SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14773

- ICAM4_HUMAN

UniProt

Q14773 - ICAM4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Intercellular adhesion molecule 4
Gene
ICAM4, LW
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.1 Publication

GO - Molecular functioni

  1. integrin binding Source: ProtInc

GO - Biological processi

  1. extracellular matrix organization Source: Reactome
  2. regulation of immune response Source: Reactome
  3. single organismal cell-cell adhesion Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Blood group antigen

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiREACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_13552. Integrin cell surface interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Intercellular adhesion molecule 4
Short name:
ICAM-4
Alternative name(s):
Landsteiner-Wiener blood group glycoprotein
Short name:
LW blood group protein
CD_antigen: CD242
Gene namesi
Name:ICAM4
Synonyms:LW
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:5347. ICAM4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini23 – 240218Extracellular Reviewed prediction
Add
BLAST
Transmembranei241 – 26121Helical; Reviewed prediction
Add
BLAST
Topological domaini262 – 27110Cytoplasmic Reviewed prediction

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
  2. integral component of membrane Source: ProtInc
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

MIMi111250. phenotype.
PharmGKBiPA29595.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222 Reviewed prediction
Add
BLAST
Chaini23 – 271249Intercellular adhesion molecule 4
PRO_0000014796Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi68 – 681N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi69 ↔ 117 By similarity
Glycosylationi78 – 781N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi153 ↔ 210 By similarity
Glycosylationi190 – 1901N-linked (GlcNAc...) Reviewed prediction
Glycosylationi223 – 2231N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

N- and O-glycosylated.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ14773.
PRIDEiQ14773.

Expressioni

Tissue specificityi

Erythrocytes.

Gene expression databases

BgeeiQ14773.
CleanExiHS_ICAM4.
GenevestigatoriQ14773.

Interactioni

Protein-protein interaction databases

BioGridi109613. 1 interaction.
IntActiQ14773. 2 interactions.
STRINGi9606.ENSP00000342114.

Structurei

3D structure databases

ProteinModelPortaliQ14773.
SMRiQ14773. Positions 47-227.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini62 – 12463Ig-like C2-type 1
Add
BLAST
Domaini146 – 21772Ig-like C2-type 2
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG47696.
HOGENOMiHOG000112993.
HOVERGENiHBG052076.
KOiK06581.
OMAiYVNTENE.
OrthoDBiEOG7B31NV.
PhylomeDBiQ14773.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR013783. Ig-like_fold.
[Graphical view]
PfamiPF03921. ICAM_N. 1 hit.
[Graphical view]
PRINTSiPR01472. ICAMVCAM1.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: Q14773-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGSLFPLSLL FFLAAAYPGV GSALGRRTKR AQSPKGSPLA PSGTSVPFWV    50
RMSPEFVAVQ PGKSVQLNCS NSCPQPQNSS LRTPLRQGKT LRGPGWVSYQ 100
LLDVRAWSSL AHCLVTCAGK TRWATSRITA YKPPHSVILE PPVLKGRKYT 150
LRCHVTQVFP VGYLVVTLRH GSRVIYSESL ERFTGLDLAN VTLTYEFAAG 200
PRDFWQPVIC HARLNLDGLV VRNSSAPITL MLAWSPAPTA LASGSIAALV 250
GILLTVGAAY LCKCLAMKSQ A 271
Length:271
Mass (Da):29,265
Last modified:November 1, 1997 - v1
Checksum:i2F6BC8BABD79E615
GO
Isoform Short (identifier: Q14773-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-271: AWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA → GEAPL

Show »
Length:237
Mass (Da):25,931
Checksum:iF74416D3FB52ADB2
GO
Isoform 3 (identifier: Q14773-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-271: KPPHSVILEP...CKCLAMKSQA → SVPGGLLGGD...QSGEMAIHGG

Show »
Length:272
Mass (Da):29,649
Checksum:i991DE1707703CA19
GO

Polymorphismi

Responsible for the Landsteiner-Wiener blood group system [MIMi:111250]. The molecular basis of the LW(A)=LW5/LW(B)=LW7 blood group antigens is a single variation in position 100; Gln-100 corresponds to LW(A) and Arg-100 to LW(B).

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti100 – 1001Q → R in LW(B). 1 Publication
Corresponds to variant rs77493670 [ dbSNP | Ensembl ].
VAR_003912
Natural varianti208 – 2081V → L.1 Publication
Corresponds to variant rs36023325 [ dbSNP | Ensembl ].
VAR_038721

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei132 – 271140KPPHS…MKSQA → SVPGGLLGGDPEAWKPGHLF RKPGALHRPGSGQRDLDLRV CCWTPRLLAARDLPRAPQSR RPGGPQQLGTHYTDARLEPR AHSFGLRFHRCPCRDPPHCG RCVPMQVPSYEVPGVKGDVL CRLSEKKRNMKQSGEMAIHG G in isoform 3.
VSP_043229Add
BLAST
Alternative sequencei233 – 27139AWSPA…MKSQA → GEAPL in isoform Short.
VSP_002519Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti14 – 2916AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59538. 1 Publication
Add
BLAST
Sequence conflicti14 – 2916AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59537. 1 Publication
Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L27671 mRNA. Translation: AAA59538.1.
L27670 mRNA. Translation: AAA59537.1.
X93093 Genomic DNA. Translation: CAA63646.1.
BT009816 mRNA. Translation: AAP88818.1.
DQ011692 Genomic DNA. Translation: AAY16986.1.
AC011511 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84089.1.
BC000046 mRNA. Translation: AAH00046.1.
BC029364 mRNA. Translation: AAH29364.1.
S78852 mRNA. Translation: AAB35046.1.
CCDSiCCDS12232.1. [Q14773-1]
CCDS32904.1. [Q14773-3]
CCDS42500.1. [Q14773-2]
PIRiI52612.
I59300.
I80159.
RefSeqiNP_001034221.1. NM_001039132.2. [Q14773-3]
NP_001535.1. NM_001544.4. [Q14773-1]
NP_071772.1. NM_022377.3. [Q14773-2]
UniGeneiHs.706750.

Genome annotation databases

EnsembliENST00000340992; ENSP00000342114; ENSG00000105371. [Q14773-3]
ENST00000380770; ENSP00000370147; ENSG00000105371. [Q14773-1]
ENST00000393717; ENSP00000377320; ENSG00000105371. [Q14773-2]
GeneIDi3386.
KEGGihsa:3386.
UCSCiuc002mnr.2. human. [Q14773-3]
uc002mns.2. human. [Q14773-1]
uc002mnt.2. human. [Q14773-2]

Polymorphism databases

DMDMi2497309.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

dbRBC/BGMUT

Blood group antigen gene mutation database

SeattleSNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L27671 mRNA. Translation: AAA59538.1 .
L27670 mRNA. Translation: AAA59537.1 .
X93093 Genomic DNA. Translation: CAA63646.1 .
BT009816 mRNA. Translation: AAP88818.1 .
DQ011692 Genomic DNA. Translation: AAY16986.1 .
AC011511 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84089.1 .
BC000046 mRNA. Translation: AAH00046.1 .
BC029364 mRNA. Translation: AAH29364.1 .
S78852 mRNA. Translation: AAB35046.1 .
CCDSi CCDS12232.1. [Q14773-1 ]
CCDS32904.1. [Q14773-3 ]
CCDS42500.1. [Q14773-2 ]
PIRi I52612.
I59300.
I80159.
RefSeqi NP_001034221.1. NM_001039132.2. [Q14773-3 ]
NP_001535.1. NM_001544.4. [Q14773-1 ]
NP_071772.1. NM_022377.3. [Q14773-2 ]
UniGenei Hs.706750.

3D structure databases

ProteinModelPortali Q14773.
SMRi Q14773. Positions 47-227.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109613. 1 interaction.
IntActi Q14773. 2 interactions.
STRINGi 9606.ENSP00000342114.

Polymorphism databases

DMDMi 2497309.

Proteomic databases

PaxDbi Q14773.
PRIDEi Q14773.

Protocols and materials databases

DNASUi 3386.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000340992 ; ENSP00000342114 ; ENSG00000105371 . [Q14773-3 ]
ENST00000380770 ; ENSP00000370147 ; ENSG00000105371 . [Q14773-1 ]
ENST00000393717 ; ENSP00000377320 ; ENSG00000105371 . [Q14773-2 ]
GeneIDi 3386.
KEGGi hsa:3386.
UCSCi uc002mnr.2. human. [Q14773-3 ]
uc002mns.2. human. [Q14773-1 ]
uc002mnt.2. human. [Q14773-2 ]

Organism-specific databases

CTDi 3386.
GeneCardsi GC19P010397.
HGNCi HGNC:5347. ICAM4.
MIMi 111250. phenotype.
614088. gene.
neXtProti NX_Q14773.
PharmGKBi PA29595.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG47696.
HOGENOMi HOG000112993.
HOVERGENi HBG052076.
KOi K06581.
OMAi YVNTENE.
OrthoDBi EOG7B31NV.
PhylomeDBi Q14773.

Enzyme and pathway databases

Reactomei REACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
REACT_13552. Integrin cell surface interactions.

Miscellaneous databases

GenomeRNAii 3386.
NextBioi 13396.
PROi Q14773.
SOURCEi Search...

Gene expression databases

Bgeei Q14773.
CleanExi HS_ICAM4.
Genevestigatori Q14773.

Family and domain databases

Gene3Di 2.60.40.10. 2 hits.
InterProi IPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR013783. Ig-like_fold.
[Graphical view ]
Pfami PF03921. ICAM_N. 1 hit.
[Graphical view ]
PRINTSi PR01472. ICAMVCAM1.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The LW blood group glycoprotein is homologous to intercellular adhesion molecules."
    Bailly P., Hermand P., Callebaut I., Sonneborn H.H., Khamlichi S., Mornon J.-P., Cartron J.-P.
    Proc. Natl. Acad. Sci. U.S.A. 91:5306-5310(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT).
  2. "Characterization of the gene encoding the human LW blood group protein in LW+ and LW- phenotypes."
    Hermand P., le Pennec P.Y., Rouger P., Cartron J.-P., Bailly P.
    Blood 87:2962-2967(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM LONG).
  3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  4. SeattleSNPs variation discovery resource
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT LEU-208.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND 3).
    Tissue: Lung and Placenta.
  8. "Molecular basis and expression of the LWa/LWb blood group polymorphism."
    Hermand P., Gane P., Mattei M.-G., Sistonen P., Cartron J.-P., Bailly P.
    Blood 86:1590-1594(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-130, VARIANT BLOOD GROUP LW(B) ARG-100.
  9. "Intercellular adhesion molecule-4 binds alpha(4)beta(1) and alpha(V)-family integrins through novel integrin-binding mechanisms."
    Spring F.A., Parsons S.F., Ortlepp S., Olsson M.L., Sessions R., Brady R.L., Anstee D.J.
    Blood 98:458-466(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiICAM4_HUMAN
AccessioniPrimary (citable) accession number: Q14773
Secondary accession number(s): A0M8X2
, Q14771, Q14772, Q16375, Q9BWR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: September 3, 2014
This is version 133 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Blood group antigen proteins
    Nomenclature of blood group antigens and list of entries
  2. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi