Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor of activated T-cells, cytoplasmic 4

Gene

NFATC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 and IL-4. Transcriptionally repressed by estrogen receptors; this inhibition is further enhanced by estrogen. Increases the transcriptional activity of PPARG and has a direct role in adipocyte differentiation. May play an important role in myotube differentiation. May play a critical role in cardiac development and hypertrophy. May play a role in deafferentation-induced apoptosis of sensory neurons.4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi430 – 4378

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Differentiation, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100968-MONOMER.
SIGNORiQ14934.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 4
Short name:
NF-ATc4
Short name:
NFATc4
Alternative name(s):
T-cell transcription factor NFAT3
Short name:
NF-AT3
Gene namesi
Name:NFATC4
Synonyms:NFAT3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:7778. NFATC4.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Nucleus 1 Publication

  • Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi168S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-170. 1 Publication1
Mutagenesisi170S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-168. 1 Publication1
Mutagenesisi213S → A: Decreased transcriptional activity; when associated with A-217. 1 Publication1
Mutagenesisi217S → A: Decreased transcriptional activity; when associated with A-213. 1 Publication1

Organism-specific databases

DisGeNETi4776.
OpenTargetsiENSG00000100968.
PharmGKBiPA31584.

Polymorphism and mutation databases

BioMutaiNFATC4.
DMDMi215274090.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002051821 – 902Nuclear factor of activated T-cells, cytoplasmic 4Add BLAST902

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei168Phosphoserine; by MAPK7 and MAPK142 Publications1
Modified residuei170Phosphoserine; by MAPK7 and MAPK142 Publications1
Modified residuei213Phosphoserine; by MAPK8 and MAPK91 Publication1
Modified residuei217Phosphoserine; by MAPK8 and MAPK91 Publication1
Modified residuei289Phosphoserine; by RPS6KA31 Publication1
Modified residuei344Phosphoserine; by RPS6KA31 Publication1

Post-translational modificationi

Phosphorylated by NFATC-kinases; dephosphorylated by calcineurin. Phosphorylated on Ser-168 and Ser-170 by MTOR, IRAK1, MAPK7 and MAPK14, on Ser-213 and Ser-217 by MAPK8 and MAPK9, and on Ser-289 and Ser-344 by RPS6KA3. Phosphorylated by GSK3B.5 Publications
Ubiquitinated, leading to its degradation by the proteasome and reduced transcriptional activity. Ubiquitination and reduction in transcriptional activity can be further facilitated through GSK3B-dependent phosphorylation. Polyubiquitin linkage is mainly through 'Lys-48'.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ14934.
PaxDbiQ14934.
PeptideAtlasiQ14934.
PRIDEiQ14934.

PTM databases

iPTMnetiQ14934.
PhosphoSitePlusiQ14934.

Expressioni

Tissue specificityi

Highly expressed in placenta, lung, kidney, testis and ovary. Weakly expressed in spleen and thymus. Not expressed in peripheral blood lymphocytes. Detected in hippocampus.1 Publication

Gene expression databases

BgeeiENSG00000100968.
CleanExiHS_NFATC4.
ExpressionAtlasiQ14934. baseline and differential.
GenevisibleiQ14934. HS.

Organism-specific databases

HPAiCAB032859.
HPA031641.

Interactioni

Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers. Interacts with CREBBP, GATA4, IRAK1, MAPK8, MAPK9 and RPS6KA3.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
UBCP0CG483EBI-3905796,EBI-3390054

Protein-protein interaction databases

BioGridi110849. 16 interactors.
IntActiQ14934. 11 interactors.
MINTiMINT-1535456.
STRINGi9606.ENSP00000388910.

