Reviewed,
UniProtKB/Swiss-Prot Q14790 (CASP8_HUMAN)
Last modified
November 25, 2008.
Version 114.
History...
Clusters with 100%,
90%,
50% identity |
Documents (8) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Caspase-8 Short name=CASP-8 EC=3.4.22.61 Alternative name(s): ICE-like apoptotic protease 5 MORT1-associated CED-3 homolog Short name=MACH FADD-homologous ICE/CED-3-like protease FADD-like ICE Short name=FLICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 Cleaved into the following 2 chains: 1- Recommended name: Caspase-8 subunit p18 2- Recommended name: Caspase-8 subunit p10 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 479 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Most upstream protease of the activation cascade of caspases responsible for the TNFRSF6/FAS mediated and TNFRSF1A induced cell death. Binding to the adapter molecule FADD recruits it to either receptor. The resulting aggregate called death-inducing signaling complex (DISC) performs CASP8 proteolytic activation. The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases. Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC. Cleaves and activates CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10. May participate in the GZMB apoptotic pathways. Cleaves ADPRT. Hydrolyzes the small-molecule substrate, Ac-Asp-Glu-Val-Asp-|-AMC. Likely target for the cowpox virus CRMA death inhibitory protein. Isoforms 5, 6, 7 and 8 lack the catalytic site and may interfere with the pro-apoptotic activity of the complex. |
| Catalytic activity | Strict requirement for Asp at position P1 and has a preferred cleavage sequence of (Leu/Asp/Val)-Glu-Thr-Asp-|-(Gly/Ser/Ala). |
| Subunit structure | Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 18 kDa (p18) and a 10 kDa (p10) subunit. Interacts with FADD, CFLAR and PEA15. Isoform 9 interacts at the endoplasmic reticulum with a complex containing BCAP31, BAP29, BCL2 and/or BCL2L1. Interacts with TNFAIP8L2 By similarity. |
| Subcellular location | |
| Tissue specificity | Isoforms 1, 5 and 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus, and liver. Barely detectable in brain, testis, and skeletal muscle. |
| Domain | Isoform 9 contains a N-terminal extension that is required for interaction with the BCAP31 complex. |
| Post-translational modification | Generation of the subunits requires association with the death-inducing signaling complex (DISC), whereas additional processing is likely due to the autocatalytic activity of the activated protease. GZMB and CASP10 can be involved in these processing events. Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Polymorphism | Genetic vaiations in CASP8 are associated with reduced risk of lung cancer [MIM:211980] in a population of Han Chinese subjects. Genetic vaiations are also associated with decreased risk of cancer of various other forms including esophageal, gastric, colorectal, cervical, and breast, acting in an allele dose-dependent manner. |
| Involvement in disease | Defects in CASP8 are the cause of caspase-8 deficiency (CASP8D) [MIM:607271]. CASP8D is a disorder resembling autoimmune lymphoproliferative syndrome (ALPS). It is characterized by lymphadenopathy, splenomegaly, and defective CD95-induced apoptosis of peripheral blood lymphocytes (PBLs). It leads to defects in activation of T-lymphocytes, B-lymphocytes, and natural killer cells leading to immunodeficiency characterized by recurrent sinopulmonary and herpes simplex virus infections and poor responses to immunization. |
| Sequence similarities | Belongs to the peptidase C14 family. Contains 2 DED (death effector) domains. |
| Sequence caution | The sequence CAA66858.1 differs from that shown. Reason: Miscellaneous discrepancy. The sequence CAA66859.1 differs from that shown. Reason: Miscellaneous discrepancy. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 2 | EBI-78060,EBI-78060 | ||
| BCAP31 | P51572 | 1 | EBI-288343,EBI-77683 | |
| BCAP31 | P51572 | 1 | EBI-78060,EBI-77683 | |
| BCL2 | Q9JJV8 | 1 | EBI-78060,EBI-1749099 | From a different organism. |
| CASP10 | Q92851 | 2 | EBI-78060,EBI-495095 | |
| ced-4 | P30429 | 1 | EBI-78060,EBI-494118 | From a different organism. |
| EDA2R | Q9HAV5 | 1 | EBI-288343,EBI-526033 | |
| FADD | Q13158 | 3 | EBI-78060,EBI-494804 | |
| FADD | Q13158 | 1 | EBI-288326,EBI-494804 | |
| FAS | P25445 | 3 | EBI-78060,EBI-494743 | |
| ILK | Q13418 | 1 | EBI-78060,EBI-747644 | |
| NOL3 | O60936 | 3 | EBI-78060,EBI-740992 | |
| P35 | P08160 | 1 | EBI-78060,EBI-1030934 | From a different organism. |
| RIPK1 | Q13546 | 1 | EBI-78060,EBI-358507 | |
| Tnfaip8l2 | Q9D8Y7 | 1 | EBI-78060,EBI-1781612 | From a different organism. |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q14790-1) Also known as: Alpha-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q14790-2) Also known as: Alpha-2; MCH5-beta; The sequence of this isoform differs from the canonical sequence as follows: 184-198: Missing. | ||||||
| Isoform 3 (identifier: Q14790-3) Also known as: Alpha-3; The sequence of this isoform differs from the canonical sequence as follows: 184-267: Missing. | ||||||
| Isoform 4 (identifier: Q14790-4) Also known as: Alpha-4; The sequence of this isoform differs from the canonical sequence as follows: 102-102: R → RFHFCRMSWAEANSQCQTQSVPFWRRVDHLLIR 184-198: Missing. | ||||||
| Isoform 5 (identifier: Q14790-5) Also known as: Beta-1; The sequence of this isoform differs from the canonical sequence as follows: 199-235: GEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGY → DFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH 236-479: Missing. | ||||||
| Isoform 6 (identifier: Q14790-6) Also known as: Beta-2; The sequence of this isoform differs from the canonical sequence as follows: 184-220: ERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQ → DFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH 221-479: Missing. | ||||||
| Isoform 7 (identifier: Q14790-7) Also known as: Beta-3; 8L; The sequence of this isoform differs from the canonical sequence as follows: 269-276: ALTTTFEE → TVEPKREK 277-479: Missing. | ||||||
| Notes: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 8 (identifier: Q14790-8) Also known as: Beta-4; The sequence of this isoform differs from the canonical sequence as follows: 184-198: Missing. 269-276: ALTTTFEE → TVEPKREK 277-479: Missing. | ||||||
| Isoform 9 (identifier: Q14790-9) Also known as: 8L; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MEGGRRARVVIESRRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADYILLPFKKM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Propeptide | 1 – 216 | 216 | PRO_0000004628 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 217 – 374 | 158 | Caspase-8 subunit p18 | PRO_0000004629 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | 375 – 384 | 10 | PRO_0000004630 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 385 – 479 | 95 | Caspase-8 subunit p10 | PRO_0000004631 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2 – 80 | 79 | DED 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 100 – 177 | 78 | DED 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 317 | 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 360 | 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 188 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 219 | 1 | Phosphoserine | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 334 | 1 | Phosphotyrosine | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MEGGRRARVVIESRRNFFLG AFPTPFPAEHVELGRLGDSE TAMVPGKGGADYILLPFKKM in isoform 9. | VSP_000808 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 102 | 1 | R → RFHFCRMSWAEANSQCQTQS VPFWRRVDHLLIR in isoform 4. | VSP_000809 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 184 – 267 | 84 | Missing in isoform 3. | VSP_000813 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 184 – 220 | 37 | ERSSS…DSESQ → DFGQSLPNEKQTSGILSDHQ QSQFCKSTGESAQTSQH in isoform 6. | VSP_000811 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 184 – 198 | 15 | Missing in isoform 2, isoform 4 and isoform 8. | VSP_000810 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 199 – 235 | 37 | GEELC…KPRGY → DFGQSLPNEKQTSGILSDHQ QSQFCKSTGESAQTSQH in isoform 5. | VSP_000814 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 221 – 479 | 259 | Missing in isoform 6. | VSP_000812 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 236 – 479 | 244 | Missing in isoform 5. | VSP_000815 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 269 – 276 | 8 | ALTTTFEE → TVEPKREK in isoform 7 and isoform 8. | VSP_000816 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 277 – 479 | 203 | Missing in isoform 7 and isoform 8. | VSP_000817 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 219 | 1 | S → T: dbSNP rs35976359. | VAR_025816 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 248 | 1 | R → W in CASP8D. dbSNP rs17860424. | VAR_014204 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 285 | 1 | D → H: dbSNP rs1045485. | VAR_020127 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 73 | 1 | D → A: Abolishes binding to FLASH. Induces NF-kappa-B activation | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 294 | 1 | E → D in AAD24962. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 331 | 1 | A → P Ref.2 Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 343 – 344 | 2 | LK → FG in AAL87631. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 235 – 240 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 245 – 250 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 254 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 263 – 276 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 280 – 286 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 289 – 301 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 310 – 316 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 322 – 324 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 330 – 332 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 337 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 338 – 340 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 342 – 344 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 346 – 348 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 353 – 359 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 361 – 364 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 368 – 371 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 391 – 394 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 398 – 405 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 412 – 414 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 415 – 417 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 420 – 432 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 433 – 435 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 439 – 452 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 456 – 459 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 465 – 468 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||

Clusters with