SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14833

- GRM4_HUMAN

UniProt

Q14833 - GRM4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Metabotropic glutamate receptor 4
Gene
GRM4, GPRC1D, MGLUR4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate cyclase activity.3 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei159 – 1591Glutamate By similarity
Binding sitei230 – 2301Glutamate By similarity
Binding sitei312 – 3121Glutamate By similarity
Binding sitei405 – 4051Glutamate By similarity

GO - Molecular functioni

  1. G-protein coupled receptor activity Source: UniProtKB
  2. glutamate receptor activity Source: UniProtKB
  3. group III metabotropic glutamate receptor activity Source: RefGenome

GO - Biological processi

  1. activation of MAPK activity Source: UniProtKB
  2. adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway Source: UniProtKB
  3. learning Source: Ensembl
  4. neurotransmitter secretion Source: UniProtKB
  5. positive regulation of MAPK cascade Source: UniProtKB
  6. regulation of neuron apoptotic process Source: UniProtKB
  7. regulation of synaptic transmission, glutamatergic Source: RefGenome
  8. synaptic transmission Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_18319. Class C/3 (Metabotropic glutamate/pheromone receptors).
REACT_19231. G alpha (i) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Metabotropic glutamate receptor 4
Short name:
mGluR4
Gene namesi
Name:GRM4
Synonyms:GPRC1D, MGLUR4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:4596. GRM4.

Subcellular locationi

Cell membrane; Multi-pass membrane protein 2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini33 – 587555Extracellular Reviewed prediction
Add
BLAST
Transmembranei588 – 61023Helical; Name=1; Reviewed prediction
Add
BLAST
Topological domaini611 – 62414Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei625 – 64521Helical; Name=2; Reviewed prediction
Add
BLAST
Topological domaini646 – 65611Extracellular Reviewed prediction
Add
BLAST
Transmembranei657 – 67519Helical; Name=3; Reviewed prediction
Add
BLAST
Topological domaini676 – 69924Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei700 – 72021Helical; Name=4; Reviewed prediction
Add
BLAST
Topological domaini721 – 75030Extracellular Reviewed prediction
Add
BLAST
Transmembranei751 – 77222Helical; Name=5; Reviewed prediction
Add
BLAST
Topological domaini773 – 78513Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei786 – 80823Helical; Name=6; Reviewed prediction
Add
BLAST
Topological domaini809 – 82113Extracellular Reviewed prediction
Add
BLAST
Transmembranei822 – 84726Helical; Name=7; Reviewed prediction
Add
BLAST
Topological domaini848 – 91265Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. cytoplasmic vesicle Source: UniProtKB
  2. dendritic shaft Source: Ensembl
  3. integral component of plasma membrane Source: UniProtKB
  4. intracellular Source: UniProtKB
  5. plasma membrane Source: Reactome
  6. presynaptic active zone membrane Source: Ensembl
  7. presynaptic membrane Source: RefGenome
  8. terminal bouton Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28993.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3232 Reviewed prediction
Add
BLAST
Chaini33 – 912880Metabotropic glutamate receptor 4
PRO_0000012930Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi67 ↔ 109 By similarity
Glycosylationi98 – 981N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi249 ↔ 538 By similarity
Glycosylationi301 – 3011N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi372 ↔ 388 By similarity
Disulfide bondi428 ↔ 435 By similarity
Glycosylationi454 – 4541N-linked (GlcNAc...) Reviewed prediction
Glycosylationi484 – 4841N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi520 ↔ 539 By similarity
Disulfide bondi524 ↔ 542 By similarity
Disulfide bondi545 ↔ 557 By similarity
Disulfide bondi560 ↔ 573 By similarity
Glycosylationi569 – 5691N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ14833.
PRIDEiQ14833.

PTM databases

PhosphoSiteiQ14833.

Expressioni

Tissue specificityi

Strongly expressed in the cerebellum. Expressed at low levels in hippocampus, hypothalamus and thalamus. No expression detected in liver.2 Publications

Gene expression databases

ArrayExpressiQ14833.
BgeeiQ14833.
CleanExiHS_GRM4.
GenevestigatoriQ14833.

Organism-specific databases

HPAiCAB022096.

Interactioni

Subunit structurei

Interacts with PICK1 By similarity.

Protein-protein interaction databases

STRINGi9606.ENSP00000363296.

Structurei

3D structure databases

ProteinModelPortaliQ14833.
SMRiQ14833. Positions 38-853.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni180 – 1823Glutamate binding By similarity

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG295200.
HOGENOMiHOG000218635.
HOVERGENiHBG107965.
InParanoidiQ14833.
KOiK04607.
OMAiGWGWWWA.
OrthoDBiEOG7Z0JXG.
PhylomeDBiQ14833.
TreeFamiTF313240.

Family and domain databases

InterProiIPR001828. ANF_lig-bd_rcpt.
IPR000337. GPCR_3.
IPR011500. GPCR_3_9-Cys_dom.
IPR017978. GPCR_3_C.
IPR017979. GPCR_3_CS.
IPR000162. GPCR_3_mtglu_rcpt.
IPR001786. GPCR_3_mtglu_rcpt_4.
IPR028082. Peripla_BP_I.
[Graphical view]
PfamiPF00003. 7tm_3. 1 hit.
PF01094. ANF_receptor. 1 hit.
PF07562. NCD3G. 1 hit.
[Graphical view]
PRINTSiPR00248. GPCRMGR.
PR01054. MTABOTROPC4R.
PR00593. MTABOTROPICR.
SUPFAMiSSF53822. SSF53822. 1 hit.
PROSITEiPS00979. G_PROTEIN_RECEP_F3_1. 1 hit.
PS00980. G_PROTEIN_RECEP_F3_2. 1 hit.
PS00981. G_PROTEIN_RECEP_F3_3. 1 hit.
PS50259. G_PROTEIN_RECEP_F3_4. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q14833-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPGKRGLGWW WARLPLCLLL SLYGPWMPSS LGKPKGHPHM NSIRIDGDIT    50
LGGLFPVHGR GSEGKPCGEL KKEKGIHRLE AMLFALDRIN NDPDLLPNIT 100
LGARILDTCS RDTHALEQSL TFVQALIEKD GTEVRCGSGG PPIITKPERV 150
VGVIGASGSS VSIMVANILR LFKIPQISYA STAPDLSDNS RYDFFSRVVP 200
SDTYQAQAMV DIVRALKWNY VSTVASEGSY GESGVEAFIQ KSREDGGVCI 250
AQSVKIPREP KAGEFDKIIR RLLETSNARA VIIFANEDDI RRVLEAARRA 300
NQTGHFFWMG SDSWGSKIAP VLHLEEVAEG AVTILPKRMS VRGFDRYFSS 350
RTLDNNRRNI WFAEFWEDNF HCKLSRHALK KGSHVKKCTN RERIGQDSAY 400
EQEGKVQFVI DAVYAMGHAL HAMHRDLCPG RVGLCPRMDP VDGTQLLKYI 450
RNVNFSGIAG NPVTFNENGD APGRYDIYQY QLRNDSAEYK VIGSWTDHLH 500
LRIERMHWPG SGQQLPRSIC SLPCQPGERK KTVKGMPCCW HCEPCTGYQY 550
QVDRYTCKTC PYDMRPTENR TGCRPIPIIK LEWGSPWAVL PLFLAVVGIA 600
ATLFVVITFV RYNDTPIVKA SGRELSYVLL AGIFLCYATT FLMIAEPDLG 650
TCSLRRIFLG LGMSISYAAL LTKTNRIYRI FEQGKRSVSA PRFISPASQL 700
AITFSLISLQ LLGICVWFVV DPSHSVVDFQ DQRTLDPRFA RGVLKCDISD 750
LSLICLLGYS MLLMVTCTVY AIKTRGVPET FNEAKPIGFT MYTTCIVWLA 800
FIPIFFGTSQ SADKLYIQTT TLTVSVSLSA SVSLGMLYMP KVYIILFHPE 850
QNVPKRKRSL KAVVTAATMS NKFTQKGNFR PNGEAKSELC ENLEAPALAT 900
KQTYVTYTNH AI 912
Length:912
Mass (Da):101,868
Last modified:November 1, 1997 - v1
Checksum:i4A2F36E63A2EAF5A
GO
Isoform 2 (identifier: Q14833-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGK → MVQTLPKLFPHDGAKRKKRTLRTSGPCFGGGGQ
     34-173: Missing.

Note: No experimental confirmation available.

Show »
Length:772
Mass (Da):86,683
Checksum:i5AEAFC7B26F3CFCF
GO
Isoform 3 (identifier: Q14833-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-172: MPGKRGLGWW...IMVANILRLF → MSC

Show »
Length:743
Mass (Da):83,580
Checksum:i202C4DC3F806DC8F
GO
Isoform 4 (identifier: Q14833-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-172: MPGKRGLGWW...IMVANILRLF → MAVPLGAPCW...RLLSQHVKPA

Note: No experimental confirmation available.

Show »
Length:779
Mass (Da):87,353
Checksum:iDEEE2F3C60EBD6E1
GO
Isoform 5 (identifier: Q14833-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-173: MPGKRGLGWW...MVANILRLFK → MPAWEPGVAA...PRCLLPESAQ
     343-390: GFDRYFSSRTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTN → D

Note: No experimental confirmation available.

Show »
Length:796
Mass (Da):88,493
Checksum:iFAE466D1D45D3829
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti169 – 1691L → F.
Corresponds to variant rs452752 [ dbSNP | Ensembl ].
VAR_049275
Natural varianti797 – 7971V → I.1 Publication
VAR_012992

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 173173MPGKR…LRLFK → MPAWEPGVAASCGWRAPPCS PLRLCIAPHPCTPPSSHQGN LTCRLPPRSFGFCRCVWVRT RGPSLPGEQVSLAAHESEGA AAQLGSSPEIDPRRPRCLLP ESAQ in isoform 5.
VSP_046761Add
BLAST
Alternative sequencei1 – 172172MPGKR…ILRLF → MSC in isoform 3.
VSP_045218Add
BLAST
Alternative sequencei1 – 172172MPGKR…ILRLF → MAVPLGAPCWASALPAWAPP GLPHRSLLTRLLSQHVKPA in isoform 4.
VSP_046762Add
BLAST
Alternative sequencei1 – 3333MPGKR…SSLGK → MVQTLPKLFPHDGAKRKKRT LRTSGPCFGGGGQ in isoform 2.
VSP_044740Add
BLAST
Alternative sequencei34 – 173140Missing in isoform 2.
VSP_044741Add
BLAST
Alternative sequencei343 – 39048GFDRY…KKCTN → D in isoform 5.
VSP_046763Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti449 – 4491Y → H in BAH11632. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X80818 mRNA. Translation: CAA56784.1.
U92457 mRNA. Translation: AAB51762.1.
AK122982 mRNA. Translation: BAG53831.1.
AK131536 mRNA. Translation: BAD18673.1.
AK293913 mRNA. Translation: BAH11625.1.
AK293949 mRNA. Translation: BAH11632.1.
AL354740 Genomic DNA. No translation available.
AL590403 Genomic DNA. Translation: CAI17348.1.
CCDSiCCDS4787.1. [Q14833-1]
CCDS59010.1. [Q14833-4]
CCDS59011.1. [Q14833-3]
CCDS59012.1. [Q14833-5]
RefSeqiNP_000832.1. NM_000841.3. [Q14833-1]
NP_001243738.1. NM_001256809.2. [Q14833-5]
NP_001243740.1. NM_001256811.2.
NP_001243741.1. NM_001256812.2. [Q14833-3]
NP_001243742.1. NM_001256813.2. [Q14833-4]
NP_001269776.1. NM_001282847.1.
UniGeneiHs.429018.
Hs.435128.
Hs.736330.

Genome annotation databases

EnsembliENST00000374177; ENSP00000363292; ENSG00000124493. [Q14833-5]
ENST00000374181; ENSP00000363296; ENSG00000124493. [Q14833-1]
ENST00000455714; ENSP00000398456; ENSG00000124493. [Q14833-2]
ENST00000535756; ENSP00000437925; ENSG00000124493. [Q14833-4]
ENST00000538487; ENSP00000440556; ENSG00000124493. [Q14833-1]
ENST00000544773; ENSP00000437730; ENSG00000124493. [Q14833-3]
ENST00000609222; ENSP00000477466; ENSG00000124493. [Q14833-4]
GeneIDi2914.
KEGGihsa:2914.
UCSCiuc003oio.4. human. [Q14833-1]
uc003oiq.4. human.
uc011dsm.3. human.

Polymorphism databases

DMDMi2495077.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X80818 mRNA. Translation: CAA56784.1 .
U92457 mRNA. Translation: AAB51762.1 .
AK122982 mRNA. Translation: BAG53831.1 .
AK131536 mRNA. Translation: BAD18673.1 .
AK293913 mRNA. Translation: BAH11625.1 .
AK293949 mRNA. Translation: BAH11632.1 .
AL354740 Genomic DNA. No translation available.
AL590403 Genomic DNA. Translation: CAI17348.1 .
CCDSi CCDS4787.1. [Q14833-1 ]
CCDS59010.1. [Q14833-4 ]
CCDS59011.1. [Q14833-3 ]
CCDS59012.1. [Q14833-5 ]
RefSeqi NP_000832.1. NM_000841.3. [Q14833-1 ]
NP_001243738.1. NM_001256809.2. [Q14833-5 ]
NP_001243740.1. NM_001256811.2.
NP_001243741.1. NM_001256812.2. [Q14833-3 ]
NP_001243742.1. NM_001256813.2. [Q14833-4 ]
NP_001269776.1. NM_001282847.1.
UniGenei Hs.429018.
Hs.435128.
Hs.736330.

3D structure databases

ProteinModelPortali Q14833.
SMRi Q14833. Positions 38-853.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000363296.

Chemistry

BindingDBi Q14833.
ChEMBLi CHEMBL2736.
DrugBanki DB00142. L-Glutamic Acid.
GuidetoPHARMACOLOGYi 292.

Protein family/group databases

GPCRDBi Search...

PTM databases

PhosphoSitei Q14833.

Polymorphism databases

DMDMi 2495077.

Proteomic databases

PaxDbi Q14833.
PRIDEi Q14833.

Protocols and materials databases

DNASUi 2914.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000374177 ; ENSP00000363292 ; ENSG00000124493 . [Q14833-5 ]
ENST00000374181 ; ENSP00000363296 ; ENSG00000124493 . [Q14833-1 ]
ENST00000455714 ; ENSP00000398456 ; ENSG00000124493 . [Q14833-2 ]
ENST00000535756 ; ENSP00000437925 ; ENSG00000124493 . [Q14833-4 ]
ENST00000538487 ; ENSP00000440556 ; ENSG00000124493 . [Q14833-1 ]
ENST00000544773 ; ENSP00000437730 ; ENSG00000124493 . [Q14833-3 ]
ENST00000609222 ; ENSP00000477466 ; ENSG00000124493 . [Q14833-4 ]
GeneIDi 2914.
KEGGi hsa:2914.
UCSCi uc003oio.4. human. [Q14833-1 ]
uc003oiq.4. human.
uc011dsm.3. human.

Organism-specific databases

CTDi 2914.
GeneCardsi GC06M035230.
HGNCi HGNC:4596. GRM4.
HPAi CAB022096.
MIMi 604100. gene.
neXtProti NX_Q14833.
PharmGKBi PA28993.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG295200.
HOGENOMi HOG000218635.
HOVERGENi HBG107965.
InParanoidi Q14833.
KOi K04607.
OMAi GWGWWWA.
OrthoDBi EOG7Z0JXG.
PhylomeDBi Q14833.
TreeFami TF313240.

Enzyme and pathway databases

Reactomei REACT_18319. Class C/3 (Metabotropic glutamate/pheromone receptors).
REACT_19231. G alpha (i) signalling events.

Miscellaneous databases

ChiTaRSi GRM4. human.
GeneWikii Metabotropic_glutamate_receptor_4.
GenomeRNAii 2914.
NextBioi 11551.
PROi Q14833.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q14833.
Bgeei Q14833.
CleanExi HS_GRM4.
Genevestigatori Q14833.

Family and domain databases

InterProi IPR001828. ANF_lig-bd_rcpt.
IPR000337. GPCR_3.
IPR011500. GPCR_3_9-Cys_dom.
IPR017978. GPCR_3_C.
IPR017979. GPCR_3_CS.
IPR000162. GPCR_3_mtglu_rcpt.
IPR001786. GPCR_3_mtglu_rcpt_4.
IPR028082. Peripla_BP_I.
[Graphical view ]
Pfami PF00003. 7tm_3. 1 hit.
PF01094. ANF_receptor. 1 hit.
PF07562. NCD3G. 1 hit.
[Graphical view ]
PRINTSi PR00248. GPCRMGR.
PR01054. MTABOTROPC4R.
PR00593. MTABOTROPICR.
SUPFAMi SSF53822. SSF53822. 1 hit.
PROSITEi PS00979. G_PROTEIN_RECEP_F3_1. 1 hit.
PS00980. G_PROTEIN_RECEP_F3_2. 1 hit.
PS00981. G_PROTEIN_RECEP_F3_3. 1 hit.
PS50259. G_PROTEIN_RECEP_F3_4. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization and localization of human metabotropic glutamate receptor type 4."
    Makoff A., Lelchuk R., Oxer M., Harrington K., Emson P.
    Brain Res. Mol. Brain Res. 37:239-248(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells."
    Wu S., Wright R.A., Rockey P.K., Burgett S.G., Arnold J.S., Rosteck P.R. Jr., Johnson B.G., Schoepp D.D., Belagaje R.M.
    Brain Res. Mol. Brain Res. 53:88-97(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
  3. "Molecular cloning, functional expression and pharmacological characterization of the human metabotropic glutamate receptor type 4."
    Flor P.J., Lukic S., Rueegg D., Leonhardt T., Knoepfel T., Kuhn R.
    Neuropharmacology 34:149-155(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
    Tissue: Brain and Cerebellum.
  5. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "Mutation screening of the metabotropic glutamate receptor mGluR4 (GRM4) gene in patients with schizophrenia."
    Ohtsuki T., Toru M., Arinami T.
    Psychiatr. Genet. 11:79-83(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ILE-797.

Entry informationi

Entry nameiGRM4_HUMAN
AccessioniPrimary (citable) accession number: Q14833
Secondary accession number(s): B3KVL9
, B7Z1T9, B7Z1U6, F5GXM5, Q5SZ84, Q6ZMQ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: September 3, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi