Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q14833 (GRM4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 128. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Metabotropic glutamate receptor 4

Short name=mGluR4
Gene names
Name:GRM4
Synonyms:GPRC1D, MGLUR4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length912 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate cyclase activity. Ref.1 Ref.2 Ref.3

Subunit structure

Interacts with PICK1 By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein Ref.1 Ref.3.

Tissue specificity

Strongly expressed in the cerebellum. Expressed at low levels in hippocampus, hypothalamus and thalamus. No expression detected in liver. Ref.1 Ref.3

Sequence similarities

Belongs to the G-protein coupled receptor 3 family.

Ontologies

Keywords
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
Transmembrane
Transmembrane helix
   Molecular functionG-protein coupled receptor
Receptor
Transducer
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processactivation of MAPK activity

Inferred from direct assay PubMed 15102938. Source: UniProtKB

adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway

Inferred from mutant phenotype PubMed 15102938. Source: UniProtKB

learning

Inferred from electronic annotation. Source: Ensembl

neurotransmitter secretion

Traceable author statement PubMed 15102938. Source: UniProtKB

positive regulation of MAPK cascade

Inferred from expression pattern PubMed 15102938. Source: UniProtKB

regulation of neuron apoptotic process

Traceable author statement PubMed 15102938. Source: UniProtKB

regulation of synaptic transmission, glutamatergic

Inferred from Biological aspect of Ancestor. Source: RefGenome

synaptic transmission

Traceable author statement Ref.1. Source: ProtInc

   Cellular_componentcytoplasmic vesicle

Inferred from direct assay PubMed 15102938. Source: UniProtKB

dendritic shaft

Inferred from electronic annotation. Source: Ensembl

integral component of plasma membrane

Inferred from direct assay PubMed 15102938. Source: UniProtKB

intracellular

Inferred from direct assay PubMed 15102938. Source: UniProtKB

plasma membrane

Traceable author statement. Source: Reactome

presynaptic active zone membrane

Inferred from electronic annotation. Source: Ensembl

presynaptic membrane

Inferred from Biological aspect of Ancestor. Source: RefGenome

terminal bouton

Inferred from electronic annotation. Source: Ensembl

   Molecular_functionG-protein coupled receptor activity

Inferred from mutant phenotype Ref.1Ref.2. Source: UniProtKB

glutamate receptor activity

Inferred from mutant phenotype Ref.1Ref.2. Source: UniProtKB

group III metabotropic glutamate receptor activity

Inferred from Biological aspect of Ancestor. Source: RefGenome

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q14833-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q14833-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGK → MVQTLPKLFPHDGAKRKKRTLRTSGPCFGGGGQ
     34-173: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q14833-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-172: MPGKRGLGWW...IMVANILRLF → MSC
Isoform 4 (identifier: Q14833-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-172: MPGKRGLGWW...IMVANILRLF → MAVPLGAPCW...RLLSQHVKPA
Note: No experimental confirmation available.
Isoform 5 (identifier: Q14833-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-173: MPGKRGLGWW...MVANILRLFK → MPAWEPGVAA...PRCLLPESAQ
     343-390: GFDRYFSSRTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTN → D
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3232 Potential
Chain33 – 912880Metabotropic glutamate receptor 4
PRO_0000012930

Regions

Topological domain33 – 587555Extracellular Potential
Transmembrane588 – 61023Helical; Name=1; Potential
Topological domain611 – 62414Cytoplasmic Potential
Transmembrane625 – 64521Helical; Name=2; Potential
Topological domain646 – 65611Extracellular Potential
Transmembrane657 – 67519Helical; Name=3; Potential
Topological domain676 – 69924Cytoplasmic Potential
Transmembrane700 – 72021Helical; Name=4; Potential
Topological domain721 – 75030Extracellular Potential
Transmembrane751 – 77222Helical; Name=5; Potential
Topological domain773 – 78513Cytoplasmic Potential
Transmembrane786 – 80823Helical; Name=6; Potential
Topological domain809 – 82113Extracellular Potential
Transmembrane822 – 84726Helical; Name=7; Potential
Topological domain848 – 91265Cytoplasmic Potential
Region180 – 1823Glutamate binding By similarity

