Reviewed,
UniProtKB/Swiss-Prot Q14934 (NFAC4_HUMAN)
Last modified
January 19, 2010.
Version 95.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Nuclear factor of activated T-cells, cytoplasmic 4 Short name=NF-ATc4 Short name=NFATc4 Alternative name(s): T-cell transcription factor NFAT3 Short name=NF-AT3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 902 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 and IL-4. Transcriptionally repressed by estrogen receptors; this inhibition is further enhanced by estrogen. Increases the transcriptional activity of PPARG and has a direct role in adipocyte differentiation. May play an important role in myotube differentiation. May play a critical role in cardiac development and hypertrophy. May play a role in deafferentation-induced apoptosis of sensory neurons. Ref.1 Ref.7 Ref.10 Ref.11 |
| Subunit structure | Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers. Interacts with CREBBP, GATA4, IRAK1, MAPK8, MAPK9 and RPS6KA3. Ref.10 Ref.6 Ref.9 Ref.15 |
| Subcellular location | Cytoplasm. Nucleus. Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. Ref.14 |
| Tissue specificity | Highly expressed in placenta, lung, kidney, testis and ovary. Weakly expressed in spleen and thymus. Not expressed in peripheral blood lymphocytes. Detected in hippocampus. Ref.2 |
| Domain | Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors By similarity. |
| Post-translational modification | Phosphorylated by NFATC-kinases; dephosphorylated by calcineurin. Phosphorylated on Ser-168 and Ser-170 by FRAP1, IRAK1, MAPK7 and MAPK14, on Ser-213 and Ser-217 by MAPK8 and MAPK9, and on Ser-289 and Ser-344 by RPS6KA3. Phosphorylated by GSK3B. Ref.7 Ref.10 Ref.9 Ref.14 Ref.8 Ref.12 Ref.13 Ubiquitinated, leading to its degradation by the proteasome and reduced transcriptional activity. Ubiquitination and reduction in transcriptional activity can be further facilitated through GSK3B-dependent phosphorylation. Polyubiquitin linkage is mainly through 'Lys-48'. Ref.12 |
| Sequence similarities | Contains 1 IPT/TIG domain. Contains 1 RHD (Rel-like) domain. |
Ontologies
Alternative products
| This entry describes 24 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q14934-1) Also known as: ID-IXL; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q14934-2) Also known as: IA-IXL; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM | ||||||
| Isoform 3 (identifier: Q14934-3) Also known as: IA-IXi; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM 881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 4 (identifier: Q14934-4) Also known as: IC-IXL; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM | ||||||
| Isoform 5 (identifier: Q14934-5) Also known as: IC-IXi; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM 881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 6 (identifier: Q14934-6) Also known as: IB-IXL; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLSGRDLGAPAGSM | ||||||
| Isoform 7 (identifier: Q14934-7) Also known as: IB-IXi; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLSGRDLGAPAGSM 881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 8 (identifier: Q14934-8) Also known as: ID-IXi; The sequence of this isoform differs from the canonical sequence as follows: 881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 9 (identifier: Q14934-9) Also known as: IE-IXL; The sequence of this isoform differs from the canonical sequence as follows: 1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS | ||||||
| Isoform 10 (identifier: Q14934-10) Also known as: IE-IXi; The sequence of this isoform differs from the canonical sequence as follows: 1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS 881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 11 (identifier: Q14934-11) Also known as: IA-IXS; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MITTLPSLLPASLASISHRVTNLPSNSLSHNPGLSKPDFPGNSSPGLPSSSSPGRDLGAPAGSM 773-880: Missing. | ||||||
| Isoform 12 (identifier: Q14934-12) Also known as: IEi-IXL; The sequence of this isoform differs from the canonical sequence as follows: 1-70: Missing. | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 13 (identifier: Q14934-13) Also known as: IEi-IXi; The sequence of this isoform differs from the canonical sequence as follows: 1-70: Missing. 881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 14 (identifier: Q14934-14) Also known as: IC-IXS; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MADGGADSAAQRLPEGPGRVAPGRDLGAPAGSM 773-880: Missing. | ||||||
| Isoform 15 (identifier: Q14934-15) Also known as: IB-IXS; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLSGRDLGAPAGSM 773-880: Missing. | ||||||
| Isoform 16 (identifier: Q14934-16) Also known as: ID-IXS; The sequence of this isoform differs from the canonical sequence as follows: 773-880: Missing. | ||||||
| Isoform 17 (identifier: Q14934-17) Also known as: IE-IXS; The sequence of this isoform differs from the canonical sequence as follows: 1-32: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLG → MPASISSIFPGPTLLLSCGS 773-880: Missing. | ||||||
| Isoform 18 (identifier: Q14934-18) Also known as: IEi-IXS; The sequence of this isoform differs from the canonical sequence as follows: 1-70: Missing. 773-880: Missing. | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 19 (identifier: Q14934-19) Also known as: IV-IXL; The sequence of this isoform differs from the canonical sequence as follows: 1-465: Missing. | ||||||
| Isoform 20 (identifier: Q14934-20) Also known as: IV-IXi; The sequence of this isoform differs from the canonical sequence as follows: 1-465: Missing. 881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 21 (identifier: Q14934-21) Also known as: IV-IXS; The sequence of this isoform differs from the canonical sequence as follows: 1-465: Missing. 773-880: Missing. | ||||||
| Isoform 22 (identifier: Q14934-22) Also known as: VI-IXL; The sequence of this isoform differs from the canonical sequence as follows: 1-712: Missing. | ||||||
| Isoform 23 (identifier: Q14934-23) Also known as: VI-IXi; The sequence of this isoform differs from the canonical sequence as follows: 1-712: Missing. 881-902: VSEIIGRDLSGFPAPPGEEPPA → GGCGTGGCECECVQEIALHVC | ||||||
| Note: Due to an intron retention. | ||||||
| Isoform 24 (identifier: Q14934-24) Also known as: VI-IXS; The sequence of this isoform differs from the canonical sequence as follows: 1-712: Missing. 773-880: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 902 | 902 | Nuclear factor of activated T-cells, cytoplasmic 4 | PRO_0000205182 | |||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||
| Repeat | 213 – 229 | 17 | SP 1 | ||||||||||||||||||||||||
| Repeat | 277 – 293 | 17 | SP 2; approximate | ||||||||||||||||||||||||
| Domain | 401 – 582 | 182 | RHD | ||||||||||||||||||||||||
| Domain | 586 – 683 | 98 | IPT/TIG | ||||||||||||||||||||||||
| DNA binding | 430 – 437 | 8 | |||||||||||||||||||||||||
| Region | 114 – 119 | 6 | Calcineurin-binding | ||||||||||||||||||||||||
| Region | 213 – 293 | 81 | 2 approximate SP repeats | ||||||||||||||||||||||||
| Motif | 268 – 270 | 3 | Nuclear localization signal | ||||||||||||||||||||||||
| Motif | 672 – 674 | 3 | Nuclear localization signal | ||||||||||||||||||||||||
| Compositional bias | 41 – 327 | 287 | Pro-rich | ||||||||||||||||||||||||
| Compositional bias | 717 – 836 | 120 | Pro-rich | ||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||
| Modified residue | 168 | 1 | Phosphoserine; by MAPK7 and MAPK14 Ref.7 Ref.14 | ||||||||||||||||||||||||
| Modified residue | 170 | 1 | Phosphoserine; by MAPK7 and MAPK14 Ref.7 Ref.14 | ||||||||||||||||||||||||
| Modified residue | 213 | 1 | Phosphoserine; by MAPK8 and MAPK9 Ref.9 | ||||||||||||||||||||||||
| Modified residue | 217 | 1 | Phosphoserine; by MAPK8 and MAPK9 Ref.9 | ||||||||||||||||||||||||
| Modified residue | 272 | 1 | Phosphoserine Ref.13 | ||||||||||||||||||||||||
| Modified residue | 289 | 1 | Phosphoserine; by RPS6KA3 Ref.10 Ref.8 | ||||||||||||||||||||||||
| Modified residue | 334 | 1 | Phosphoserine; by RPS6KA3 Ref.13 | ||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||
| Alternative sequence | 1 – 712 | 712 | Missing in isoform 22, isoform 23 and isoform 24. | VSP_036697 | |||||||||||||||||||||||
| Alternative sequence | 1 – 465 | 465 | Missing in isoform 19, isoform 20 and isoform 21. | VSP_036698 | |||||||||||||||||||||||
| Alternative sequence | 1 – 70 | 70 | Missing in isoform 12, isoform 13 and isoform 18. | VSP_036699 | |||||||||||||||||||||||
| Alternative sequence | 1 – 32 | 32 | MGAAS…AGGLG → MPASISSIFPGPTLLLSCGS in isoform 9, isoform 10 and isoform 17. | VSP_036700 | |||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MITTLPSLLPASLASISHRV TNLPSNSLSHNPGLSKPDFP GNSSPGLPSSSSPGRDLGAP AGSM in isoform 2, isoform 3 and isoform 11. | VSP_036701 | |||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MADGGADSAAQRLPEGPGRV APGRDLGAPAGSM in isoform 4, isoform 5 and isoform 14. | VSP_036702 | |||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MLSGRDLGAPAGSM in isoform 6, isoform 7 and isoform 15. | VSP_036703 | |||||||||||||||||||||||
| Alternative sequence | 773 – 880 | 108 | Missing in isoform 11, isoform 14, isoform 15, isoform 16, isoform 17, isoform 18, isoform 21 and isoform 24. | VSP_036704 | |||||||||||||||||||||||
| Alternative sequence | 881 – 902 | 22 | VSEII…EEPPA → GGCGTGGCECECVQEIALHV C in isoform 3, isoform 5, isoform 7, isoform 8, isoform 10, isoform 13, isoform 20 and isoform 23. | VSP_036705 | |||||||||||||||||||||||
| Natural variant | 160 | 1 | G → A: dbSNP rs2229309. Ref.1 Ref.4 | VAR_046985 | |||||||||||||||||||||||
| Natural variant | 246 | 1 | S → N: dbSNP rs2228231. | VAR_046986 | |||||||||||||||||||||||
| Natural variant | 800 | 1 | S → P: dbSNP rs7149586. Ref.1 Ref.4 | VAR_046987 | |||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||
| Mutagenesis | 168 | 1 | S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-170. Ref.7 | ||||||||||||||||||||||||
| Mutagenesis | 170 | 1 | S → A: Promotes nuclear localization and increases transcriptional activity; when associated with A-168. Ref.7 | ||||||||||||||||||||||||
| Mutagenesis | 213 | 1 | S → A: Decreased transcriptional activity; when associated with A-217. Ref.9 | ||||||||||||||||||||||||
| Mutagenesis | 217 | 1 | S → A: Decreased transcriptional activity; when associated with A-213. Ref.9 | ||||||||||||||||||||||||
| Sequence conflict | 359 | 1 | E → K in BAG56726. Ref.3 | ||||||||||||||||||||||||
| Sequence conflict | 646 | 1 | L → P in BAG63617. Ref.3 | ||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||
| Beta strand | 587 – 594 | 8 | |||||||||||||||||||||||||
| Beta strand | 602 – 610 | 9 | |||||||||||||||||||||||||
| Beta strand | 616 – 620 | 5 | |||||||||||||||||||||||||
| Turn | 638 – 640 | 3 | |||||||||||||||||||||||||
| Beta strand | 645 – 649 | 5 | |||||||||||||||||||||||||
| Beta strand | 662 – 669 | 8 | |||||||||||||||||||||||||
| Beta strand | 671 – 673 | 3 | |||||||||||||||||||||||||
| Beta strand | 679 – 684 | 6 | |||||||||||||||||||||||||
| Beta strand | 687 – 689 | 3 | |||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation of two new members of the NF-AT gene family and functional characterization of the NF-AT proteins." Hoey T., Sun Y.-L., Williamson K., Xu X. Immunity 2:461-472(1995) [PubMed: 7749981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANTS ALA-160 AND PRO-800. Tissue: T-cell. |
| [2] | "Alternative splicing and expression of human and mouse NFAT genes." Vihma H., Pruunsild P., Timmusk T. Genomics 92:279-291(2008) [PubMed: 18675896] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20; 21; 22; 23 AND 24), TISSUE SPECIFICITY. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 12 AND 16). Tissue: Adrenal gland and Testis. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 61-902 (ISOFORMS 1/2/4/6), VARIANTS ALA-160 AND PRO-800. Tissue: Ovary and Rhabdomyosarcoma. |
| [5] | "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT." Crabtree G.R. Cell 96:611-614(1999) [PubMed: 10089876] [Abstract] Cited for: REVIEW. |
| [6] | "Requirement of two NFATc4 transactivation domains for CBP potentiation." Yang T.T.C., Davis R.J., Chow C.-W. J. Biol. Chem. 276:39569-39576(2001) [PubMed: 11514544] [Abstract] Cited for: INTERACTION WITH CREBBP. |
| [7] | "Phosphorylation of NFATc4 by p38 mitogen-activated protein kinases." Yang T.T.C., Xiong Q., Enslen H., Davis R.J., Chow C.-W. Mol. Cell. Biol. 22:3892-3904(2002) [PubMed: 11997522] [Abstract] Cited for: FUNCTION, PHOSPHORYLATION AT SER-168 AND SER-170, MUTAGENESIS OF SER-168 AND SER-170. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-289, MASS SPECTROMETRY. Tissue: Epithelium. |
| [9] | "Nuclear factor of activated T3 is a negative regulator of Ras-JNK1/2-AP-1 induced cell transformation." Yao K., Cho Y.-Y., Bergen H.R. III, Madden B.J., Choi B.Y., Ma W.-Y., Bode A.M., Dong Z. Cancer Res. 67:8725-8735(2007) [PubMed: 17875713] [Abstract] Cited for: INTERACTION WITH MAPK8 AND MAPK9, PHOSPHORYLATION AT SER-213 AND SER-217, MUTAGENESIS OF SER-213 AND SER-217. |
| [10] | "RSK2 mediates muscle cell differentiation through regulation of NFAT3." Cho Y.-Y., Yao K., Bode A.M., Bergen H.R. III, Madden B.J., Oh S.-M., Ermakova S., Kang B.S., Choi H.S., Shim J.-H., Dong Z. J. Biol. Chem. 282:8380-8392(2007) [PubMed: 17213202] [Abstract] Cited for: FUNCTION, INTERACTION WITH RPS6KA3, PHOSPHORYLATION AT SER-289 AND SER-344. |
| [11] | "Repression of NFAT3 transcriptional activity by estrogen receptors." Qin X., Wang X.-H., Yang Z.-H., Ding L.-H., Xu X.-J., Cheng L., Niu C., Sun H.-W., Zhang H., Ye Q.-N. Cell. Mol. Life Sci. 65:2752-2762(2008) [PubMed: 18668201] [Abstract] Cited for: FUNCTION. |
| [12] | "Regulation of the stability and transcriptional activity of NFATc4 by ubiquitination." Fan Y., Xie P., Zhang T., Zhang H., Gu D., She M., Li H. FEBS Lett. 582:4008-4014(2008) [PubMed: 19026640] [Abstract] Cited for: PHOSPHORYLATION, UBIQUITINATION. |
| [13] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-272 AND SER-334, MASS SPECTROMETRY. |
| [14] | "Integration of protein kinases mTOR and extracellular signal-regulated kinase 5 in regulating nucleocytoplasmic localization of NFATc4." Yang T.T.C., Yu R.Y.L., Agadir A., Gao G.-J., Campos-Gonzalez R., Tournier C., Chow C.-W. Mol. Cell. Biol. 28:3489-3501(2008) [PubMed: 18347059] [Abstract] Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-168 AND SER-170. |
| [15] | "The interleukin-1 receptor associated kinase 1 contributes to the regulation of NFAT." Wang D., Fasciano S., Li L. Mol. Immunol. 45:3902-3908(2008) [PubMed: 18691762] [Abstract] Cited for: INTERACTION WITH IRAK1. |
| [16] | "Solution structure of the TIG domain from human nuclear factor of activated T-cells, cytoplasmic 4." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 585-691. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L41066 mRNA. Translation: AAA79175.1. EU887632 mRNA. Translation: ACG55652.1. EU887633 mRNA. Translation: ACG55653.1. EU887634 mRNA. Translation: ACG55654.1. EU887635 mRNA. Translation: ACG55655.1. EU887636 mRNA. Translation: ACG55656.1. EU887637 mRNA. Translation: ACG55657.1. EU887638 mRNA. Translation: ACG55658.1. EU887639 mRNA. Translation: ACG55659.1. EU887640 mRNA. Translation: ACG55660.1. EU887641 mRNA. Translation: ACG55661.1. EU887642 mRNA. Translation: ACG55662.1. EU887643 mRNA. Translation: ACG55663.1. EU887644 mRNA. Translation: ACG55664.1. EU887645 mRNA. Translation: ACG55665.1. EU887646 mRNA. Translation: ACG55666.1. EU887647 mRNA. Translation: ACG55667.1. EU887648 mRNA. Translation: ACG55668.1. EU887649 mRNA. Translation: ACG55669.1. EU887650 mRNA. Translation: ACG55670.1. EU887651 mRNA. Translation: ACG55671.1. EU887652 mRNA. Translation: ACG55672.1. EU887653 mRNA. Translation: ACG55673.1. EU887654 mRNA. Translation: ACG55674.1. EU887655 mRNA. Translation: ACG55675.1. AK293185 mRNA. Translation: BAG56726.1. AK302271 mRNA. Translation: BAG63617.1. BC008857 mRNA. Translation: AAH08857.2. BC053855 mRNA. Translation: AAH53855.1. | ||||||||||||
| IPI | IPI00385215. IPI00914604. IPI00917067. IPI00923386. IPI00923387. IPI00923404. IPI00923405. IPI00923412. IPI00923417. IPI00923426. IPI00923428. IPI00923439. IPI00923440. IPI00923465. IPI00923469. IPI00923488. IPI00923509. IPI00923559. IPI00923568. IPI00923580. IPI00923589. IPI00923591. IPI00923608. IPI00923620. | ||||||||||||
| RefSeq | NP_001129494.1. NP_004545.2. | ||||||||||||
| UniGene | Hs.77810 | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| SMR | Q14934. Positions 401-686. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | Q14934. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q14934. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q14934. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000250373; ENSP00000250373; ENSG00000100968; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 4776. | ||||||||||||
| KEGG | hsa:4776. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 4776. | ||||||||||||
| GeneCards | GC14P023907. | ||||||||||||
| HGNC | HGNC:7778. NFATC4. | ||||||||||||
| MIM | 602699. gene. | ||||||||||||
| PharmGKB | PA31584. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG06046. | ||||||||||||
| HOVERGEN | Q14934. | ||||||||||||
| InParanoid | Q14934. | ||||||||||||
| OMA | FSPPAPF. | ||||||||||||
| PhylomeDB | Q14934. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q14934. | ||||||||||||
| Bgee | Q14934. | ||||||||||||
| CleanEx | HS_NFATC4. | ||||||||||||
| Genevestigator | Q14934. | ||||||||||||
| GermOnline | ENSG00000100968. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR008366. NFAT. IPR018286. NFAT_sbgrp. IPR008967. p53-like_TF_DNA-bd. IPR011539. RHD. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 1 hit. G3DSA:2.60.40.340. RHD. 1 hit. | ||||||||||||
| PANTHER | PTHR12533. NFAT. 1 hit. | ||||||||||||
| Pfam | PF00554. RHD. 1 hit. PF01833. TIG. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR01789. NUCFACTORATC. | ||||||||||||
| SMART | SM00429. IPT. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS01204. REL_1. False negative. PS50254. REL_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | NFAC4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14934 Secondary accession number(s): B4DDG5 Q96H68 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


