Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q14833

- GRM4_HUMAN

UniProt

Q14833 - GRM4_HUMAN

Protein

Metabotropic glutamate receptor 4

Gene

GRM4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 130 (01 Oct 2014)
      Sequence version 1 (01 Nov 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate cyclase activity.3 Publications

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei159 – 1591GlutamateBy similarity
    Binding sitei230 – 2301GlutamateBy similarity
    Binding sitei312 – 3121GlutamateBy similarity
    Binding sitei405 – 4051GlutamateBy similarity

    GO - Molecular functioni

    1. glutamate receptor activity Source: UniProtKB
    2. G-protein coupled receptor activity Source: UniProtKB
    3. group III metabotropic glutamate receptor activity Source: RefGenome

    GO - Biological processi

    1. activation of MAPK activity Source: UniProtKB
    2. adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway Source: UniProtKB
    3. learning Source: Ensembl
    4. neurotransmitter secretion Source: UniProtKB
    5. positive regulation of MAPK cascade Source: UniProtKB
    6. regulation of neuron apoptotic process Source: UniProtKB
    7. regulation of synaptic transmission, glutamatergic Source: RefGenome
    8. synaptic transmission Source: ProtInc

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Enzyme and pathway databases

    ReactomeiREACT_18319. Class C/3 (Metabotropic glutamate/pheromone receptors).
    REACT_19231. G alpha (i) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Metabotropic glutamate receptor 4
    Short name:
    mGluR4
    Gene namesi
    Name:GRM4
    Synonyms:GPRC1D, MGLUR4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:4596. GRM4.

    Subcellular locationi

    Cell membrane 2 Publications; Multi-pass membrane protein 2 Publications

    GO - Cellular componenti

    1. cytoplasmic vesicle Source: UniProtKB
    2. dendritic shaft Source: Ensembl
    3. integral component of plasma membrane Source: UniProtKB
    4. intracellular Source: UniProtKB
    5. plasma membrane Source: Reactome
    6. presynaptic active zone membrane Source: Ensembl
    7. presynaptic membrane Source: RefGenome
    8. terminal bouton Source: Ensembl

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28993.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3232Sequence AnalysisAdd
    BLAST
    Chaini33 – 912880Metabotropic glutamate receptor 4PRO_0000012930Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi67 ↔ 109By similarity
    Glycosylationi98 – 981N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi249 ↔ 538By similarity
    Glycosylationi301 – 3011N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi372 ↔ 388By similarity
    Disulfide bondi428 ↔ 435By similarity
    Glycosylationi454 – 4541N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi484 – 4841N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi520 ↔ 539By similarity
    Disulfide bondi524 ↔ 542By similarity
    Disulfide bondi545 ↔ 557By similarity
    Disulfide bondi560 ↔ 573By similarity
    Glycosylationi569 – 5691N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ14833.
    PRIDEiQ14833.

    PTM databases

    PhosphoSiteiQ14833.

    Expressioni

    Tissue specificityi

    Strongly expressed in the cerebellum. Expressed at low levels in hippocampus, hypothalamus and thalamus. No expression detected in liver.2 Publications

    Gene expression databases

    ArrayExpressiQ14833.
    BgeeiQ14833.
    CleanExiHS_GRM4.
    GenevestigatoriQ14833.

    Organism-specific databases

    HPAiCAB022096.

    Interactioni

    Subunit structurei

    Interacts with PICK1.By similarity

    Protein-protein interaction databases

    STRINGi9606.ENSP00000363296.

    Structurei

    3D structure databases

    ProteinModelPortaliQ14833.
    SMRiQ14833. Positions 38-853.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini33 – 587555ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini611 – 62414CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini646 – 65611ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini676 – 69924CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini721 – 75030ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini773 – 78513CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini809 – 82113ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini848 – 91265CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei588 – 61023Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei625 – 64521Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei657 – 67519Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei700 – 72021Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei751 – 77222Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei786 – 80823Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei822 – 84726Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni180 – 1823Glutamate bindingBy similarity

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG295200.
    HOGENOMiHOG000218635.
    HOVERGENiHBG107965.
    InParanoidiQ14833.
    KOiK04607.
    OMAiGWGWWWA.
    OrthoDBiEOG7Z0JXG.
    PhylomeDBiQ14833.
    TreeFamiTF313240.

    Family and domain databases

    InterProiIPR001828. ANF_lig-bd_rcpt.
    IPR000337. GPCR_3.
    IPR011500. GPCR_3_9-Cys_dom.
    IPR017978. GPCR_3_C.
    IPR017979. GPCR_3_CS.
    IPR000162. GPCR_3_mtglu_rcpt.
    IPR001786. GPCR_3_mtglu_rcpt_4.
    IPR028082. Peripla_BP_I.
    [Graphical view]
    PfamiPF00003. 7tm_3. 1 hit.
    PF01094. ANF_receptor. 1 hit.
    PF07562. NCD3G. 1 hit.
    [Graphical view]
    PRINTSiPR00248. GPCRMGR.
    PR01054. MTABOTROPC4R.
    PR00593. MTABOTROPICR.
    SUPFAMiSSF53822. SSF53822. 1 hit.
    PROSITEiPS00979. G_PROTEIN_RECEP_F3_1. 1 hit.
    PS00980. G_PROTEIN_RECEP_F3_2. 1 hit.
    PS00981. G_PROTEIN_RECEP_F3_3. 1 hit.
    PS50259. G_PROTEIN_RECEP_F3_4. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q14833-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPGKRGLGWW WARLPLCLLL SLYGPWMPSS LGKPKGHPHM NSIRIDGDIT    50
    LGGLFPVHGR GSEGKPCGEL KKEKGIHRLE AMLFALDRIN NDPDLLPNIT 100
    LGARILDTCS RDTHALEQSL TFVQALIEKD GTEVRCGSGG PPIITKPERV 150
    VGVIGASGSS VSIMVANILR LFKIPQISYA STAPDLSDNS RYDFFSRVVP 200
    SDTYQAQAMV DIVRALKWNY VSTVASEGSY GESGVEAFIQ KSREDGGVCI 250
    AQSVKIPREP KAGEFDKIIR RLLETSNARA VIIFANEDDI RRVLEAARRA 300
    NQTGHFFWMG SDSWGSKIAP VLHLEEVAEG AVTILPKRMS VRGFDRYFSS 350
    RTLDNNRRNI WFAEFWEDNF HCKLSRHALK KGSHVKKCTN RERIGQDSAY 400
    EQEGKVQFVI DAVYAMGHAL HAMHRDLCPG RVGLCPRMDP VDGTQLLKYI 450
    RNVNFSGIAG NPVTFNENGD APGRYDIYQY QLRNDSAEYK VIGSWTDHLH 500
    LRIERMHWPG SGQQLPRSIC SLPCQPGERK KTVKGMPCCW HCEPCTGYQY 550
    QVDRYTCKTC PYDMRPTENR TGCRPIPIIK LEWGSPWAVL PLFLAVVGIA 600
    ATLFVVITFV RYNDTPIVKA SGRELSYVLL AGIFLCYATT FLMIAEPDLG 650
    TCSLRRIFLG LGMSISYAAL LTKTNRIYRI FEQGKRSVSA PRFISPASQL 700
    AITFSLISLQ LLGICVWFVV DPSHSVVDFQ DQRTLDPRFA RGVLKCDISD 750
    LSLICLLGYS MLLMVTCTVY AIKTRGVPET FNEAKPIGFT MYTTCIVWLA 800
    FIPIFFGTSQ SADKLYIQTT TLTVSVSLSA SVSLGMLYMP KVYIILFHPE 850
    QNVPKRKRSL KAVVTAATMS NKFTQKGNFR PNGEAKSELC ENLEAPALAT 900
    KQTYVTYTNH AI 912
    Length:912
    Mass (Da):101,868
    Last modified:November 1, 1997 - v1
    Checksum:i4A2F36E63A2EAF5A
    GO
    Isoform 2 (identifier: Q14833-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-33: MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGK → MVQTLPKLFPHDGAKRKKRTLRTSGPCFGGGGQ
         34-173: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:772
    Mass (Da):86,683
    Checksum:i5AEAFC7B26F3CFCF
    GO
    Isoform 3 (identifier: Q14833-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-172: MPGKRGLGWW...IMVANILRLF → MSC

    Show »
    Length:743
    Mass (Da):83,580
    Checksum:i202C4DC3F806DC8F
    GO
    Isoform 4 (identifier: Q14833-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-172: MPGKRGLGWW...IMVANILRLF → MAVPLGAPCW...RLLSQHVKPA

    Note: No experimental confirmation available.

    Show »
    Length:779
    Mass (Da):87,353
    Checksum:iDEEE2F3C60EBD6E1
    GO
    Isoform 5 (identifier: Q14833-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-173: MPGKRGLGWW...MVANILRLFK → MPAWEPGVAA...PRCLLPESAQ
         343-390: GFDRYFSSRTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTN → D

    Note: No experimental confirmation available.

    Show »
    Length:796
    Mass (Da):88,493
    Checksum:iFAE466D1D45D3829
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti449 – 4491Y → H in BAH11632. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti169 – 1691L → F.
    Corresponds to variant rs452752 [ dbSNP | Ensembl ].
    VAR_049275
    Natural varianti797 – 7971V → I.1 Publication
    VAR_012992

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 173173MPGKR…LRLFK → MPAWEPGVAASCGWRAPPCS PLRLCIAPHPCTPPSSHQGN LTCRLPPRSFGFCRCVWVRT RGPSLPGEQVSLAAHESEGA AAQLGSSPEIDPRRPRCLLP ESAQ in isoform 5. 1 PublicationVSP_046761Add
    BLAST
    Alternative sequencei1 – 172172MPGKR…ILRLF → MSC in isoform 3. 1 PublicationVSP_045218Add
    BLAST
    Alternative sequencei1 – 172172MPGKR…ILRLF → MAVPLGAPCWASALPAWAPP GLPHRSLLTRLLSQHVKPA in isoform 4. 1 PublicationVSP_046762Add
    BLAST
    Alternative sequencei1 – 3333MPGKR…SSLGK → MVQTLPKLFPHDGAKRKKRT LRTSGPCFGGGGQ in isoform 2. 1 PublicationVSP_044740Add
    BLAST
    Alternative sequencei34 – 173140Missing in isoform 2. 1 PublicationVSP_044741Add
    BLAST
    Alternative sequencei343 – 39048GFDRY…KKCTN → D in isoform 5. 1 PublicationVSP_046763Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X80818 mRNA. Translation: CAA56784.1.
    U92457 mRNA. Translation: AAB51762.1.
    AK122982 mRNA. Translation: BAG53831.1.
    AK131536 mRNA. Translation: BAD18673.1.
    AK293913 mRNA. Translation: BAH11625.1.
    AK293949 mRNA. Translation: BAH11632.1.
    AL354740 Genomic DNA. No translation available.
    AL590403 Genomic DNA. Translation: CAI17348.1.
    CCDSiCCDS4787.1. [Q14833-1]
    CCDS59010.1. [Q14833-4]
    CCDS59011.1. [Q14833-3]
    CCDS59012.1. [Q14833-5]
    RefSeqiNP_000832.1. NM_000841.3. [Q14833-1]
    NP_001243738.1. NM_001256809.2. [Q14833-5]
    NP_001243740.1. NM_001256811.2.
    NP_001243741.1. NM_001256812.2. [Q14833-3]
    NP_001243742.1. NM_001256813.2. [Q14833-4]
    NP_001269776.1. NM_001282847.1.
    UniGeneiHs.429018.
    Hs.435128.
    Hs.736330.

    Genome annotation databases

    EnsembliENST00000374177; ENSP00000363292; ENSG00000124493. [Q14833-5]
    ENST00000374181; ENSP00000363296; ENSG00000124493. [Q14833-1]
    ENST00000455714; ENSP00000398456; ENSG00000124493. [Q14833-2]
    ENST00000535756; ENSP00000437925; ENSG00000124493. [Q14833-4]
    ENST00000538487; ENSP00000440556; ENSG00000124493. [Q14833-1]
    ENST00000544773; ENSP00000437730; ENSG00000124493. [Q14833-3]
    ENST00000609222; ENSP00000477466; ENSG00000124493. [Q14833-4]
    GeneIDi2914.
    KEGGihsa:2914.
    UCSCiuc003oio.4. human. [Q14833-1]
    uc003oiq.4. human.
    uc011dsm.3. human.

    Polymorphism databases

    DMDMi2495077.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X80818 mRNA. Translation: CAA56784.1 .
    U92457 mRNA. Translation: AAB51762.1 .
    AK122982 mRNA. Translation: BAG53831.1 .
    AK131536 mRNA. Translation: BAD18673.1 .
    AK293913 mRNA. Translation: BAH11625.1 .
    AK293949 mRNA. Translation: BAH11632.1 .
    AL354740 Genomic DNA. No translation available.
    AL590403 Genomic DNA. Translation: CAI17348.1 .
    CCDSi CCDS4787.1. [Q14833-1 ]
    CCDS59010.1. [Q14833-4 ]
    CCDS59011.1. [Q14833-3 ]
    CCDS59012.1. [Q14833-5 ]
    RefSeqi NP_000832.1. NM_000841.3. [Q14833-1 ]
    NP_001243738.1. NM_001256809.2. [Q14833-5 ]
    NP_001243740.1. NM_001256811.2.
    NP_001243741.1. NM_001256812.2. [Q14833-3 ]
    NP_001243742.1. NM_001256813.2. [Q14833-4 ]
    NP_001269776.1. NM_001282847.1.
    UniGenei Hs.429018.
    Hs.435128.
    Hs.736330.

    3D structure databases

    ProteinModelPortali Q14833.
    SMRi Q14833. Positions 38-853.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000363296.

    Chemistry

    BindingDBi Q14833.
    ChEMBLi CHEMBL2736.
    DrugBanki DB00142. L-Glutamic Acid.
    GuidetoPHARMACOLOGYi 292.

    Protein family/group databases

    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q14833.

    Polymorphism databases

    DMDMi 2495077.

    Proteomic databases

    PaxDbi Q14833.
    PRIDEi Q14833.

    Protocols and materials databases

    DNASUi 2914.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000374177 ; ENSP00000363292 ; ENSG00000124493 . [Q14833-5 ]
    ENST00000374181 ; ENSP00000363296 ; ENSG00000124493 . [Q14833-1 ]
    ENST00000455714 ; ENSP00000398456 ; ENSG00000124493 . [Q14833-2 ]
    ENST00000535756 ; ENSP00000437925 ; ENSG00000124493 . [Q14833-4 ]
    ENST00000538487 ; ENSP00000440556 ; ENSG00000124493 . [Q14833-1 ]
    ENST00000544773 ; ENSP00000437730 ; ENSG00000124493 . [Q14833-3 ]
    ENST00000609222 ; ENSP00000477466 ; ENSG00000124493 . [Q14833-4 ]
    GeneIDi 2914.
    KEGGi hsa:2914.
    UCSCi uc003oio.4. human. [Q14833-1 ]
    uc003oiq.4. human.
    uc011dsm.3. human.

    Organism-specific databases

    CTDi 2914.
    GeneCardsi GC06M035230.
    HGNCi HGNC:4596. GRM4.
    HPAi CAB022096.
    MIMi 604100. gene.
    neXtProti NX_Q14833.
    PharmGKBi PA28993.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG295200.
    HOGENOMi HOG000218635.
    HOVERGENi HBG107965.
    InParanoidi Q14833.
    KOi K04607.
    OMAi GWGWWWA.
    OrthoDBi EOG7Z0JXG.
    PhylomeDBi Q14833.
    TreeFami TF313240.

    Enzyme and pathway databases

    Reactomei REACT_18319. Class C/3 (Metabotropic glutamate/pheromone receptors).
    REACT_19231. G alpha (i) signalling events.

    Miscellaneous databases

    ChiTaRSi GRM4. human.
    GeneWikii Metabotropic_glutamate_receptor_4.
    GenomeRNAii 2914.
    NextBioi 11551.
    PROi Q14833.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q14833.
    Bgeei Q14833.
    CleanExi HS_GRM4.
    Genevestigatori Q14833.

    Family and domain databases

    InterProi IPR001828. ANF_lig-bd_rcpt.
    IPR000337. GPCR_3.
    IPR011500. GPCR_3_9-Cys_dom.
    IPR017978. GPCR_3_C.
    IPR017979. GPCR_3_CS.
    IPR000162. GPCR_3_mtglu_rcpt.
    IPR001786. GPCR_3_mtglu_rcpt_4.
    IPR028082. Peripla_BP_I.
    [Graphical view ]
    Pfami PF00003. 7tm_3. 1 hit.
    PF01094. ANF_receptor. 1 hit.
    PF07562. NCD3G. 1 hit.
    [Graphical view ]
    PRINTSi PR00248. GPCRMGR.
    PR01054. MTABOTROPC4R.
    PR00593. MTABOTROPICR.
    SUPFAMi SSF53822. SSF53822. 1 hit.
    PROSITEi PS00979. G_PROTEIN_RECEP_F3_1. 1 hit.
    PS00980. G_PROTEIN_RECEP_F3_2. 1 hit.
    PS00981. G_PROTEIN_RECEP_F3_3. 1 hit.
    PS50259. G_PROTEIN_RECEP_F3_4. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular characterization and localization of human metabotropic glutamate receptor type 4."
      Makoff A., Lelchuk R., Oxer M., Harrington K., Emson P.
      Brain Res. Mol. Brain Res. 37:239-248(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Brain.
    2. "Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells."
      Wu S., Wright R.A., Rockey P.K., Burgett S.G., Arnold J.S., Rosteck P.R. Jr., Johnson B.G., Schoepp D.D., Belagaje R.M.
      Brain Res. Mol. Brain Res. 53:88-97(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
    3. "Molecular cloning, functional expression and pharmacological characterization of the human metabotropic glutamate receptor type 4."
      Flor P.J., Lukic S., Rueegg D., Leonhardt T., Knoepfel T., Kuhn R.
      Neuropharmacology 34:149-155(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Brain.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
      Tissue: Brain and Cerebellum.
    5. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "Mutation screening of the metabotropic glutamate receptor mGluR4 (GRM4) gene in patients with schizophrenia."
      Ohtsuki T., Toru M., Arinami T.
      Psychiatr. Genet. 11:79-83(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT ILE-797.

    Entry informationi

    Entry nameiGRM4_HUMAN
    AccessioniPrimary (citable) accession number: Q14833
    Secondary accession number(s): B3KVL9
    , B7Z1T9, B7Z1U6, F5GXM5, Q5SZ84, Q6ZMQ2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1997
    Last modified: October 1, 2014
    This is version 130 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3