Sites

Binding site1591Glutamate By similarity
Binding site2301Glutamate By similarity
Binding site3121Glutamate By similarity
Binding site4051Glutamate By similarity

Amino acid modifications

Glycosylation981N-linked (GlcNAc...) Potential
Glycosylation3011N-linked (GlcNAc...) Potential
Glycosylation4541N-linked (GlcNAc...) Potential
Glycosylation4841N-linked (GlcNAc...) Potential
Glycosylation5691N-linked (GlcNAc...) Potential
Disulfide bond67 ↔ 109 By similarity
Disulfide bond249 ↔ 538 By similarity
Disulfide bond372 ↔ 388 By similarity
Disulfide bond428 ↔ 435 By similarity
Disulfide bond520 ↔ 539 By similarity
Disulfide bond524 ↔ 542 By similarity
Disulfide bond545 ↔ 557 By similarity
Disulfide bond560 ↔ 573 By similarity

Natural variations

Alternative sequence1 – 173173MPGKR…LRLFK → MPAWEPGVAASCGWRAPPCS PLRLCIAPHPCTPPSSHQGN LTCRLPPRSFGFCRCVWVRT RGPSLPGEQVSLAAHESEGA AAQLGSSPEIDPRRPRCLLP ESAQ in isoform 5.
VSP_046761
Alternative sequence1 – 172172MPGKR…ILRLF → MSC in isoform 3.
VSP_045218
Alternative sequence1 – 172172MPGKR…ILRLF → MAVPLGAPCWASALPAWAPP GLPHRSLLTRLLSQHVKPA in isoform 4.
VSP_046762
Alternative sequence1 – 3333MPGKR…SSLGK → MVQTLPKLFPHDGAKRKKRT LRTSGPCFGGGGQ in isoform 2.
VSP_044740
Alternative sequence34 – 173140Missing in isoform 2.
VSP_044741
Alternative sequence343 – 39048GFDRY…KKCTN → D in isoform 5.
VSP_046763
Natural variant1691L → F.
Corresponds to variant rs452752 [ dbSNP | Ensembl ].
VAR_049275
Natural variant7971V → I. Ref.6
VAR_012992

Experimental info

Sequence conflict4491Y → H in BAH11632. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1997. Version 1.
Checksum: 4A2F36E63A2EAF5A

FASTA912101,868
        10         20         30         40         50         60 
MPGKRGLGWW WARLPLCLLL SLYGPWMPSS LGKPKGHPHM NSIRIDGDIT LGGLFPVHGR 

        70         80         90        100        110        120 
GSEGKPCGEL KKEKGIHRLE AMLFALDRIN NDPDLLPNIT LGARILDTCS RDTHALEQSL 

       130        140        150        160        170        180 
TFVQALIEKD GTEVRCGSGG PPIITKPERV VGVIGASGSS VSIMVANILR LFKIPQISYA 

       190        200        210        220        230        240 
STAPDLSDNS RYDFFSRVVP SDTYQAQAMV DIVRALKWNY VSTVASEGSY GESGVEAFIQ 

       250        260        270        280        290        300 
KSREDGGVCI AQSVKIPREP KAGEFDKIIR RLLETSNARA VIIFANEDDI RRVLEAARRA 

       310        320        330        340        350        360 
NQTGHFFWMG SDSWGSKIAP VLHLEEVAEG AVTILPKRMS VRGFDRYFSS RTLDNNRRNI 

       370        380        390        400        410        420 
WFAEFWEDNF HCKLSRHALK KGSHVKKCTN RERIGQDSAY EQEGKVQFVI DAVYAMGHAL 

       430        440        450        460        470        480 
HAMHRDLCPG RVGLCPRMDP VDGTQLLKYI RNVNFSGIAG NPVTFNENGD APGRYDIYQY 

       490        500        510        520        530        540 
QLRNDSAEYK VIGSWTDHLH LRIERMHWPG SGQQLPRSIC SLPCQPGERK KTVKGMPCCW 

       550        560        570        580        590        600 
HCEPCTGYQY QVDRYTCKTC PYDMRPTENR TGCRPIPIIK LEWGSPWAVL PLFLAVVGIA 

       610        620        630        640        650        660 
ATLFVVITFV RYNDTPIVKA SGRELSYVLL AGIFLCYATT FLMIAEPDLG TCSLRRIFLG 

       670        680        690        700        710        720 
LGMSISYAAL LTKTNRIYRI FEQGKRSVSA PRFISPASQL AITFSLISLQ LLGICVWFVV 

       730        740        750        760        770        780 
DPSHSVVDFQ DQRTLDPRFA RGVLKCDISD LSLICLLGYS MLLMVTCTVY AIKTRGVPET 

       790        800        810        820        830        840 
FNEAKPIGFT MYTTCIVWLA FIPIFFGTSQ SADKLYIQTT TLTVSVSLSA SVSLGMLYMP 

       850        860        870        880        890        900 
KVYIILFHPE QNVPKRKRSL KAVVTAATMS NKFTQKGNFR PNGEAKSELC ENLEAPALAT 

       910 
KQTYVTYTNH AI 

« Hide

Isoform 2 [UniParc].

Checksum: 5AEAFC7B26F3CFCF
Show »

FASTA77286,683
Isoform 3 [UniParc].

Checksum: 202C4DC3F806DC8F
Show »

FASTA74383,580
Isoform 4 [UniParc].

Checksum: DEEE2F3C60EBD6E1
Show »

FASTA77987,353
Isoform 5 [UniParc].

Checksum: FAE466D1D45D3829
Show »

FASTA79688,493

References

« Hide 'large scale' references
[1]"Molecular characterization and localization of human metabotropic glutamate receptor type 4."
Makoff A., Lelchuk R., Oxer M., Harrington K., Emson P.
Brain Res. Mol. Brain Res. 37:239-248(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Brain.
[2]"Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells."
Wu S., Wright R.A., Rockey P.K., Burgett S.G., Arnold J.S., Rosteck P.R. Jr., Johnson B.G., Schoepp D.D., Belagaje R.M.
Brain Res. Mol. Brain Res. 53:88-97(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
[3]"Molecular cloning, functional expression and pharmacological characterization of the human metabotropic glutamate receptor type 4."
Flor P.J., Lukic S., Rueegg D., Leonhardt T., Knoepfel T., Kuhn R.
Neuropharmacology 34:149-155(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Brain.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
Tissue: Brain and Cerebellum.
[5]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"Mutation screening of the metabotropic glutamate receptor mGluR4 (GRM4) gene in patients with schizophrenia."
Ohtsuki T., Toru M., Arinami T.
Psychiatr. Genet. 11:79-83(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT ILE-797.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X80818 mRNA. Translation: CAA56784.1.
U92457 mRNA. Translation: AAB51762.1.
AK122982 mRNA. Translation: BAG53831.1.
AK131536 mRNA. Translation: BAD18673.1.
AK293913 mRNA. Translation: BAH11625.1.
AK293949 mRNA. Translation: BAH11632.1.
AL354740 Genomic DNA. No translation available.
AL590403 Genomic DNA. Translation: CAI17348.1.
CCDSCCDS4787.1. [Q14833-1]
CCDS59010.1. [Q14833-4]
CCDS59011.1. [Q14833-3]
CCDS59012.1. [Q14833-5]
RefSeqNP_000832.1. NM_000841.3. [Q14833-1]
NP_001243738.1. NM_001256809.2. [Q14833-5]
NP_001243740.1. NM_001256811.2.
NP_001243741.1. NM_001256812.2. [Q14833-3]
NP_001243742.1. NM_001256813.2. [Q14833-4]
NP_001269776.1. NM_001282847.1.
UniGeneHs.429018.
Hs.435128.
Hs.736330.

3D structure databases

ProteinModelPortalQ14833.
SMRQ14833. Positions 38-853.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000363296.

Chemistry

BindingDBQ14833.
ChEMBLCHEMBL2736.
DrugBankDB00142. L-Glutamic Acid.
GuidetoPHARMACOLOGY292.

Protein family/group databases

GPCRDBSearch...

PTM databases

PhosphoSiteQ14833.

Polymorphism databases

DMDM2495077.

Proteomic databases

PaxDbQ14833.
PRIDEQ14833.

Protocols and materials databases

DNASU2914.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000374177; ENSP00000363292; ENSG00000124493. [Q14833-5]
ENST00000374181; ENSP00000363296; ENSG00000124493. [Q14833-1]
ENST00000455714; ENSP00000398456; ENSG00000124493. [Q14833-2]
ENST00000535756; ENSP00000437925; ENSG00000124493. [Q14833-4]
ENST00000538487; ENSP00000440556; ENSG00000124493. [Q14833-1]
ENST00000544773; ENSP00000437730; ENSG00000124493. [Q14833-3]
ENST00000609222; ENSP00000477466; ENSG00000124493. [Q14833-4]
GeneID2914.
KEGGhsa:2914.
UCSCuc003oio.4. human. [Q14833-1]
uc003oiq.4. human.
uc011dsm.3. human.

Organism-specific databases

CTD2914.
GeneCardsGC06M035230.
HGNCHGNC:4596. GRM4.
HPACAB022096.
MIM604100. gene.
neXtProtNX_Q14833.
PharmGKBPA28993.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG295200.
HOGENOMHOG000218635.
HOVERGENHBG107965.
InParanoidQ14833.
KOK04607.
OMAGWGWWWA.
OrthoDBEOG7Z0JXG.
PhylomeDBQ14833.
TreeFamTF313240.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressQ14833.
BgeeQ14833.
CleanExHS_GRM4.
GenevestigatorQ14833.

Family and domain databases

InterProIPR001828. ANF_lig-bd_rcpt.
IPR000337. GPCR_3.
IPR011500. GPCR_3_9-Cys_dom.
IPR017978. GPCR_3_C.
IPR017979. GPCR_3_CS.
IPR000162. GPCR_3_mtglu_rcpt.
IPR001786. GPCR_3_mtglu_rcpt_4.
IPR028082. Peripla_BP_I.
[Graphical view]
PfamPF00003. 7tm_3. 1 hit.
PF01094. ANF_receptor. 1 hit.
PF07562. NCD3G. 1 hit.
[Graphical view]
PRINTSPR00248. GPCRMGR.
PR01054. MTABOTROPC4R.
PR00593. MTABOTROPICR.
SUPFAMSSF53822. SSF53822. 1 hit.
PROSITEPS00979. G_PROTEIN_RECEP_F3_1. 1 hit.
PS00980. G_PROTEIN_RECEP_F3_2. 1 hit.
PS00981. G_PROTEIN_RECEP_F3_3. 1 hit.
PS50259. G_PROTEIN_RECEP_F3_4. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSGRM4. human.
GeneWikiMetabotropic_glutamate_receptor_4.
GenomeRNAi2914.
NextBio11551.
PROQ14833.
SOURCESearch...

Entry information

Entry nameGRM4_HUMAN
AccessionPrimary (citable) accession number: Q14833
Secondary accession number(s): B3KVL9 expand/collapse secondary AC list , B7Z1T9, B7Z1U6, F5GXM5, Q5SZ84, Q6ZMQ2
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: July 9, 2014
This is version 128 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries