Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14833

- GRM4_HUMAN

UniProt

Q14833 - GRM4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Metabotropic glutamate receptor 4

Gene

GRM4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate cyclase activity.3 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei159 – 1591GlutamateBy similarity
Binding sitei230 – 2301GlutamateBy similarity
Binding sitei312 – 3121GlutamateBy similarity
Binding sitei405 – 4051GlutamateBy similarity

GO - Molecular functioni

  1. glutamate receptor activity Source: UniProtKB
  2. G-protein coupled receptor activity Source: UniProtKB
  3. group III metabotropic glutamate receptor activity Source: RefGenome

GO - Biological processi

  1. activation of MAPK activity Source: UniProtKB
  2. adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway Source: UniProtKB
  3. learning Source: Ensembl
  4. neurotransmitter secretion Source: UniProtKB
  5. positive regulation of MAPK cascade Source: UniProtKB
  6. regulation of neuron apoptotic process Source: UniProtKB
  7. regulation of synaptic transmission, glutamatergic Source: RefGenome
  8. synaptic transmission Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_18319. Class C/3 (Metabotropic glutamate/pheromone receptors).
REACT_19231. G alpha (i) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Metabotropic glutamate receptor 4
Short name:
mGluR4
Gene namesi
Name:GRM4
Synonyms:GPRC1D, MGLUR4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:4596. GRM4.

Subcellular locationi

Cell membrane 2 Publications; Multi-pass membrane protein 2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini33 – 587555ExtracellularSequence AnalysisAdd
BLAST
Transmembranei588 – 61023Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini611 – 62414CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei625 – 64521Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini646 – 65611ExtracellularSequence AnalysisAdd
BLAST
Transmembranei657 – 67519Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini676 – 69924CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei700 – 72021Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini721 – 75030ExtracellularSequence AnalysisAdd
BLAST
Transmembranei751 – 77222Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini773 – 78513CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei786 – 80823Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini809 – 82113ExtracellularSequence AnalysisAdd
BLAST
Transmembranei822 – 84726Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini848 – 91265CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytoplasmic vesicle Source: UniProtKB
  2. dendritic shaft Source: Ensembl
  3. integral component of plasma membrane Source: UniProtKB
  4. intracellular Source: UniProtKB
  5. plasma membrane Source: Reactome
  6. presynaptic active zone membrane Source: Ensembl
  7. presynaptic membrane Source: RefGenome
  8. terminal bouton Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28993.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3232Sequence AnalysisAdd
BLAST
Chaini33 – 912880Metabotropic glutamate receptor 4PRO_0000012930Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi67 ↔ 109By similarity
Glycosylationi98 – 981N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi249 ↔ 538By similarity
Glycosylationi301 – 3011N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi372 ↔ 388By similarity
Disulfide bondi428 ↔ 435By similarity
Glycosylationi454 – 4541N-linked (GlcNAc...)Sequence Analysis
Glycosylationi484 – 4841N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi520 ↔ 539By similarity
Disulfide bondi524 ↔ 542By similarity
Disulfide bondi545 ↔ 557By similarity
Disulfide bondi560 ↔ 573By similarity
Glycosylationi569 – 5691N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ14833.
PRIDEiQ14833.

PTM databases

PhosphoSiteiQ14833.

Expressioni

Tissue specificityi

Strongly expressed in the cerebellum. Expressed at low levels in hippocampus, hypothalamus and thalamus. No expression detected in liver.2 Publications

Gene expression databases

BgeeiQ14833.
CleanExiHS_GRM4.
ExpressionAtlasiQ14833. baseline.
GenevestigatoriQ14833.

Organism-specific databases

HPAiCAB022096.

Interactioni

Subunit structurei

Interacts with PICK1.By similarity

Protein-protein interaction databases

STRINGi9606.ENSP00000363296.

Structurei

3D structure databases

ProteinModelPortaliQ14833.
SMRiQ14833. Positions 38-853.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni180 – 1823Glutamate bindingBy similarity

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG295200.
GeneTreeiENSGT00760000118884.
HOGENOMiHOG000218635.
HOVERGENiHBG107965.
InParanoidiQ14833.
KOiK04607.
OMAiGWGWWWA.
OrthoDBiEOG7Z0JXG.
PhylomeDBiQ14833.
TreeFamiTF313240.

Family and domain databases

InterProiIPR001828. ANF_lig-bd_rcpt.
IPR000337. GPCR_3.
IPR011500. GPCR_3_9-Cys_dom.
IPR017978. GPCR_3_C.
IPR017979. GPCR_3_CS.
IPR000162. GPCR_3_mtglu_rcpt.
IPR001786. GPCR_3_mtglu_rcpt_4.
IPR028082. Peripla_BP_I.
[Graphical view]
PfamiPF00003. 7tm_3. 1 hit.
PF01094. ANF_receptor. 1 hit.
PF07562. NCD3G. 1 hit.
[Graphical view]
PRINTSiPR00248. GPCRMGR.
PR01054. MTABOTROPC4R.
PR00593. MTABOTROPICR.
SUPFAMiSSF53822. SSF53822. 1 hit.
PROSITEiPS00979. G_PROTEIN_RECEP_F3_1. 1 hit.
PS00980. G_PROTEIN_RECEP_F3_2. 1 hit.
PS00981. G_PROTEIN_RECEP_F3_3. 1 hit.
PS50259. G_PROTEIN_RECEP_F3_4. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q14833-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPGKRGLGWW WARLPLCLLL SLYGPWMPSS LGKPKGHPHM NSIRIDGDIT
60 70 80 90 100
LGGLFPVHGR GSEGKPCGEL KKEKGIHRLE AMLFALDRIN NDPDLLPNIT
110 120 130 140 150
LGARILDTCS RDTHALEQSL TFVQALIEKD GTEVRCGSGG PPIITKPERV
160 170 180 190 200
VGVIGASGSS VSIMVANILR LFKIPQISYA STAPDLSDNS RYDFFSRVVP
210 220 230 240 250
SDTYQAQAMV DIVRALKWNY VSTVASEGSY GESGVEAFIQ KSREDGGVCI
260 270 280 290 300
AQSVKIPREP KAGEFDKIIR RLLETSNARA VIIFANEDDI RRVLEAARRA
310 320 330 340 350
NQTGHFFWMG SDSWGSKIAP VLHLEEVAEG AVTILPKRMS VRGFDRYFSS
360 370 380 390 400
RTLDNNRRNI WFAEFWEDNF HCKLSRHALK KGSHVKKCTN RERIGQDSAY
410 420 430 440 450
EQEGKVQFVI DAVYAMGHAL HAMHRDLCPG RVGLCPRMDP VDGTQLLKYI
460 470 480 490 500
RNVNFSGIAG NPVTFNENGD APGRYDIYQY QLRNDSAEYK VIGSWTDHLH
510 520 530 540 550
LRIERMHWPG SGQQLPRSIC SLPCQPGERK KTVKGMPCCW HCEPCTGYQY
560 570 580 590 600
QVDRYTCKTC PYDMRPTENR TGCRPIPIIK LEWGSPWAVL PLFLAVVGIA
610 620 630 640 650
ATLFVVITFV RYNDTPIVKA SGRELSYVLL AGIFLCYATT FLMIAEPDLG
660 670 680 690 700
TCSLRRIFLG LGMSISYAAL LTKTNRIYRI FEQGKRSVSA PRFISPASQL
710 720 730 740 750
AITFSLISLQ LLGICVWFVV DPSHSVVDFQ DQRTLDPRFA RGVLKCDISD
760 770 780 790 800
LSLICLLGYS MLLMVTCTVY AIKTRGVPET FNEAKPIGFT MYTTCIVWLA
810 820 830 840 850
FIPIFFGTSQ SADKLYIQTT TLTVSVSLSA SVSLGMLYMP KVYIILFHPE
860 870 880 890 900
QNVPKRKRSL KAVVTAATMS NKFTQKGNFR PNGEAKSELC ENLEAPALAT
910
KQTYVTYTNH AI
Length:912
Mass (Da):101,868
Last modified:November 1, 1997 - v1
Checksum:i4A2F36E63A2EAF5A
GO
Isoform 2 (identifier: Q14833-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGK → MVQTLPKLFPHDGAKRKKRTLRTSGPCFGGGGQ
     34-173: Missing.

Note: No experimental confirmation available.

Show »
Length:772
Mass (Da):86,683
Checksum:i5AEAFC7B26F3CFCF
GO
Isoform 3 (identifier: Q14833-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-172: MPGKRGLGWW...IMVANILRLF → MSC

Show »
Length:743
Mass (Da):83,580
Checksum:i202C4DC3F806DC8F
GO
Isoform 4 (identifier: Q14833-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-172: MPGKRGLGWW...IMVANILRLF → MAVPLGAPCW...RLLSQHVKPA

Note: No experimental confirmation available.

Show »
Length:779
Mass (Da):87,353
Checksum:iDEEE2F3C60EBD6E1
GO
Isoform 5 (identifier: Q14833-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-173: MPGKRGLGWW...MVANILRLFK → MPAWEPGVAA...PRCLLPESAQ
     343-390: GFDRYFSSRTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTN → D

Note: No experimental confirmation available.

Show »
Length:796
Mass (Da):88,493
Checksum:iFAE466D1D45D3829
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti449 – 4491Y → H in BAH11632. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti169 – 1691L → F.
Corresponds to variant rs452752 [ dbSNP | Ensembl ].
VAR_049275
Natural varianti797 – 7971V → I.1 Publication
VAR_012992

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 173173MPGKR…LRLFK → MPAWEPGVAASCGWRAPPCS PLRLCIAPHPCTPPSSHQGN LTCRLPPRSFGFCRCVWVRT RGPSLPGEQVSLAAHESEGA AAQLGSSPEIDPRRPRCLLP ESAQ in isoform 5. 1 PublicationVSP_046761Add
BLAST
Alternative sequencei1 – 172172MPGKR…ILRLF → MSC in isoform 3. 1 PublicationVSP_045218Add
BLAST
Alternative sequencei1 – 172172MPGKR…ILRLF → MAVPLGAPCWASALPAWAPP GLPHRSLLTRLLSQHVKPA in isoform 4. 1 PublicationVSP_046762Add
BLAST
Alternative sequencei1 – 3333MPGKR…SSLGK → MVQTLPKLFPHDGAKRKKRT LRTSGPCFGGGGQ in isoform 2. 1 PublicationVSP_044740Add
BLAST
Alternative sequencei34 – 173140Missing in isoform 2. 1 PublicationVSP_044741Add
BLAST
Alternative sequencei343 – 39048GFDRY…KKCTN → D in isoform 5. 1 PublicationVSP_046763Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X80818 mRNA. Translation: CAA56784.1.
U92457 mRNA. Translation: AAB51762.1.
AK122982 mRNA. Translation: BAG53831.1.
AK131536 mRNA. Translation: BAD18673.1.
AK293913 mRNA. Translation: BAH11625.1.
AK293949 mRNA. Translation: BAH11632.1.
AL354740 Genomic DNA. No translation available.
AL590403 Genomic DNA. Translation: CAI17348.1.
CCDSiCCDS4787.1. [Q14833-1]
CCDS59010.1. [Q14833-4]
CCDS59011.1. [Q14833-3]
CCDS59012.1. [Q14833-5]
RefSeqiNP_000832.1. NM_000841.3. [Q14833-1]
NP_001243738.1. NM_001256809.2. [Q14833-5]
NP_001243740.1. NM_001256811.2.
NP_001243741.1. NM_001256812.2. [Q14833-3]
NP_001243742.1. NM_001256813.2. [Q14833-4]
NP_001269776.1. NM_001282847.1.
UniGeneiHs.429018.
Hs.435128.
Hs.736330.

Genome annotation databases

EnsembliENST00000374177; ENSP00000363292; ENSG00000124493. [Q14833-5]
ENST00000455714; ENSP00000398456; ENSG00000124493. [Q14833-2]
ENST00000535756; ENSP00000437925; ENSG00000124493. [Q14833-4]
ENST00000538487; ENSP00000440556; ENSG00000124493. [Q14833-1]
ENST00000544773; ENSP00000437730; ENSG00000124493. [Q14833-3]
ENST00000609222; ENSP00000477466; ENSG00000124493. [Q14833-4]
GeneIDi2914.
KEGGihsa:2914.
UCSCiuc003oio.4. human. [Q14833-1]
uc003oiq.4. human.
uc011dsm.3. human.
uc031som.1. human.

Polymorphism databases

DMDMi2495077.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X80818 mRNA. Translation: CAA56784.1 .
U92457 mRNA. Translation: AAB51762.1 .
AK122982 mRNA. Translation: BAG53831.1 .
AK131536 mRNA. Translation: BAD18673.1 .
AK293913 mRNA. Translation: BAH11625.1 .
AK293949 mRNA. Translation: BAH11632.1 .
AL354740 Genomic DNA. No translation available.
AL590403 Genomic DNA. Translation: CAI17348.1 .
CCDSi CCDS4787.1. [Q14833-1 ]
CCDS59010.1. [Q14833-4 ]
CCDS59011.1. [Q14833-3 ]
CCDS59012.1. [Q14833-5 ]
RefSeqi NP_000832.1. NM_000841.3. [Q14833-1 ]
NP_001243738.1. NM_001256809.2. [Q14833-5 ]
NP_001243740.1. NM_001256811.2.
NP_001243741.1. NM_001256812.2. [Q14833-3 ]
NP_001243742.1. NM_001256813.2. [Q14833-4 ]
NP_001269776.1. NM_001282847.1.
UniGenei Hs.429018.
Hs.435128.
Hs.736330.

3D structure databases

ProteinModelPortali Q14833.
SMRi Q14833. Positions 38-853.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000363296.

Chemistry

BindingDBi Q14833.
ChEMBLi CHEMBL2736.
GuidetoPHARMACOLOGYi 292.

Protein family/group databases

GPCRDBi Search...

PTM databases

PhosphoSitei Q14833.

Polymorphism databases

DMDMi 2495077.

Proteomic databases

PaxDbi Q14833.
PRIDEi Q14833.

Protocols and materials databases

DNASUi 2914.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000374177 ; ENSP00000363292 ; ENSG00000124493 . [Q14833-5 ]
ENST00000455714 ; ENSP00000398456 ; ENSG00000124493 . [Q14833-2 ]
ENST00000535756 ; ENSP00000437925 ; ENSG00000124493 . [Q14833-4 ]
ENST00000538487 ; ENSP00000440556 ; ENSG00000124493 . [Q14833-1 ]
ENST00000544773 ; ENSP00000437730 ; ENSG00000124493 . [Q14833-3 ]
ENST00000609222 ; ENSP00000477466 ; ENSG00000124493 . [Q14833-4 ]
GeneIDi 2914.
KEGGi hsa:2914.
UCSCi uc003oio.4. human. [Q14833-1 ]
uc003oiq.4. human.
uc011dsm.3. human.
uc031som.1. human.

Organism-specific databases

CTDi 2914.
GeneCardsi GC06M035725.
HGNCi HGNC:4596. GRM4.
HPAi CAB022096.
MIMi 604100. gene.
neXtProti NX_Q14833.
PharmGKBi PA28993.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG295200.
GeneTreei ENSGT00760000118884.
HOGENOMi HOG000218635.
HOVERGENi HBG107965.
InParanoidi Q14833.
KOi K04607.
OMAi GWGWWWA.
OrthoDBi EOG7Z0JXG.
PhylomeDBi Q14833.
TreeFami TF313240.

Enzyme and pathway databases

Reactomei REACT_18319. Class C/3 (Metabotropic glutamate/pheromone receptors).
REACT_19231. G alpha (i) signalling events.

Miscellaneous databases

ChiTaRSi GRM4. human.
GeneWikii Metabotropic_glutamate_receptor_4.
GenomeRNAii 2914.
NextBioi 11551.
PROi Q14833.
SOURCEi Search...

Gene expression databases

Bgeei Q14833.
CleanExi HS_GRM4.
ExpressionAtlasi Q14833. baseline.
Genevestigatori Q14833.

Family and domain databases

InterProi IPR001828. ANF_lig-bd_rcpt.
IPR000337. GPCR_3.
IPR011500. GPCR_3_9-Cys_dom.
IPR017978. GPCR_3_C.
IPR017979. GPCR_3_CS.
IPR000162. GPCR_3_mtglu_rcpt.
IPR001786. GPCR_3_mtglu_rcpt_4.
IPR028082. Peripla_BP_I.
[Graphical view ]
Pfami PF00003. 7tm_3. 1 hit.
PF01094. ANF_receptor. 1 hit.
PF07562. NCD3G. 1 hit.
[Graphical view ]
PRINTSi PR00248. GPCRMGR.
PR01054. MTABOTROPC4R.
PR00593. MTABOTROPICR.
SUPFAMi SSF53822. SSF53822. 1 hit.
PROSITEi PS00979. G_PROTEIN_RECEP_F3_1. 1 hit.
PS00980. G_PROTEIN_RECEP_F3_2. 1 hit.
PS00981. G_PROTEIN_RECEP_F3_3. 1 hit.
PS50259. G_PROTEIN_RECEP_F3_4. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization and localization of human metabotropic glutamate receptor type 4."
    Makoff A., Lelchuk R., Oxer M., Harrington K., Emson P.
    Brain Res. Mol. Brain Res. 37:239-248(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells."
    Wu S., Wright R.A., Rockey P.K., Burgett S.G., Arnold J.S., Rosteck P.R. Jr., Johnson B.G., Schoepp D.D., Belagaje R.M.
    Brain Res. Mol. Brain Res. 53:88-97(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
  3. "Molecular cloning, functional expression and pharmacological characterization of the human metabotropic glutamate receptor type 4."
    Flor P.J., Lukic S., Rueegg D., Leonhardt T., Knoepfel T., Kuhn R.
    Neuropharmacology 34:149-155(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
    Tissue: Brain and Cerebellum.
  5. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "Mutation screening of the metabotropic glutamate receptor mGluR4 (GRM4) gene in patients with schizophrenia."
    Ohtsuki T., Toru M., Arinami T.
    Psychiatr. Genet. 11:79-83(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ILE-797.

Entry informationi

Entry nameiGRM4_HUMAN
AccessioniPrimary (citable) accession number: Q14833
Secondary accession number(s): B3KVL9
, B7Z1T9, B7Z1U6, F5GXM5, Q5SZ84, Q6ZMQ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: October 29, 2014
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3