Q14833 (GRM4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Metabotropic glutamate receptor 4 Short name=mGluR4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 912 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity. |
| Subunit structure | Interacts with PICK1 By similarity. |
| Subcellular location | |
| Tissue specificity | Strongly expressed in the cerebellum. Expressed at low levels in hippocampus, hypothalamus and thalamus. No expression detected in liver. |
| Sequence similarities | Belongs to the G-protein coupled receptor 3 family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q14833-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q14833-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGK → MVQTLPKLFPHDGAKRKKRTLRTSGPCFGGGGQ 34-173: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q14833-3) The sequence of this isoform differs from the canonical sequence as follows: 1-172: MPGKRGLGWW...IMVANILRLF → MSC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 32 | 32 | Potential | ||||||||
| Chain | 33 – 912 | 880 | Metabotropic glutamate receptor 4 | PRO_0000012930 | |||||||
Regions | |||||||||||
| Topological domain | 33 – 587 | 555 | Extracellular Potential | ||||||||
| Transmembrane | 588 – 610 | 23 | Helical; Name=1; Potential | ||||||||
| Topological domain | 611 – 624 | 14 | Cytoplasmic Potential | ||||||||
| Transmembrane | 625 – 645 | 21 | Helical; Name=2; Potential | ||||||||
| Topological domain | 646 – 656 | 11 | Extracellular Potential | ||||||||
| Transmembrane | 657 – 675 | 19 | Helical; Name=3; Potential | ||||||||
| Topological domain | 676 – 699 | 24 | Cytoplasmic Potential | ||||||||
| Transmembrane | 700 – 720 | 21 | Helical; Name=4; Potential | ||||||||
| Topological domain | 721 – 750 | 30 | Extracellular Potential | ||||||||
| Transmembrane | 751 – 772 | 22 | Helical; Name=5; Potential | ||||||||
| Topological domain | 773 – 785 | 13 | Cytoplasmic Potential | ||||||||
| Transmembrane | 786 – 808 | 23 | Helical; Name=6; Potential | ||||||||
| Topological domain | 809 – 821 | 13 | Extracellular Potential | ||||||||
| Transmembrane | 822 – 847 | 26 | Helical; Name=7; Potential | ||||||||
| Topological domain | 848 – 912 | 65 | Cytoplasmic Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 98 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 301 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 454 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 484 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 569 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 67 ↔ 109 | By similarity | |||||||||
| Disulfide bond | 249 ↔ 538 | By similarity | |||||||||
| Disulfide bond | 372 ↔ 388 | By similarity | |||||||||
| Disulfide bond | 428 ↔ 435 | By similarity | |||||||||
| Disulfide bond | 520 ↔ 539 | By similarity | |||||||||
| Disulfide bond | 524 ↔ 542 | By similarity | |||||||||
| Disulfide bond | 545 ↔ 557 | By similarity | |||||||||
| Disulfide bond | 560 ↔ 573 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 172 | 172 | MPGKR…ILRLF → MSC in isoform 3. | VSP_045218 | |||||||
| Alternative sequence | 1 – 33 | 33 | MPGKR…SSLGK → MVQTLPKLFPHDGAKRKKRT LRTSGPCFGGGGQ in isoform 2. | VSP_044740 | |||||||
| Alternative sequence | 34 – 173 | 140 | Missing in isoform 2. | VSP_044741 | |||||||
| Natural variant | 169 | 1 | L → F. Corresponds to variant rs452752 [ dbSNP | Ensembl ]. | VAR_049275 | |||||||
| Natural variant | 797 | 1 | V → I. Ref.6 | VAR_012992 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 449 | 1 | Y → H in BAH11632. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular characterization and localization of human metabotropic glutamate receptor type 4." Makoff A., Lelchuk R., Oxer M., Harrington K., Emson P. Brain Res. Mol. Brain Res. 37:239-248(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells." Wu S., Wright R.A., Rockey P.K., Burgett S.G., Arnold J.S., Rosteck P.R. Jr., Johnson B.G., Schoepp D.D., Belagaje R.M. Brain Res. Mol. Brain Res. 53:88-97(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Molecular cloning, functional expression and pharmacological characterization of the human metabotropic glutamate receptor type 4." Flor P.J., Lukic S., Rueegg D., Leonhardt T., Knoepfel T., Kuhn R. Neuropharmacology 34:149-155(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Cerebellum. |
| [5] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Mutation screening of the metabotropic glutamate receptor mGluR4 (GRM4) gene in patients with schizophrenia." Ohtsuki T., Toru M., Arinami T. Psychiatr. Genet. 11:79-83(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT ILE-797. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X80818 mRNA. Translation: CAA56784.1. U92457 mRNA. Translation: AAB51762.1. AK293913 mRNA. Translation: BAH11625.1. AK293949 mRNA. Translation: BAH11632.1. AL354740 Genomic DNA. No translation available. AL590403 Genomic DNA. Translation: CAI17348.1. |
| IPI | IPI00000839. IPI01013349. |
| RefSeq | NP_000832.1. NM_000841.2. NP_001243741.1. NM_001256812.1. NP_001243743.1. NM_001256814.1. |
| UniGene | Hs.429018. Hs.736330. |
3D structure databases | |
| ProteinModelPortal | Q14833. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000363296. |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | Q14833. |
Polymorphism databases | |
| DMDM | 2495077. |
Proteomic databases | |
| PaxDb | Q14833. |
| PRIDE | Q14833. |
Protocols and materials databases | |
| DNASU | 2914. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000374181; ENSP00000363296; ENSG00000124493. ENST00000455714; ENSP00000398456; ENSG00000124493. ENST00000538487; ENSP00000440556; ENSG00000124493. ENST00000544773; ENSP00000437730; ENSG00000124493. |
| GeneID | 2914. |
| KEGG | hsa:2914. |
| UCSC | uc003oio.3. human. |
Organism-specific databases | |
| CTD | 2914. |
| GeneCards | GC06M034203. |
| HGNC | HGNC:4596. GRM4. |
| HPA | CAB022096. |
| MIM | 604100. gene. |
| neXtProt | NX_Q14833. |
| PharmGKB | PA28993. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG295200. |
| HOGENOM | HOG000218635. |
| HOVERGEN | HBG107965. |
| InParanoid | Q14833. |
| KO | K04607. |
| OMA | GWGWWWA. |
| OrthoDB | EOG4ZW59D. |
| PhylomeDB | Q14833. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | Q14833. |
| Bgee | Q14833. |
| CleanEx | HS_GRM4. |
| Genevestigator | Q14833. |
| GermOnline | ENSG00000124493. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001828. ANF_lig-bd_rcpt. IPR000337. GPCR_3. IPR011500. GPCR_3_9-Cys_dom. IPR017978. GPCR_3_C. IPR017979. GPCR_3_CS. IPR000162. GPCR_3_mtglu_rcpt. IPR001786. GPCR_3_mtglu_rcpt_4. [Graphical view] |
| Pfam | PF00003. 7tm_3. 1 hit. PF01094. ANF_receptor. 1 hit. PF07562. NCD3G. 1 hit. [Graphical view] |
| PRINTS | PR00248. GPCRMGR. PR01054. MTABOTROPC4R. PR00593. MTABOTROPICR. |
| PROSITE | PS00979. G_PROTEIN_RECEP_F3_1. 1 hit. PS00980. G_PROTEIN_RECEP_F3_2. 1 hit. PS00981. G_PROTEIN_RECEP_F3_3. 1 hit. PS50259. G_PROTEIN_RECEP_F3_4. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q14833. |
| ChEMBL | CHEMBL2736. |
| ChiTaRS | GRM4. human. |
| DrugBank | DB00142. L-Glutamic Acid. |
| GenomeRNAi | 2914. |
| NextBio | 11551. |
| SOURCE | Search... |
Entry information
| Entry name | GRM4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14833 Secondary accession number(s): B7Z1T9 Q5SZ84 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