Structurei

Secondary structure

1902
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi587 – 594Combined sources8
Beta strandi602 – 610Combined sources9
Beta strandi616 – 620Combined sources5
Turni638 – 640Combined sources3
Beta strandi645 – 649Combined sources5
Beta strandi662 – 669Combined sources8
Beta strandi671 – 673Combined sources3
Beta strandi679 – 684Combined sources6
Beta strandi687 – 689Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YRPNMR-A585-691[»]
ProteinModelPortaliQ14934.
SMRiQ14934.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14934.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati213 – 229SP 1Add BLAST17
Repeati277 – 293SP 2; approximateAdd BLAST17
Domaini401 – 582RHDPROSITE-ProRule annotationAdd BLAST182
Domaini586 – 683IPT/TIGAdd BLAST98

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni114 – 119Calcineurin-binding6
Regioni213 – 2932 approximate SP repeatsAdd BLAST81

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi268 – 270Nuclear localization signal3
Motifi672 – 674Nuclear localization signal3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi41 – 327Pro-richAdd BLAST287
Compositional biasi717 – 836Pro-richAdd BLAST120

Domaini

Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.By similarity

Sequence similaritiesi

Contains 1 IPT/TIG domain.Curated
Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IIAD. Eukaryota.
ENOG4111EMW. LUCA.
GeneTreeiENSGT00550000074562.
HOVERGENiHBG104364.
InParanoidiQ14934.
KOiK17334.
OMAiWTPDDPW.
OrthoDBiEOG091G01QP.
PhylomeDBiQ14934.
TreeFamiTF326480.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR032397. RHD_dimer.
IPR011539. RHD_DNA_bind_dom.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PfamiPF16179. RHD_dimer. 1 hit.
PF00554. RHD_DNA_bind. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]

Sequences (24)i

Sequence statusi: Complete.

This entry describes 24 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14934-1) [UniParc]FASTAAdd to basket
Also known as: ID-IXL

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAASCEDEE LEFKLVFGEE KEAPPLGAGG LGEELDSEDA PPCCRLALGE
60 70 80 90 100
PPPYGAAPIG IPRPPPPRPG MHSPPPRPAP SPGTWESQPA RSVRLGGPGG
110 120 130 140 150
GAGGAGGGRV LECPSIRITS ISPTPEPPAA LEDNPDAWGD GSPRDYPPPE
160 170 180 190 200
GFGGYREAGG QGGGAFFSPS PGSSSLSSWS FFSDASDEAA LYAACDEVES
210 220 230 240 250
ELNEAASRFG LGSPLPSPRA SPRPWTPEDP WSLYGPSPGG RGPEDSWLLL
260 270 280 290 300
SAPGPTPASP RPASPCGKRR YSSSGTPSSA SPALSRRGSL GEEGSEPPPP
310 320 330 340 350
PPLPLARDPG SPGPFDYVGA PPAESIPQKT RRTSSEQAVA LPRSEEPASC
360 370 380 390 400
NGKLPLGAEE SVAPPGGSRK EVAGMDYLAV PSPLAWSKAR IGGHSPIFRT
410 420 430 440 450
SALPPLDWPL PSQYEQLELR IEVQPRAHHR AHYETEGSRG AVKAAPGGHP
460 470 480 490 500
VVKLLGYSEK PLTLQMFIGT ADERNLRPHA FYQVHRITGK MVATASYEAV
510 520 530 540 550
VSGTKVLEMT LLPENNMAAN IDCAGILKLR NSDIELRKGE TDIGRKNTRV
560 570 580 590 600
RLVFRVHVPQ GGGKVVSVQA ASVPIECSQR SAQELPQVEA YSPSACSVRG
610 620 630 640 650
GEELVLTGSN FLPDSKVVFI ERGPDGKLQW EEEATVNRLQ SNEVTLTLTV
660 670 680 690 700
PEYSNKRVSR PVQVYFYVSN GRRKRSPTQS FRFLPVICKE EPLPDSSLRG
710 720 730 740 750
FPSASATPFG TDMDFSPPRP PYPSYPHEDP ACETPYLSEG FGYGMPPLYP
760 770 780 790 800
QTGPPPSYRP GLRMFPETRG TTGCAQPPAV SFLPRPFPSD PYGGRGSSFS
810 820 830 840 850
LGLPFSPPAP FRPPPLPASP PLEGPFPSQS DVHPLPAEGY NKVGPGYGPG
860 870 880 890 900
EGAPEQEKSR GGYSSGFRDS VPIQGITLEE VSEIIGRDLS GFPAPPGEEP

PA
Length:902
Mass (Da):95,449
Last modified:November 25, 2008 - v2
Checksum:iAE94C5D1325D24D7
GO
Isoform 2 (identifier: Q14934-2) [UniParc]FASTAAdd to basket
Also known as: IA-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM

Show »
Length:965
Mass (Da):101,680
Checksum:i977A42276D24A2DD
GO
Isoform 3 (identifier: Q14934-3) [UniParc]FASTAAdd to basket
Also known as: IA-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:964
Mass (Da):101,513
Checksum:i91DDEA6EACD24AD1
GO
Isoform 4 (identifier: Q14934-4) [UniParc]FASTAAdd to basket
Also known as: IC-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM

Show »
Length:934
Mass (Da):98,436
Checksum:iE72E379E8F1087A2
GO
Isoform 5 (identifier: Q14934-5) [UniParc]FASTAAdd to basket
Also known as: IC-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:933
Mass (Da):98,269
Checksum:iB5A8538C98F73584
GO
Isoform 6 (identifier: Q14934-6) [UniParc]FASTAAdd to basket
Also known as: IB-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGRDLGAPAGSM

Show »
Length:915
Mass (Da):96,662
Checksum:i36C042AAF575636D
GO
Isoform 7 (identifier: Q14934-7) [UniParc]FASTAAdd to basket
Also known as: IB-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGRDLGAPAGSM
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:914
Mass (Da):96,495
Checksum:iCBDD67F6FD13FA0B
GO
Isoform 8 (identifier: Q14934-8) [UniParc]FASTAAdd to basket
Also known as: ID-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:901
Mass (Da):95,282
Checksum:i2F5A1C31D55440FA
GO
Isoform 9 (identifier: Q14934-9) [UniParc]FASTAAdd to basket
Also known as: IE-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS

Show »
Length:890
Mass (Da):94,146
Checksum:iCD0C3EF25B5761B6
GO
Isoform 10 (identifier: Q14934-10) [UniParc]FASTAAdd to basket
Also known as: IE-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:889
Mass (Da):93,978
Checksum:iE7A13F58DF1121B1
GO
Isoform 11 (identifier: Q14934-11) [UniParc]FASTAAdd to basket
Also known as: IA-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM
     773-880: Missing.

Show »
Length:857
Mass (Da):90,525
Checksum:iAA5ED1F6E0713077
GO
Isoform 12 (identifier: Q14934-12) [UniParc]FASTAAdd to basket
Also known as: IEi-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Note: Due to an intron retention.
Show »
Length:832
Mass (Da):88,270
Checksum:i22978126C7D764DB
GO
Isoform 13 (identifier: Q14934-13) [UniParc]FASTAAdd to basket
Also known as: IEi-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:831
Mass (Da):88,103
Checksum:iCC1EEBC45F144C10
GO
Isoform 14 (identifier: Q14934-14) [UniParc]FASTAAdd to basket
Also known as: IC-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM
     773-880: Missing.

Show »
Length:826
Mass (Da):87,282
Checksum:i4BF3996D8C2BA62C
GO
Isoform 15 (identifier: Q14934-15) [UniParc]FASTAAdd to basket
Also known as: IB-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGRDLGAPAGSM
     773-880: Missing.

Show »
Length:807
Mass (Da):85,508
Checksum:iF9035684E3A5FE7E
GO
Isoform 16 (identifier: Q14934-16) [UniParc]FASTAAdd to basket
Also known as: ID-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     773-880: Missing.

Show »
Length:794
Mass (Da):84,294
Checksum:i8378E0D0BB0888D2
GO
Isoform 17 (identifier: Q14934-17) [UniParc]FASTAAdd to basket
Also known as: IE-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS
     773-880: Missing.

Show »
Length:782
Mass (Da):82,991
Checksum:i4B73A89F510DC96E
GO
Isoform 18 (identifier: Q14934-18) [UniParc]FASTAAdd to basket
Also known as: IEi-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     773-880: Missing.

Note: Due to an intron retention.
Show »
Length:724
Mass (Da):77,115
Checksum:iE589F6754CC1B54C
GO
Isoform 19 (identifier: Q14934-19) [UniParc]FASTAAdd to basket
Also known as: IV-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-465: Missing.

Show »
Length:437
Mass (Da):47,373
Checksum:iEEA72B2EDFA7E67A
GO
Isoform 20 (identifier: Q14934-20) [UniParc]FASTAAdd to basket
Also known as: IV-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-465: Missing.
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:436
Mass (Da):47,206
Checksum:iACB4E3DC2F96ED8B
GO
Isoform 21 (identifier: Q14934-21) [UniParc]FASTAAdd to basket
Also known as: IV-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-465: Missing.
     773-880: Missing.

Show »
Length:329
Mass (Da):36,219
Checksum:i043037F5F05D38C5
GO
Isoform 22 (identifier: Q14934-22) [UniParc]FASTAAdd to basket
Also known as: VI-IXL

The sequence of this isoform differs from the canonical sequence as follows:
     1-712: Missing.

Show »
Length:190
Mass (Da):20,104
Checksum:i3B4512C612A69FDF
GO
Isoform 23 (identifier: Q14934-23) [UniParc]FASTAAdd to basket
Also known as: VI-IXi

The sequence of this isoform differs from the canonical sequence as follows:
     1-712: Missing.
     881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC

Note: Due to an intron retention.
Show »
Length:189
Mass (Da):19,937
Checksum:iCE8D0B112EEF4803
GO
Isoform 24 (identifier: Q14934-24) [UniParc]FASTAAdd to basket
Also known as: VI-IXS

The sequence of this isoform differs from the canonical sequence as follows:
     1-712: Missing.
     773-880: Missing.

Show »
Length:82
Mass (Da):8,950
Checksum:iDC673A88B52B383F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti359E → K in BAG56726 (PubMed:14702039).Curated1
Sequence conflicti646L → P in BAG63617 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_046985160G → A.2 PublicationsCorresponds to variant rs2229309dbSNPEnsembl.1
Natural variantiVAR_046986246S → N.Corresponds to variant rs2228231dbSNPEnsembl.1
Natural variantiVAR_046987800S → P.2 PublicationsCorresponds to variant rs7149586dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0366971 – 712Missing in isoform 22, isoform 23 and isoform 24. 1 PublicationAdd BLAST712
Alternative sequenceiVSP_0366981 – 465Missing in isoform 19, isoform 20 and isoform 21. 1 PublicationAdd BLAST465
Alternative sequenceiVSP_0366991 – 70Missing in isoform 12, isoform 13 and isoform 18. 2 PublicationsAdd BLAST70
Alternative sequenceiVSP_0367001 – 32MGAAS…AGGLG → MPASISSIFPGPTLLLSCGS in isoform 9, isoform 10 and isoform 17. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0367011M → MITTLPSLLPASLASISHRV TNLPSNSLSHNPGLSKPDFP GNSSPGLPSSSSPGRDLGAP AGSM in isoform 2, isoform 3 and isoform 11. 1 Publication1
Alternative sequenceiVSP_0367021M → MADGGADSAAQRLPEGPGRV APGRDLGAPAGSM in isoform 4, isoform 5 and isoform 14. 1 Publication1
Alternative sequenceiVSP_0367031M → MLSGRDLGAPAGSM in isoform 6, isoform 7 and isoform 15. 1 Publication1
Alternative sequenceiVSP_036704773 – 880Missing in isoform 11, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 21 and isoform 24. 2 PublicationsAdd BLAST108
Alternative sequenceiVSP_036705881 – 902VSEII…EEPPA → GGCGTGGCECECVQEIALHV C in isoform 3, isoform 5, isoform 7, isoform 8, isoform 10, isoform 13, isoform 20 and isoform 23. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L41066 mRNA. Translation: AAA79175.1.
EU887632 mRNA. Translation: ACG55652.1.
EU887633 mRNA. Translation: ACG55653.1.
EU887634 mRNA. Translation: ACG55654.1.
EU887635 mRNA. Translation: ACG55655.1.
EU887636 mRNA. Translation: ACG55656.1.
EU887637 mRNA. Translation: ACG55657.1.
EU887638 mRNA. Translation: ACG55658.1.
EU887639 mRNA. Translation: ACG55659.1.
EU887640 mRNA. Translation: ACG55660.1.
EU887641 mRNA. Translation: ACG55661.1.
EU887642 mRNA. Translation: ACG55662.1.
EU887643 mRNA. Translation: ACG55663.1.
EU887644 mRNA. Translation: ACG55664.1.
EU887645 mRNA. Translation: ACG55665.1.
EU887646 mRNA. Translation: ACG55666.1.
EU887647 mRNA. Translation: ACG55667.1.
EU887648 mRNA. Translation: ACG55668.1.
EU887649 mRNA. Translation: ACG55669.1.
EU887650 mRNA. Translation: ACG55670.1.
EU887651 mRNA. Translation: ACG55671.1.
EU887652 mRNA. Translation: ACG55672.1.
EU887653 mRNA. Translation: ACG55673.1.
EU887654 mRNA. Translation: ACG55674.1.
EU887655 mRNA. Translation: ACG55675.1.
AK293185 mRNA. Translation: BAG56726.1.
AK302271 mRNA. Translation: BAG63617.1.
BC008857 mRNA. Translation: AAH08857.2.
BC053855 mRNA. Translation: AAH53855.1.
CCDSiCCDS45089.1. [Q14934-3]
CCDS55909.1. [Q14934-11]
CCDS55910.1. [Q14934-16]
CCDS55911.1. [Q14934-12]
CCDS73625.1. [Q14934-10]
CCDS9629.1. [Q14934-1]
RefSeqiNP_001129494.1. NM_001136022.2. [Q14934-3]
NP_001185894.1. NM_001198965.1. [Q14934-16]
NP_001185895.1. NM_001198966.2. [Q14934-12]
NP_001185896.1. NM_001198967.2. [Q14934-11]
NP_001275731.1. NM_001288802.1. [Q14934-10]
NP_001306972.1. NM_001320043.1. [Q14934-2]
NP_004545.2. NM_004554.4. [Q14934-1]
XP_011535099.1. XM_011536797.2. [Q14934-9]
XP_011535101.1. XM_011536799.2. [Q14934-17]
UniGeneiHs.77810.

Genome annotation databases

EnsembliENST00000250373; ENSP00000250373; ENSG00000100968. [Q14934-1]
ENST00000413692; ENSP00000388910; ENSG00000100968. [Q14934-3]
ENST00000422617; ENSP00000396788; ENSG00000100968. [Q14934-10]
ENST00000424781; ENSP00000388668; ENSG00000100968. [Q14934-7]
ENST00000539237; ENSP00000439350; ENSG00000100968. [Q14934-5]
ENST00000553469; ENSP00000451502; ENSG00000100968. [Q14934-14]
ENST00000553708; ENSP00000450590; ENSG00000100968. [Q14934-8]
ENST00000553879; ENSP00000452349; ENSG00000100968. [Q14934-12]
ENST00000554050; ENSP00000451151; ENSG00000100968. [Q14934-16]
ENST00000554344; ENSP00000450469; ENSG00000100968. [Q14934-12]
ENST00000554473; ENSP00000450810; ENSG00000100968. [Q14934-21]
ENST00000554591; ENSP00000452039; ENSG00000100968. [Q14934-11]
ENST00000554661; ENSP00000450733; ENSG00000100968. [Q14934-18]
ENST00000554966; ENSP00000450644; ENSG00000100968. [Q14934-15]
ENST00000555167; ENSP00000451395; ENSG00000100968. [Q14934-20]
ENST00000555393; ENSP00000451801; ENSG00000100968. [Q14934-23]
ENST00000555453; ENSP00000450686; ENSG00000100968. [Q14934-9]
ENST00000555590; ENSP00000451224; ENSG00000100968. [Q14934-6]
ENST00000555802; ENSP00000451590; ENSG00000100968. [Q14934-22]
ENST00000556169; ENSP00000451454; ENSG00000100968. [Q14934-17]
ENST00000556279; ENSP00000452270; ENSG00000100968. [Q14934-4]
ENST00000556759; ENSP00000451183; ENSG00000100968. [Q14934-19]
ENST00000557451; ENSP00000451284; ENSG00000100968. [Q14934-13]
ENST00000557767; ENSP00000451496; ENSG00000100968. [Q14934-24]
GeneIDi4776.
KEGGihsa:4776.
UCSCiuc001wpc.5. human. [Q14934-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L41066 mRNA. Translation: AAA79175.1.
EU887632 mRNA. Translation: ACG55652.1.
EU887633 mRNA. Translation: ACG55653.1.
EU887634 mRNA. Translation: ACG55654.1.
EU887635 mRNA. Translation: ACG55655.1.
EU887636 mRNA. Translation: ACG55656.1.
EU887637 mRNA. Translation: ACG55657.1.
EU887638 mRNA. Translation: ACG55658.1.
EU887639 mRNA. Translation: ACG55659.1.
EU887640 mRNA. Translation: ACG55660.1.
EU887641 mRNA. Translation: ACG55661.1.
EU887642 mRNA. Translation: ACG55662.1.
EU887643 mRNA. Translation: ACG55663.1.
EU887644 mRNA. Translation: ACG55664.1.
EU887645 mRNA. Translation: ACG55665.1.
EU887646 mRNA. Translation: ACG55666.1.
EU887647 mRNA. Translation: ACG55667.1.
EU887648 mRNA. Translation: ACG55668.1.
EU887649 mRNA. Translation: ACG55669.1.
EU887650 mRNA. Translation: ACG55670.1.
EU887651 mRNA. Translation: ACG55671.1.
EU887652 mRNA. Translation: ACG55672.1.
EU887653 mRNA. Translation: ACG55673.1.
EU887654 mRNA. Translation: ACG55674.1.
EU887655 mRNA. Translation: ACG55675.1.
AK293185 mRNA. Translation: BAG56726.1.
AK302271 mRNA. Translation: BAG63617.1.
BC008857 mRNA. Translation: AAH08857.2.
BC053855 mRNA. Translation: AAH53855.1.
CCDSiCCDS45089.1. [Q14934-3]
CCDS55909.1. [Q14934-11]
CCDS55910.1. [Q14934-16]
CCDS55911.1. [Q14934-12]
CCDS73625.1. [Q14934-10]
CCDS9629.1. [Q14934-1]
RefSeqiNP_001129494.1. NM_001136022.2. [Q14934-3]
NP_001185894.1. NM_001198965.1. [Q14934-16]
NP_001185895.1. NM_001198966.2. [Q14934-12]
NP_001185896.1. NM_001198967.2. [Q14934-11]
NP_001275731.1. NM_001288802.1. [Q14934-10]
NP_001306972.1. NM_001320043.1. [Q14934-2]
NP_004545.2. NM_004554.4. [Q14934-1]
XP_011535099.1. XM_011536797.2. [Q14934-9]
XP_011535101.1. XM_011536799.2. [Q14934-17]
UniGeneiHs.77810.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YRPNMR-A585-691[»]
ProteinModelPortaliQ14934.
SMRiQ14934.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110849. 16 interactors.
IntActiQ14934. 11 interactors.
MINTiMINT-1535456.
STRINGi9606.ENSP00000388910.

PTM databases

iPTMnetiQ14934.
PhosphoSitePlusiQ14934.

Polymorphism and mutation databases

BioMutaiNFATC4.
DMDMi215274090.

Proteomic databases

MaxQBiQ14934.
PaxDbiQ14934.
PeptideAtlasiQ14934.
PRIDEiQ14934.

Protocols and materials databases

DNASUi4776.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000250373; ENSP00000250373; ENSG00000100968. [Q14934-1]
ENST00000413692; ENSP00000388910; ENSG00000100968. [Q14934-3]
ENST00000422617; ENSP00000396788; ENSG00000100968. [Q14934-10]
ENST00000424781; ENSP00000388668; ENSG00000100968. [Q14934-7]
ENST00000539237; ENSP00000439350; ENSG00000100968. [Q14934-5]
ENST00000553469; ENSP00000451502; ENSG00000100968. [Q14934-14]
ENST00000553708; ENSP00000450590; ENSG00000100968. [Q14934-8]
ENST00000553879; ENSP00000452349; ENSG00000100968. [Q14934-12]
ENST00000554050; ENSP00000451151; ENSG00000100968. [Q14934-16]
ENST00000554344; ENSP00000450469; ENSG00000100968. [Q14934-12]
ENST00000554473; ENSP00000450810; ENSG00000100968. [Q14934-21]
ENST00000554591; ENSP00000452039; ENSG00000100968. [Q14934-11]
ENST00000554661; ENSP00000450733; ENSG00000100968. [Q14934-18]
ENST00000554966; ENSP00000450644; ENSG00000100968. [Q14934-15]
ENST00000555167; ENSP00000451395; ENSG00000100968. [Q14934-20]
ENST00000555393; ENSP00000451801; ENSG00000100968. [Q14934-23]
ENST00000555453; ENSP00000450686; ENSG00000100968. [Q14934-9]
ENST00000555590; ENSP00000451224; ENSG00000100968. [Q14934-6]
ENST00000555802; ENSP00000451590; ENSG00000100968. [Q14934-22]
ENST00000556169; ENSP00000451454; ENSG00000100968. [Q14934-17]
ENST00000556279; ENSP00000452270; ENSG00000100968. [Q14934-4]
ENST00000556759; ENSP00000451183; ENSG00000100968. [Q14934-19]
ENST00000557451; ENSP00000451284; ENSG00000100968. [Q14934-13]
ENST00000557767; ENSP00000451496; ENSG00000100968. [Q14934-24]
GeneIDi4776.
KEGGihsa:4776.
UCSCiuc001wpc.5. human. [Q14934-1]

Organism-specific databases

CTDi4776.
DisGeNETi4776.
GeneCardsiNFATC4.
HGNCiHGNC:7778. NFATC4.
HPAiCAB032859.
HPA031641.
MIMi602699. gene.
neXtProtiNX_Q14934.
OpenTargetsiENSG00000100968.
PharmGKBiPA31584.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IIAD. Eukaryota.
ENOG4111EMW. LUCA.
GeneTreeiENSGT00550000074562.
HOVERGENiHBG104364.
InParanoidiQ14934.
KOiK17334.
OMAiWTPDDPW.
OrthoDBiEOG091G01QP.
PhylomeDBiQ14934.
TreeFamiTF326480.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100968-MONOMER.
SIGNORiQ14934.

Miscellaneous databases

EvolutionaryTraceiQ14934.
GeneWikiiNFATC4.
GenomeRNAii4776.
PROiQ14934.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100968.
CleanExiHS_NFATC4.
ExpressionAtlasiQ14934. baseline and differential.
GenevisibleiQ14934. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR032397. RHD_dimer.
IPR011539. RHD_DNA_bind_dom.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PfamiPF16179. RHD_dimer. 1 hit.
PF00554. RHD_DNA_bind. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNFAC4_HUMAN
AccessioniPrimary (citable) accession number: Q14934
Secondary accession number(s): B4DDG5
, B4DY55, B5B2U7, B5B2U8, B5B2U9, B5B2V0, B5B2V1, B5B2V2, B5B2V3, B5B2V4, B5B2V5, B5B2V7, B5B2V8, B5B2V9, B5B2W0, B5B2W1, B5B2W2, B5B2W3, B5B2W4, B5B2W5, B5B2W6, B5B2W7, B5B2W8, B5B2W9, B5B2X0, Q7Z598, Q96H68
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 25, 2008
Last modified: November 2, 2016
This is version 156 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.