
Alternative sequencei1 – 11M → MLSGRDLGAPAGSM in isoform 6, isoform 7 and isoform 15. 1 PublicationVSP_036703
Alternative sequencei773 – 880108Missing in isoform 11, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 21 and isoform 24. 2 PublicationsVSP_036704Add
BLAST
Alternative sequencei881 – 90222VSEII…EEPPA → GGCGTGGCECECVQEIALHV C in isoform 3, isoform 5, isoform 7, isoform 8, isoform 10, isoform 13, isoform 20 and isoform 23. 1 PublicationVSP_036705Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L41066 mRNA. Translation: AAA79175.1.
EU887632 mRNA. Translation: ACG55652.1.
EU887633 mRNA. Translation: ACG55653.1.
EU887634 mRNA. Translation: ACG55654.1.
EU887635 mRNA. Translation: ACG55655.1.
EU887636 mRNA. Translation: ACG55656.1.
EU887637 mRNA. Translation: ACG55657.1.
EU887638 mRNA. Translation: ACG55658.1.
EU887639 mRNA. Translation: ACG55659.1.
EU887640 mRNA. Translation: ACG55660.1.
EU887641 mRNA. Translation: ACG55661.1.
EU887642 mRNA. Translation: ACG55662.1.
EU887643 mRNA. Translation: ACG55663.1.
EU887644 mRNA. Translation: ACG55664.1.
EU887645 mRNA. Translation: ACG55665.1.
EU887646 mRNA. Translation: ACG55666.1.
EU887647 mRNA. Translation: ACG55667.1.
EU887648 mRNA. Translation: ACG55668.1.
EU887649 mRNA. Translation: ACG55669.1.
EU887650 mRNA. Translation: ACG55670.1.
EU887651 mRNA. Translation: ACG55671.1.
EU887652 mRNA. Translation: ACG55672.1.
EU887653 mRNA. Translation: ACG55673.1.
EU887654 mRNA. Translation: ACG55674.1.
EU887655 mRNA. Translation: ACG55675.1.
AK293185 mRNA. Translation: BAG56726.1.
AK302271 mRNA. Translation: BAG63617.1.
BC008857 mRNA. Translation: AAH08857.2.
BC053855 mRNA. Translation: AAH53855.1.
CCDSiCCDS45089.1. [Q14934-3]
CCDS55909.1. [Q14934-11]
CCDS55910.1. [Q14934-16]
CCDS55911.1. [Q14934-12]
CCDS73625.1. [Q14934-10]
CCDS9629.1. [Q14934-1]
RefSeqiNP_001129494.1. NM_001136022.2. [Q14934-3]
NP_001185894.1. NM_001198965.1. [Q14934-16]
NP_001185895.1. NM_001198966.2. [Q14934-12]
NP_001185896.1. NM_001198967.2. [Q14934-11]
NP_001275731.1. NM_001288802.1. [Q14934-10]
NP_004545.2. NM_004554.4. [Q14934-1]
UniGeneiHs.77810.

Genome annotation databases

EnsembliENST00000250373; ENSP00000250373; ENSG00000100968. [Q14934-1]
ENST00000413692; ENSP00000388910; ENSG00000100968. [Q14934-3]
ENST00000422617; ENSP00000396788; ENSG00000100968. [Q14934-10]
ENST00000424781; ENSP00000388668; ENSG00000100968. [Q14934-7]
ENST00000539237; ENSP00000439350; ENSG00000100968. [Q14934-5]
ENST00000553469; ENSP00000451502; ENSG00000100968. [Q14934-14]
ENST00000553708; ENSP00000450590; ENSG00000100968. [Q14934-8]
ENST00000553879; ENSP00000452349; ENSG00000100968. [Q14934-12]
ENST00000554050; ENSP00000451151; ENSG00000100968. [Q14934-16]
ENST00000554344; ENSP00000450469; ENSG00000100968. [Q14934-12]
ENST00000554473; ENSP00000450810; ENSG00000100968. [Q14934-21]
ENST00000554591; ENSP00000452039; ENSG00000100968. [Q14934-11]
ENST00000554661; ENSP00000450733; ENSG00000100968. [Q14934-18]
ENST00000554966; ENSP00000450644; ENSG00000100968. [Q14934-15]
ENST00000555167; ENSP00000451395; ENSG00000100968. [Q14934-20]
ENST00000555393; ENSP00000451801; ENSG00000100968. [Q14934-23]
ENST00000555453; ENSP00000450686; ENSG00000100968. [Q14934-9]
ENST00000555590; ENSP00000451224; ENSG00000100968. [Q14934-6]
ENST00000555802; ENSP00000451590; ENSG00000100968. [Q14934-22]
ENST00000556169; ENSP00000451454; ENSG00000100968. [Q14934-17]
ENST00000556279; ENSP00000452270; ENSG00000100968. [Q14934-4]
ENST00000556759; ENSP00000451183; ENSG00000100968. [Q14934-19]
ENST00000557451; ENSP00000451284; ENSG00000100968. [Q14934-13]
ENST00000557767; ENSP00000451496; ENSG00000100968. [Q14934-24]
GeneIDi4776.
KEGGihsa:4776.
UCSCiuc001wpc.3. human. [Q14934-1]
uc001wpd.3. human. [Q14934-19]
uc010alr.3. human. [Q14934-11]
uc010alt.3. human. [Q14934-5]
uc010alv.3. human. [Q14934-10]
uc010tok.2. human. [Q14934-3]
uc010tol.2. human. [Q14934-2]
uc010tom.2. human. [Q14934-7]
uc010ton.2. human. [Q14934-6]
uc010too.2. human. [Q14934-15]
uc010top.2. human. [Q14934-4]
uc010toq.2. human. [Q14934-14]
uc010tor.2. human. [Q14934-16]
uc010tot.2. human. [Q14934-9]
uc010tov.2. human. [Q14934-17]
uc010tow.2. human. [Q14934-18]
uc010tox.2. human. [Q14934-13]
uc010toy.2. human. [Q14934-21]
uc010toz.2. human. [Q14934-20]
uc010tpa.2. human. [Q14934-22]
uc010tpb.2. human. [Q14934-23]

Polymorphism databases

DMDMi215274090.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L41066 mRNA. Translation: AAA79175.1 .
EU887632 mRNA. Translation: ACG55652.1 .
EU887633 mRNA. Translation: ACG55653.1 .
EU887634 mRNA. Translation: ACG55654.1 .
EU887635 mRNA. Translation: ACG55655.1 .
EU887636 mRNA. Translation: ACG55656.1 .
EU887637 mRNA. Translation: ACG55657.1 .
EU887638 mRNA. Translation: ACG55658.1 .
EU887639 mRNA. Translation: ACG55659.1 .
EU887640 mRNA. Translation: ACG55660.1 .
EU887641 mRNA. Translation: ACG55661.1 .
EU887642 mRNA. Translation: ACG55662.1 .
EU887643 mRNA. Translation: ACG55663.1 .
EU887644 mRNA. Translation: ACG55664.1 .
EU887645 mRNA. Translation: ACG55665.1 .
EU887646 mRNA. Translation: ACG55666.1 .
EU887647 mRNA. Translation: ACG55667.1 .
EU887648 mRNA. Translation: ACG55668.1 .
EU887649 mRNA. Translation: ACG55669.1 .
EU887650 mRNA. Translation: ACG55670.1 .
EU887651 mRNA. Translation: ACG55671.1 .
EU887652 mRNA. Translation: ACG55672.1 .
EU887653 mRNA. Translation: ACG55673.1 .
EU887654 mRNA. Translation: ACG55674.1 .
EU887655 mRNA. Translation: ACG55675.1 .
AK293185 mRNA. Translation: BAG56726.1 .
AK302271 mRNA. Translation: BAG63617.1 .
BC008857 mRNA. Translation: AAH08857.2 .
BC053855 mRNA. Translation: AAH53855.1 .
CCDSi CCDS45089.1. [Q14934-3 ]
CCDS55909.1. [Q14934-11 ]
CCDS55910.1. [Q14934-16 ]
CCDS55911.1. [Q14934-12 ]
CCDS73625.1. [Q14934-10 ]
CCDS9629.1. [Q14934-1 ]
RefSeqi NP_001129494.1. NM_001136022.2. [Q14934-3 ]
NP_001185894.1. NM_001198965.1. [Q14934-16 ]
NP_001185895.1. NM_001198966.2. [Q14934-12 ]
NP_001185896.1. NM_001198967.2. [Q14934-11 ]
NP_001275731.1. NM_001288802.1. [Q14934-10 ]
NP_004545.2. NM_004554.4. [Q14934-1 ]
UniGenei Hs.77810.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2YRP NMR - A 585-691 [» ]
ProteinModelPortali Q14934.
SMRi Q14934. Positions 405-691.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110849. 15 interactions.
IntActi Q14934. 10 interactions.
MINTi MINT-1535456.

PTM databases

PhosphoSitei Q14934.

Polymorphism databases

DMDMi 215274090.

Proteomic databases

MaxQBi Q14934.
PaxDbi Q14934.
PRIDEi Q14934.

Protocols and materials databases

DNASUi 4776.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000250373 ; ENSP00000250373 ; ENSG00000100968 . [Q14934-1 ]
ENST00000413692 ; ENSP00000388910 ; ENSG00000100968 . [Q14934-3 ]
ENST00000422617 ; ENSP00000396788 ; ENSG00000100968 . [Q14934-10 ]
ENST00000424781 ; ENSP00000388668 ; ENSG00000100968 . [Q14934-7 ]
ENST00000539237 ; ENSP00000439350 ; ENSG00000100968 . [Q14934-5 ]
ENST00000553469 ; ENSP00000451502 ; ENSG00000100968 . [Q14934-14 ]
ENST00000553708 ; ENSP00000450590 ; ENSG00000100968 . [Q14934-8 ]
ENST00000553879 ; ENSP00000452349 ; ENSG00000100968 . [Q14934-12 ]
ENST00000554050 ; ENSP00000451151 ; ENSG00000100968 . [Q14934-16 ]
ENST00000554344 ; ENSP00000450469 ; ENSG00000100968 . [Q14934-12 ]
ENST00000554473 ; ENSP00000450810 ; ENSG00000100968 . [Q14934-21 ]
ENST00000554591 ; ENSP00000452039 ; ENSG00000100968 . [Q14934-11 ]
ENST00000554661 ; ENSP00000450733 ; ENSG00000100968 . [Q14934-18 ]
ENST00000554966 ; ENSP00000450644 ; ENSG00000100968 . [Q14934-15 ]
ENST00000555167 ; ENSP00000451395 ; ENSG00000100968 . [Q14934-20 ]
ENST00000555393 ; ENSP00000451801 ; ENSG00000100968 . [Q14934-23 ]
ENST00000555453 ; ENSP00000450686 ; ENSG00000100968 . [Q14934-9 ]
ENST00000555590 ; ENSP00000451224 ; ENSG00000100968 . [Q14934-6 ]
ENST00000555802 ; ENSP00000451590 ; ENSG00000100968 . [Q14934-22 ]
ENST00000556169 ; ENSP00000451454 ; ENSG00000100968 . [Q14934-17 ]
ENST00000556279 ; ENSP00000452270 ; ENSG00000100968 . [Q14934-4 ]
ENST00000556759 ; ENSP00000451183 ; ENSG00000100968 . [Q14934-19 ]
ENST00000557451 ; ENSP00000451284 ; ENSG00000100968 . [Q14934-13 ]
ENST00000557767 ; ENSP00000451496 ; ENSG00000100968 . [Q14934-24 ]
GeneIDi 4776.
KEGGi hsa:4776.
UCSCi uc001wpc.3. human. [Q14934-1 ]
uc001wpd.3. human. [Q14934-19 ]
uc010alr.3. human. [Q14934-11 ]
uc010alt.3. human. [Q14934-5 ]
uc010alv.3. human. [Q14934-10 ]
uc010tok.2. human. [Q14934-3 ]
uc010tol.2. human. [Q14934-2 ]
uc010tom.2. human. [Q14934-7 ]
uc010ton.2. human. [Q14934-6 ]
uc010too.2. human. [Q14934-15 ]
uc010top.2. human. [Q14934-4 ]
uc010toq.2. human. [Q14934-14 ]
uc010tor.2. human. [Q14934-16 ]
uc010tot.2. human. [Q14934-9 ]
uc010tov.2. human. [Q14934-17 ]
uc010tow.2. human. [Q14934-18 ]
uc010tox.2. human. [Q14934-13 ]
uc010toy.2. human. [Q14934-21 ]
uc010toz.2. human. [Q14934-20 ]
uc010tpa.2. human. [Q14934-22 ]
uc010tpb.2. human. [Q14934-23 ]

Organism-specific databases

CTDi 4776.
GeneCardsi GC14P024834.
HGNCi HGNC:7778. NFATC4.
HPAi CAB032859.
HPA031641.
MIMi 602699. gene.
neXtProti NX_Q14934.
PharmGKBi PA31584.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG70055.
GeneTreei ENSGT00550000074562.
HOVERGENi HBG104364.
InParanoidi Q14934.
KOi K17334.
OMAi WTPDDPW.
OrthoDBi EOG79PJND.
PhylomeDBi Q14934.
TreeFami TF326480.

Miscellaneous databases

EvolutionaryTracei Q14934.
GeneWikii NFATC4.
GenomeRNAii 4776.
NextBioi 18420.
PROi Q14934.
SOURCEi Search...

Gene expression databases

Bgeei Q14934.
CleanExi HS_NFATC4.
ExpressionAtlasi Q14934. baseline and differential.
Genevestigatori Q14934.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProi IPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR011539. RHD.
[Graphical view ]
PANTHERi PTHR12533. PTHR12533. 1 hit.
Pfami PF00554. RHD. 1 hit.
PF01833. TIG. 1 hit.
[Graphical view ]
PRINTSi PR01789. NUCFACTORATC.
SMARTi SM00429. IPT. 1 hit.
[Graphical view ]
SUPFAMi SSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEi PS50254. REL_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation of two new members of the NF-AT gene family and functional characterization of the NF-AT proteins."
    Hoey T., Sun Y.-L., Williamson K., Xu X.
    Immunity 2:461-472(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANTS ALA-160 AND PRO-800.
    Tissue: T-cell.
  2. "Alternative splicing and expression of human and mouse NFAT genes."
    Vihma H., Pruunsild P., Timmusk T.
    Genomics 92:279-291(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20; 21; 22; 23 AND 24), TISSUE SPECIFICITY.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 12 AND 16).
    Tissue: Adrenal gland and Testis.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 61-902 (ISOFORMS 1/2/4/6), VARIANTS ALA-160 AND PRO-800.
    Tissue: Ovary and Rhabdomyosarcoma.
  5. "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT."
    Crabtree G.R.
    Cell 96:611-614(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: REVIEW.
  6. "Requirement of two NFATc4 transactivation domains for CBP potentiation."
    Yang T.T.C., Davis R.J., Chow C.-W.
    J. Biol. Chem. 276:39569-39576(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CREBBP.
  7. "Phosphorylation of NFATc4 by p38 mitogen-activated protein kinases."
    Yang T.T.C., Xiong Q., Enslen H., Davis R.J., Chow C.-W.
    Mol. Cell. Biol. 22:3892-3904(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, PHOSPHORYLATION AT SER-168 AND SER-170, MUTAGENESIS OF SER-168 AND SER-170.
  8. "Nuclear factor of activated T3 is a negative regulator of Ras-JNK1/2-AP-1 induced cell transformation."
    Yao K., Cho Y.-Y., Bergen H.R. III, Madden B.J., Choi B.Y., Ma W.-Y., Bode A.M., Dong Z.
    Cancer Res. 67:8725-8735(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MAPK8 AND MAPK9, PHOSPHORYLATION AT SER-213 AND SER-217, MUTAGENESIS OF SER-213 AND SER-217.
  9. Cited for: FUNCTION, INTERACTION WITH RPS6KA3, PHOSPHORYLATION AT SER-289 AND SER-344.
  10. Cited for: FUNCTION.
  11. "Regulation of the stability and transcriptional activity of NFATc4 by ubiquitination."
    Fan Y., Xie P., Zhang T., Zhang H., Gu D., She M., Li H.
    FEBS Lett. 582:4008-4014(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION, UBIQUITINATION.
  12. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "Integration of protein kinases mTOR and extracellular signal-regulated kinase 5 in regulating nucleocytoplasmic localization of NFATc4."
    Yang T.T.C., Yu R.Y.L., Agadir A., Gao G.-J., Campos-Gonzalez R., Tournier C., Chow C.-W.
    Mol. Cell. Biol. 28:3489-3501(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-168 AND SER-170.
  14. "The interleukin-1 receptor associated kinase 1 contributes to the regulation of NFAT."
    Wang D., Fasciano S., Li L.
    Mol. Immunol. 45:3902-3908(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH IRAK1.
  15. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  16. "Solution structure of the TIG domain from human nuclear factor of activated T-cells, cytoplasmic 4."
    RIKEN structural genomics initiative (RSGI)
    Submitted (FEB-2008) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 585-691.

Entry informationi

Entry nameiNFAC4_HUMAN
AccessioniPrimary (citable) accession number: Q14934
Secondary accession number(s): B4DDG5
, B4DY55, B5B2U7, B5B2U8, B5B2U9, B5B2V0, B5B2V1, B5B2V2, B5B2V3, B5B2V4, B5B2V5, B5B2V7, B5B2V8, B5B2V9, B5B2W0, B5B2W1, B5B2W2, B5B2W3, B5B2W4, B5B2W5, B5B2W6, B5B2W7, B5B2W8, B5B2W9, B5B2X0, Q7Z598, Q96H68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 25, 2008
Last modified: October 29, 2014
This is version 138 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3