Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin reductase 1

Gene

PTGR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha (By similarity). Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.By similarity

Catalytic activityi

A n-alkanal + NAD(P)+ = an alk-2-enal + NAD(P)H.
11-alpha-hydroxy-9,15-dioxoprost-5-enoate + NAD(P)+ = (5Z)-(13E)-11-alpha-hydroxy-9,15-dioxoprosta-5,13-dienoate + NAD(P)H.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei178NADP1 Publication1
Binding sitei193NADP1 Publication1
Binding sitei217NADP1 Publication1
Binding sitei321NADP1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi152 – 155NADP1 Publication4
Nucleotide bindingi239 – 245NADP1 Publication7
Nucleotide bindingi270 – 272NADP1 Publication3

GO - Molecular functioni

GO - Biological processi

  • leukotriene metabolic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Ligandi

NADP

Enzyme and pathway databases

BioCyciZFISH:G66-33958-MONOMER.
ZFISH:HS02959-MONOMER.
ReactomeiR-HSA-2142691. Synthesis of Leukotrienes (LT) and Eoxins (EX).
R-HSA-2142700. Synthesis of Lipoxins (LX).
R-HSA-2162123. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Chemistry databases

SwissLipidsiSLP:000001629.

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin reductase 1 (EC:1.3.1.-)
Short name:
PRG-1
Alternative name(s):
15-oxoprostaglandin 13-reductase (EC:1.3.1.48)
NADP-dependent leukotriene B4 12-hydroxydehydrogenase (EC:1.3.1.74)
Gene namesi
Name:PTGR1
Synonyms:LTB4DH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:18429. PTGR1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB-SubCell
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi22949.
OpenTargetsiENSG00000106853.
ENSG00000283263.
PharmGKBiPA162400322.

Polymorphism and mutation databases

BioMutaiPTGR1.
DMDMi23503081.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002180651 – 329Prostaglandin reductase 1Add BLAST329

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei18PhosphothreonineCombined sources1
Modified residuei20PhosphoserineCombined sources1
Modified residuei178N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ14914.
MaxQBiQ14914.
PaxDbiQ14914.
PeptideAtlasiQ14914.
PRIDEiQ14914.
TopDownProteomicsiQ14914-1. [Q14914-1]

PTM databases

iPTMnetiQ14914.
PhosphoSitePlusiQ14914.

Expressioni

Tissue specificityi

High expression in the kidney, liver, and intestine but not in leukocytes.1 Publication

Gene expression databases

BgeeiENSG00000106853.
CleanExiHS_PTGR1.
ExpressionAtlasiQ14914. baseline and differential.
GenevisibleiQ14914. HS.

Organism-specific databases

HPAiHPA036724.
HPA036725.

Interactioni

Subunit structurei

Monomer or homodimer.By similarity

Protein-protein interaction databases

BioGridi116604. 14 interactors.
IntActiQ14914. 2 interactors.
MINTiMINT-5004604.
STRINGi9606.ENSP00000311572.

Structurei

Secondary structure

1329
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi4 – 11Combined sources8
Beta strandi14 – 16Combined sources3
Helixi19 – 21Combined sources3
Beta strandi22 – 28Combined sources7
Beta strandi37 – 45Combined sources9
Helixi49 – 53Combined sources5
Helixi54 – 56Combined sources3
Beta strandi67 – 75Combined sources9
Beta strandi84 – 87Combined sources4
Beta strandi91 – 97Combined sources7
Helixi115 – 119Combined sources5
Turni120 – 122Combined sources3
Helixi124 – 134Combined sources11
Beta strandi144 – 149Combined sources6
Helixi153 – 164Combined sources12
Beta strandi168 – 175Combined sources8
Helixi176 – 185Combined sources10
Beta strandi188 – 192Combined sources5
Turni193 – 195Combined sources3
Helixi199 – 206Combined sources8
Beta strandi211 – 218Combined sources8
Helixi220 – 227Combined sources8
Beta strandi230 – 238Combined sources9
Helixi242 – 245Combined sources4
Helixi257 – 262Combined sources6
Beta strandi266 – 269Combined sources4
Helixi272 – 274Combined sources3
Helixi277 – 292Combined sources16
Beta strandi300 – 304Combined sources5
Helixi306 – 308Combined sources3
Helixi309 – 317Combined sources9
Beta strandi322 – 328Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZSVX-ray2.30A/B/C/D4-329[»]
2Y05X-ray2.20A/B/C/D4-329[»]
ProteinModelPortaliQ14914.
SMRiQ14914.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14914.

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi250 – 257Pro-rich8

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1196. Eukaryota.
COG2130. LUCA.
GeneTreeiENSGT00390000009335.
HOGENOMiHOG000294663.
HOVERGENiHBG055024.
InParanoidiQ14914.
KOiK13948.
OMAiMGMPGFT.
OrthoDBiEOG091G0F5B.
PhylomeDBiQ14914.
TreeFamiTF324201.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
3.90.180.10. 1 hit.
InterProiIPR013149. ADH_C.
IPR002085. ADH_SF_Zn-type.
IPR014190. B4_12hDH.
IPR011032. GroES-like.
IPR016040. NAD(P)-bd_dom.
IPR020843. PKS_ER.
[Graphical view]
PANTHERiPTHR11695. PTHR11695. 1 hit.
PfamiPF00107. ADH_zinc_N. 1 hit.
[Graphical view]
SMARTiSM00829. PKS_ER. 1 hit.
[Graphical view]
SUPFAMiSSF50129. SSF50129. 2 hits.
SSF51735. SSF51735. 1 hit.
TIGRFAMsiTIGR02825. B4_12hDH. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14914-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRTKTWTLK KHFVGYPTNS DFELKTAELP PLKNGEVLLE ALFLTVDPYM
60 70 80 90 100
RVAAKRLKEG DTMMGQQVAK VVESKNVALP KGTIVLASPG WTTHSISDGK
110 120 130 140 150
DLEKLLTEWP DTIPLSLALG TVGMPGLTAY FGLLEICGVK GGETVMVNAA
160 170 180 190 200
AGAVGSVVGQ IAKLKGCKVV GAVGSDEKVA YLQKLGFDVV FNYKTVESLE
210 220 230 240 250
ETLKKASPDG YDCYFDNVGG EFSNTVIGQM KKFGRIAICG AISTYNRTGP
260 270 280 290 300
LPPGPPPEIV IYQELRMEAF VVYRWQGDAR QKALKDLLKW VLEGKIQYKE
310 320
YIIEGFENMP AAFMGMLKGD NLGKTIVKA
Length:329
Mass (Da):35,870
Last modified:September 19, 2002 - v2
Checksum:iE121ADB7C5BD9CF8
GO
Isoform 2 (identifier: Q14914-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     294-329: GKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA → IKRENEED

Note: No experimental confirmation available.
Show »
Length:301
Mass (Da):32,895
Checksum:iBD24D01FD752BE62
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti311A → R in BAA08382 (PubMed:8576264).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02311127A → S.3 PublicationsCorresponds to variant rs1053959dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044652294 – 329GKIQY…TIVKA → IKRENEED in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289597 mRNA. Translation: BAF82286.1.
AK298379 mRNA. Translation: BAG60615.1.
AL135787 Genomic DNA. Translation: CAC22151.1.
AL159168 Genomic DNA. No translation available.
CH471105 Genomic DNA. Translation: EAW59074.1.
BC035228 mRNA. Translation: AAH35228.1.
D49387 mRNA. Translation: BAA08382.1.
CCDSiCCDS55331.1. [Q14914-2]
CCDS6779.1. [Q14914-1]
RefSeqiNP_001139580.1. NM_001146108.1. [Q14914-1]
NP_001139581.1. NM_001146109.1. [Q14914-2]
NP_036344.2. NM_012212.3. [Q14914-1]
UniGeneiHs.584864.

Genome annotation databases

EnsembliENST00000309195; ENSP00000311572; ENSG00000106853. [Q14914-1]
ENST00000407693; ENSP00000385763; ENSG00000106853. [Q14914-1]
GeneIDi22949.
KEGGihsa:22949.
UCSCiuc004bfh.3. human. [Q14914-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289597 mRNA. Translation: BAF82286.1.
AK298379 mRNA. Translation: BAG60615.1.
AL135787 Genomic DNA. Translation: CAC22151.1.
AL159168 Genomic DNA. No translation available.
CH471105 Genomic DNA. Translation: EAW59074.1.
BC035228 mRNA. Translation: AAH35228.1.
D49387 mRNA. Translation: BAA08382.1.
CCDSiCCDS55331.1. [Q14914-2]
CCDS6779.1. [Q14914-1]
RefSeqiNP_001139580.1. NM_001146108.1. [Q14914-1]
NP_001139581.1. NM_001146109.1. [Q14914-2]
NP_036344.2. NM_012212.3. [Q14914-1]
UniGeneiHs.584864.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZSVX-ray2.30A/B/C/D4-329[»]
2Y05X-ray2.20A/B/C/D4-329[»]
ProteinModelPortaliQ14914.
SMRiQ14914.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116604. 14 interactors.
IntActiQ14914. 2 interactors.
MINTiMINT-5004604.
STRINGi9606.ENSP00000311572.

Chemistry databases

SwissLipidsiSLP:000001629.

PTM databases

iPTMnetiQ14914.
PhosphoSitePlusiQ14914.

Polymorphism and mutation databases

BioMutaiPTGR1.
DMDMi23503081.

Proteomic databases

EPDiQ14914.
MaxQBiQ14914.
PaxDbiQ14914.
PeptideAtlasiQ14914.
PRIDEiQ14914.
TopDownProteomicsiQ14914-1. [Q14914-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309195; ENSP00000311572; ENSG00000106853. [Q14914-1]
ENST00000407693; ENSP00000385763; ENSG00000106853. [Q14914-1]
GeneIDi22949.
KEGGihsa:22949.
UCSCiuc004bfh.3. human. [Q14914-1]

Organism-specific databases

CTDi22949.
DisGeNETi22949.
GeneCardsiPTGR1.
H-InvDBHIX0008283.
HGNCiHGNC:18429. PTGR1.
HPAiHPA036724.
HPA036725.
MIMi601274. gene.
neXtProtiNX_Q14914.
OpenTargetsiENSG00000106853.
ENSG00000283263.
PharmGKBiPA162400322.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1196. Eukaryota.
COG2130. LUCA.
GeneTreeiENSGT00390000009335.
HOGENOMiHOG000294663.
HOVERGENiHBG055024.
InParanoidiQ14914.
KOiK13948.
OMAiMGMPGFT.
OrthoDBiEOG091G0F5B.
PhylomeDBiQ14914.
TreeFamiTF324201.

Enzyme and pathway databases

BioCyciZFISH:G66-33958-MONOMER.
ZFISH:HS02959-MONOMER.
ReactomeiR-HSA-2142691. Synthesis of Leukotrienes (LT) and Eoxins (EX).
R-HSA-2142700. Synthesis of Lipoxins (LX).
R-HSA-2162123. Synthesis of Prostaglandins (PG) and Thromboxanes (TX).

Miscellaneous databases

ChiTaRSiPTGR1. human.
EvolutionaryTraceiQ14914.
GenomeRNAii22949.
PROiQ14914.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000106853.
CleanExiHS_PTGR1.
ExpressionAtlasiQ14914. baseline and differential.
GenevisibleiQ14914. HS.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
3.90.180.10. 1 hit.
InterProiIPR013149. ADH_C.
IPR002085. ADH_SF_Zn-type.
IPR014190. B4_12hDH.
IPR011032. GroES-like.
IPR016040. NAD(P)-bd_dom.
IPR020843. PKS_ER.
[Graphical view]
PANTHERiPTHR11695. PTHR11695. 1 hit.
PfamiPF00107. ADH_zinc_N. 1 hit.
[Graphical view]
SMARTiSM00829. PKS_ER. 1 hit.
[Graphical view]
SUPFAMiSSF50129. SSF50129. 2 hits.
SSF51735. SSF51735. 1 hit.
TIGRFAMsiTIGR02825. B4_12hDH. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPTGR1_HUMAN
AccessioniPrimary (citable) accession number: Q14914
Secondary accession number(s): A8K0N2
, B4DPK3, F5GY50, Q8IYQ0, Q9H1X6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 19, 2002
Last modified: November 30, 2016
This is version 163 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.