Q14790 (CASP8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 151.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Caspase-8 Short name=CASP-8 EC=3.4.22.61 Alternative name(s): Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE Short name=FLICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog Short name=MACH Cleaved into the following 2 chains: | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 479 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Most upstream protease of the activation cascade of caspases responsible for the TNFRSF6/FAS mediated and TNFRSF1A induced cell death. Binding to the adapter molecule FADD recruits it to either receptor. The resulting aggregate called death-inducing signaling complex (DISC) performs CASP8 proteolytic activation. The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases. Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC. Cleaves and activates CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10. May participate in the GZMB apoptotic pathways. Cleaves ADPRT. Hydrolyzes the small-molecule substrate, Ac-Asp-Glu-Val-Asp-|-AMC. Likely target for the cowpox virus CRMA death inhibitory protein. Isoform 5, isoform 6, isoform 7 and isoform 8 lack the catalytic site and may interfere with the pro-apoptotic activity of the complex. Ref.7 Ref.13 |
| Catalytic activity | Strict requirement for Asp at position P1 and has a preferred cleavage sequence of (Leu/Asp/Val)-Glu-Thr-Asp-|-(Gly/Ser/Ala). |
| Subunit structure | Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 18 kDa (p18) and a 10 kDa (p10) subunit. Interacts with FADD, CFLAR and PEA15. Isoform 9 interacts at the endoplasmic reticulum with a complex containing BCAP31, BAP29, BCL2 and/or BCL2L1. Interacts with TNFAIP8L2 By similarity. Ref.8 Ref.16 Ref.17 Ref.24 |
| Subcellular location | |
| Tissue specificity | Isoform 1, isoform 5 and isoform 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus and liver. Barely detectable in brain, testis and skeletal muscle. |
| Domain | Isoform 9 contains a N-terminal extension that is required for interaction with the BCAP31 complex. |
| Post-translational modification | Generation of the subunits requires association with the death-inducing signaling complex (DISC), whereas additional processing is likely due to the autocatalytic activity of the activated protease. GZMB and CASP10 can be involved in these processing events. Phosphorylated upon DNA damage, probably by ATM or ATR. Phosphorylation on Ser-387 during mitosis by CDK1 inhibits activation by proteolysis and prevents apoptosis. This phosphorylation occurs in cancer cell lines, as well as in primary breast tissues and lymphocytes. Ref.19 Ref.21 Ref.22 |
| Polymorphism | Genetic variations in CASP8 are associated with reduced risk of lung cancer [MIM:211980] in a population of Han Chinese subjects. Genetic variations are also associated with decreased risk of cancer of various other forms including esophageal, gastric, colorectal, cervical, and breast, acting in an allele dose-dependent manner. |
| Involvement in disease | Defects in CASP8 are the cause of caspase-8 deficiency (CASP8D) [MIM:607271]. CASP8D is a disorder resembling autoimmune lymphoproliferative syndrome (ALPS). It is characterized by lymphadenopathy, splenomegaly, and defective CD95-induced apoptosis of peripheral blood lymphocytes (PBLs). It leads to defects in activation of T-lymphocytes, B-lymphocytes, and natural killer cells leading to immunodeficiency characterized by recurrent sinopulmonary and herpes simplex virus infections and poor responses to immunization. Ref.25 |
| Sequence similarities | Belongs to the peptidase C14A family. Contains 2 DED (death effector) domains. |
| Sequence caution | The sequence CAA66858.1 differs from that shown. Reason: The sequence CAA66859.1 differs from that shown. Reason: |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 3 | EBI-78060,EBI-78060 | ||
| BCAP31 | P51572 | 3 | EBI-78060,EBI-77683 | |
| CASP10 | Q92851 | 5 | EBI-78060,EBI-495095 | |
| CUL3 | Q13618 | 6 | EBI-78060,EBI-456129 | |
| FADD | Q13158 | 25 | EBI-78060,EBI-494804 | |
| FAS | P25445 | 10 | EBI-78060,EBI-494743 | |
| ILK | Q13418 | 2 | EBI-78060,EBI-747644 | |
| NOL3 | O60936 | 3 | EBI-78060,EBI-740992 | |
| RIPK1 | Q13546 | 21 | EBI-78060,EBI-358507 | |
| TNFRSF10A | O00220 | 7 | EBI-78060,EBI-518861 |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: Q14790-1) Also known as: Alpha-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: Q14790-2) Also known as: Alpha-2; MCH5-beta; The sequence of this isoform differs from the canonical sequence as follows: 184-198: Missing. | |||||||||
| Isoform 3 (identifier: Q14790-3) Also known as: Alpha-3; The sequence of this isoform differs from the canonical sequence as follows: 184-267: Missing. | |||||||||
| Isoform 4 (identifier: Q14790-4) Also known as: Alpha-4; The sequence of this isoform differs from the canonical sequence as follows: 102-102: R → RFHFCRMSWAEANSQCQTQSVPFWRRVDHLLIR 184-198: Missing. | |||||||||
| Isoform 5 (identifier: Q14790-5) Also known as: Beta-1; The sequence of this isoform differs from the canonical sequence as follows: 199-235: GEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGY → DFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH 236-479: Missing. | |||||||||
| Isoform 6 (identifier: Q14790-6) Also known as: Beta-2; The sequence of this isoform differs from the canonical sequence as follows: 184-220: ERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQ → DFGQSLPNEKQTSGILSDHQQSQFCKSTGESAQTSQH 221-479: Missing. | |||||||||
| Isoform 7 (identifier: Q14790-7) Also known as: Beta-3; 8L; The sequence of this isoform differs from the canonical sequence as follows: 269-276: ALTTTFEE → TVEPKREK 277-479: Missing. | |||||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | |||||||||
| Isoform 8 (identifier: Q14790-8) Also known as: Beta-4; The sequence of this isoform differs from the canonical sequence as follows: 184-198: Missing. 269-276: ALTTTFEE → TVEPKREK 277-479: Missing. | |||||||||
| Isoform 9 (identifier: Q14790-9) Also known as: 8L; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADYILLPFKKM | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 14 | 1 | K → R in AAL87628. Ref.8 | ||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Propeptide | 1 – 216 | 216 | PRO_0000004628 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 217 – 374 | 158 | Caspase-8 subunit p18 | PRO_0000004629 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | 375 – 384 | 10 | PRO_0000004630 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 385 – 479 | 95 | Caspase-8 subunit p10 | PRO_0000004631 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 2 – 80 | 79 | DED 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 100 – 177 | 78 | DED 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 317 | 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 360 | 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 188 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 219 | 1 | Phosphoserine Ref.21 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 334 | 1 | Phosphotyrosine Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 387 | 1 | Phosphoserine; by CDK1 Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MEGGRRARVVIESKRNFFLG AFPTPFPAEHVELGRLGDSE TAMVPGKGGADYILLPFKKM in isoform 9. | VSP_000808 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 102 | 1 | R → RFHFCRMSWAEANSQCQTQS VPFWRRVDHLLIR in isoform 4. | VSP_000809 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 184 – 267 | 84 | Missing in isoform 3. | VSP_000813 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 184 – 220 | 37 | ERSSS…DSESQ → DFGQSLPNEKQTSGILSDHQ QSQFCKSTGESAQTSQH in isoform 6. | VSP_000811 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 184 – 198 | 15 | Missing in isoform 2, isoform 4 and isoform 8. | VSP_000810 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 199 – 235 | 37 | GEELC…KPRGY → DFGQSLPNEKQTSGILSDHQ QSQFCKSTGESAQTSQH in isoform 5. | VSP_000814 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 221 – 479 | 259 | Missing in isoform 6. | VSP_000812 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 236 – 479 | 244 | Missing in isoform 5. | VSP_000815 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 269 – 276 | 8 | ALTTTFEE → TVEPKREK in isoform 7 and isoform 8. | VSP_000816 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 277 – 479 | 203 | Missing in isoform 7 and isoform 8. | VSP_000817 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 219 | 1 | S → T. Ref.9 Corresponds to variant rs35976359 [ dbSNP | Ensembl ]. | VAR_025816 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 248 | 1 | R → W in CASP8D. Ref.25 Corresponds to variant rs17860424 [ dbSNP | Ensembl ]. | VAR_014204 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 285 | 1 | D → H Associated with protection against breast cancer; also associated with a lower risk of cutaneous melanoma. Ref.3 Ref.4 Ref.6 Ref.9 Ref.26 Ref.27 Ref.30 Corresponds to variant rs1045485 [ dbSNP | Ensembl ]. | VAR_020127 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 73 | 1 | D → A: Abolishes binding to FLASH. Induces NF-kappa-B activation. Ref.20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 387 | 1 | S → A: Impaired CDK1-mediated phosphorylation and enhanced apoptosis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 294 | 1 | E → D in AAD24962. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 331 | 1 | A → P in AAC50602. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 331 | 1 | A → P in AAD24962. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 343 – 344 | 2 | LK → FG in AAL87631. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 235 – 240 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 245 – 250 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 254 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 263 – 276 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 280 – 286 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 289 – 301 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 310 – 316 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 322 – 324 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 330 – 332 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 337 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 338 – 340 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 342 – 344 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 346 – 348 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 353 – 359 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 361 – 364 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 368 – 371 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 391 – 394 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 398 – 405 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 412 – 414 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 415 – 417 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 420 – 432 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 433 – 435 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 439 – 452 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 456 – 459 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 465 – 468 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death." Boldin M.P., Goncharov T.M., Goltsev Y.V., Wallach D. Cell 85:803-815(1996) [PubMed: 8681376] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 5; 6; 7 AND 8). Tissue: B-cell and Thymus. |
| [2] | "FLICE, a novel FADD-homologous ICE/CED-3-like protease, is recruited to the CD95 (Fas/APO-1) death-inducing signaling complex." Muzio M., Chinnaiyan A.M., Kischkel F.C., O'Rourke K., Shevchenko A., Ni J., Scaffidi C., Bretz J.D., Zhang M., Gentz R., Mann M., Krammer P.H., Peter M.E., Dixit V.M. Cell 85:817-827(1996) [PubMed: 8681377] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE. |
| [3] | "In vitro activation of CPP32 and Mch3 by Mch4, a novel human apoptotic cysteine protease containing two FADD-like domains." Fernandes-Alnemri T., Armstrong R.C., Krebs J.F., Srinivasula S.M., Wang L., Bullrich F., Fritz L.C., Trapani J.A., Tomaselli K.J., Litwack G., Alnemri E.S. Proc. Natl. Acad. Sci. U.S.A. 93:7464-7469(1996) [PubMed: 8755496] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), VARIANT HIS-285. Tissue: T-cell. |
| [4] | "FLAME-1, a novel FADD-like anti-apoptotic molecule that regulates Fas/TNFR1-induced apoptosis." Srinivasula S.M., Ahmad M., Ottilie S., Bullrich F., Banks S., Wang Y., Fernandes-Alnemri T., Croce C.M., Litwack G., Tomaselli K.J., Armstrong R.C., Alnemri E.S. J. Biol. Chem. 272:18542-18545(1997) [PubMed: 9228018] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT HIS-285. |
| [5] | "Structure and chromosome localization of the human CASP8 gene." Grenet J., Teitz T., Wei T., Valentine V., Kidd V.J. Gene 226:225-232(1999) [PubMed: 9931493] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [6] | "Cloning and characterization of three novel genes, ALS2CR1, ALS2CR2, and ALS2CR3, in the juvenile amyotrophic lateral sclerosis (ALS2) critical region at chromosome 2q33-q34: candidate genes for ALS2." Hadano S., Yanagisawa Y., Skaug J., Fichter K., Nasir J., Martindale D., Koop B.F., Scherer S.W., Nicholson D.W., Rouleau G.A., Ikeda J.-E., Hayden M.R. Genomics 71:200-213(2001) [PubMed: 11161814] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT HIS-285. |
| [7] | "Characterization of caspase-8L: a novel isoform of caspase-8 that behaves as an inhibitor of the caspase cascade." Himeji D., Horiuchi T., Tsukamoto H., Hayashi K., Watanabe T., Harada M. Blood 99:4070-4078(2002) [PubMed: 12010809] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), FUNCTION (ISOFORM 7). Tissue: Leukocyte. |
| [8] | "The procaspase-8 isoform, procaspase-8L, recruited to the BAP31 complex at the endoplasmic reticulum." Breckenridge D.G., Nguyen M., Kuppig S., Reth M., Shore G.C. Proc. Natl. Acad. Sci. U.S.A. 99:4331-4336(2002) [PubMed: 11917123] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 9), INTERACTION OF ISOFORM 9 WITH BCAP31 AT THE ENDOPLASMIC RETICULUM. |
| [9] | NIEHS SNPs program Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS THR-219 AND HIS-285. |
| [10] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7). Tissue: Leukocyte. |
| [12] | "Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases." Srinivasula S.M., Ahmad M., Fernandes-Alnemri T., Litwack G., Alnemri E.S. Proc. Natl. Acad. Sci. U.S.A. 93:14486-14491(1996) [PubMed: 8962078] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, PROTEOLYTIC PROCESSING. |
| [13] | "FLICE induced apoptosis in a cell-free system. Cleavage of caspase zymogens." Muzio M., Salvesen G.S., Dixit V.M. J. Biol. Chem. 272:2952-2956(1997) [PubMed: 9006941] [Abstract] Cited for: FUNCTION. |
| [14] | "FLICE is activated by association with the CD95 death-inducing signaling complex (DISC)." Medema J.P., Scaffidi C., Kischkel F.C., Shevchenko A., Mann M., Krammer P.H., Peter M.E. EMBO J. 16:2794-2804(1997) [PubMed: 9184224] [Abstract] Cited for: PROTEOLYTIC PROCESSING. |
| [15] | "Dominant expression of a novel splice variant of caspase-8 in human peripheral blood lymphocytes." Horiuchi T., Himeji D., Tsukamoto H., Harashima S., Hashimura C., Hayashi K. Biochem. Biophys. Res. Commun. 272:877-881(2000) [PubMed: 10860845] [Abstract] Cited for: CHARACTERIZATION (ISOFORM 7). |
| [16] | "p28 Bap31, a Bcl-2/Bcl-XL- and procaspase-8-associated protein in the endoplasmic reticulum." Ng F.W.H., Nguyen M., Kwan T., Branton P.E., Nicholson D.W., Cromlish J.A., Shore G.C. J. Cell Biol. 139:327-338(1997) [PubMed: 9334338] [Abstract] Cited for: INTERACTION WITH BCL2; BCL2L1 AND BCAP31. |
| [17] | "PED/PEA-15: an anti-apoptotic molecule that regulates FAS/TNFR1-induced apoptosis." Condorelli G., Vigliotta G., Cafieri A., Trencia A., Andalo P., Oriente F., Miele C., Caruso M., Formisano P., Beguinot F. Oncogene 18:4409-4415(1999) [PubMed: 10442631] [Abstract] Cited for: INTERACTION WITH PEA15. |
| [18] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [19] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-334, MASS SPECTROMETRY. |
| [20] | "Role of FLASH in caspase-8-mediated activation of NF-kappaB: dominant-negative function of FLASH mutant in NF-kappaB signaling pathway." Jun J.-I., Chung C.-W., Lee H.-J., Pyo J.-O., Lee K.N., Kim N.-S., Kim Y.S., Yoo H.-S., Lee T.-H., Kim E., Jung Y.-K. Oncogene 24:688-696(2005) [PubMed: 15592525] [Abstract] Cited for: MUTAGENESIS OF ASP-73. |
| [21] | "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage." Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J. Science 316:1160-1166(2007) [PubMed: 17525332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-219, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [22] | "Cdk1/cyclin B1 controls Fas-mediated apoptosis by regulating caspase-8 activity." Matthess Y., Raab M., Sanhaji M., Lavrik I.N., Strebhardt K. Mol. Cell. Biol. 30:5726-5740(2010) [PubMed: 20937773] [Abstract] Cited for: PHOSPHORYLATION AT SER-387 BY CDK1. |
| [23] | "The three-dimensional structure of caspase-8: an initiator enzyme in apoptosis." Blanchard H., Kodandapani L., Mittl P.R.E., Di Marco S., Krebs J.F., Wu J.C., Tomaselli K.J., Gruetter M.G. Structure 7:1125-1133(1999) [PubMed: 10508784] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS). |
| [24] | "The atomic-resolution structure of human caspase-8, a key activator of apoptosis." Watt W., Koeplinger K.A., Mildner A.M., Heinrikson R.L., Tomasselli A.G., Watenpaugh K.D. Structure 7:1135-1143(1999) [PubMed: 10508785] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.2 ANGSTROMS) OF 211-479, SUBUNIT. |
| [25] | "Pleiotropic defects in lymphocyte activation caused by caspase-8 mutations lead to human immunodeficiency." Chun H.J., Zheng L., Ahmad M., Wang J., Speirs C.K., Siegel R.M., Dale J.K., Puck J., Davis J., Hall C.G., Skoda-Smith S., Atkinson T.P., Straus S.E., Lenardo M.J. Nature 419:395-399(2002) [PubMed: 12353035] [Abstract] Cited for: VARIANT CASP8D TRP-248. |
| [26] | "Association of a common variant of the CASP8 gene with reduced risk of breast cancer." MacPherson G., Healey C.S., Teare M.D., Balasubramanian S.P., Reed M.W.R., Pharoah P.D., Ponder B.A.J., Meuth M., Bhattacharyya N.P., Cox A. J. Natl. Cancer Inst. 96:1866-1869(2004) [PubMed: 15601643] [Abstract] Cited for: VARIANT HIS-285, PROTECTION AGAINST BREAST CANCER. |
| [27] | "A common coding variant in CASP8 is associated with breast cancer risk." The Kathleen Cunningham foundation consortium for research into familial breast cancer, Breast cancer association consortium Cox A., Dunning A.M., Garcia-Closas M., Balasubramanian S., Reed M.W.R., Pooley K.A., Scollen S., Baynes C., Ponder B.A.J., Chanock S., Lissowska J., Brinton L., Peplonska B., Southey M.C., Hopper J.L., McCredie M.R.E., Giles G.G., Fletcher O. Easton D.F.Nat. Genet. 39:352-358(2007) [PubMed: 17293864] [Abstract] Cited for: VARIANT HIS-285, PROTECTION AGAINST BREAST CANCER. |
| [28] | Erratum The Kathleen Cunningham foundation consortium for research into familial breast cancer, Breast cancer association consortium Cox A., Dunning A.M., Garcia-Closas M., Balasubramanian S., Reed M.W.R., Pooley K.A., Scollen S., Baynes C., Ponder B.A.J., Chanock S., Lissowska J., Brinton L., Peplonska B., Southey M.C., Hopper J.L., McCredie M.R.E., Giles G.G., Fletcher O. Easton D.F.Nat. Genet. 39:688-688(2007) |
| [29] | "A six-nucleotide insertion-deletion polymorphism in the CASP8 promoter is associated with susceptibility to multiple cancers." Sun T., Gao Y., Tan W., Ma S., Shi Y., Yao J., Guo Y., Yang M., Zhang X., Zhang Q., Zeng C., Lin D. Nat. Genet. 39:605-613(2007) [PubMed: 17450141] [Abstract] Cited for: INVOLVEMENT IN PROTECTION AGAINST LUNG CANCER. |
| [30] | "Genetic variants and haplotypes of the caspase-8 and caspase-10 genes contribute to susceptibility to cutaneous melanoma." Li C., Zhao H., Hu Z., Liu Z., Wang L.-E., Gershenwald J.E., Prieto V.G., Lee J.E., Duvic M., Grimm E.A., Wei Q. Hum. Mutat. 29:1443-1451(2008) [PubMed: 18563783] [Abstract] Cited for: VARIANT HIS-285, RISK FACTOR FOR CUTANEOUS MELANOMA. |
| + | Additional computationally mapped references. |
Web resources
| CASP8base CASP8 mutation db |
| GeneReviews |
| NIEHS-SNPs |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X98172 mRNA. Translation: CAA66853.1. X98173 mRNA. Translation: CAA66854.1. X98174 mRNA. Translation: CAA66855.1. X98175 mRNA. Translation: CAA66856.1. X98176 mRNA. Translation: CAA66857.1. X98177 mRNA. Translation: CAA66858.1. Sequence problems. X98178 mRNA. Translation: CAA66859.1. Sequence problems. U58143 mRNA. Translation: AAC50602.1. U60520 mRNA. Translation: AAC50645.1. AF009620 mRNA. Translation: AAB70913.1. AF102146 AF102145 Genomic DNA. Translation: AAD24962.1.AB038985 Genomic DNA. Translation: BAB32555.1. AF380342 mRNA. Translation: AAK57437.1. AF422925 mRNA. Translation: AAL87628.1. AF422926 mRNA. Translation: AAL87629.1. AF422927 mRNA. Translation: AAL87630.1. AF422928 mRNA. Translation: AAL87631.1. AF422929 mRNA. Translation: AAL87632.1. DQ355026 Genomic DNA. Translation: ABC67468.1. AC007256 Genomic DNA. Translation: AAY24225.1. BC028223 mRNA. No translation available. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00000149. IPI00073318. IPI00220721. IPI00220722. IPI00220723. IPI00220724. IPI00220725. IPI00220726. IPI00305242. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001073593.1. NM_001080124.1. NP_001073594.1. NM_001080125.1. NP_001219.2. NM_001228.4. NP_203519.1. NM_033355.3. NP_203520.1. NM_033356.3. NP_203522.1. NM_033358.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.599762. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | Q14790. Positions 2-182, 222-479. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-30915N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q14790. 58 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-91645. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MEROPS | C14.009. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 2493531. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000303385; ENSP00000307131; ENSG00000064012. ENST00000358485; ENSP00000351273; ENSG00000064012. ENST00000432109; ENSP00000412523; ENSG00000064012. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 841. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:841. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002uxo.1. human. uc002uxp.1. human. uc002uxq.1. human. uc002uxr.1. human. uc002uxs.1. human. uc002uxv.1. human. uc002uxy.1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 841. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC02P202062. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0002736. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:1509. CASP8. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB002047. HPA001302. HPA005688. HPA008936. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 211980. phenotype. 601763. gene. 607271. phenotype. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 3261. Autoimmune lymphoproliferative syndrome. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA26092. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG05678. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00560000076782. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG050803. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 3.4.22.61. 2681. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | caspase_pathway. Caspase cascade in apoptosis. ceramidepathway. Ceramide signaling pathway. ar_pathway. Coregulation of Androgen receptor activity. faspathway. FAS signaling pathway (CD95). hivnefpathway. HIV-1 Nef: Negative effector of Fas and TNF-alpha. avb3_integrin_pathway. Integrins in angiogenesis. tnfpathway. TNF receptor signaling pathway. trail_pathway. TRAIL signaling pathway. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_578. Apoptosis. REACT_6900. Immune System. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000064012. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR011029. DEATH-like. IPR001875. DED. IPR011600. Pept_C14_cat. IPR001309. Pept_C14_ICE_p20. IPR016129. Pept_C14_ICE_p20_AS. IPR002138. Pept_C14_p10. IPR002398. Pept_C14_p45. IPR015917. Pept_C14_p45_core. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:1.10.533.10. DEATH_like. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K04398. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR10454. Pept_C14_p45. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF01335. DED. 2 hits. PF00656. Peptidase_C14. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR00376. IL1BCENZYME. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00115. CASc. 1 hit. SM00031. DED. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF47986. DEATH_like. 2 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS01122. CASPASE_CYS. 1 hit. PS01121. CASPASE_HIS. 1 hit. PS50207. CASPASE_P10. 1 hit. PS50208. CASPASE_P20. 1 hit. PS50168. DED. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 3510. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q14790. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | CASP8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14790 Secondary accession number(s): O14676 Q9UQ81 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with