Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Intercellular adhesion molecule 4

Gene

ICAM4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.1 Publication

GO - Molecular functioni

  • integrin binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Blood group antigen

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

BioCyciZFISH:ENSG00000105371-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-HSA-216083. Integrin cell surface interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Intercellular adhesion molecule 4
Short name:
ICAM-4
Alternative name(s):
Landsteiner-Wiener blood group glycoprotein
Short name:
LW blood group protein
CD_antigen: CD242
Gene namesi
Name:ICAM4
Synonyms:LW
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:5347. ICAM4.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini23 – 240ExtracellularSequence analysisAdd BLAST218
Transmembranei241 – 261HelicalSequence analysisAdd BLAST21
Topological domaini262 – 271CytoplasmicSequence analysis10

GO - Cellular componenti

  • extracellular region Source: UniProtKB-SubCell
  • integral component of membrane Source: ProtInc
  • integral component of plasma membrane Source: GO_Central
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi3386.
MIMi111250. phenotype.
OpenTargetsiENSG00000105371.
PharmGKBiPA29595.

Polymorphism and mutation databases

BioMutaiICAM4.
DMDMi2497309.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000001479623 – 271Intercellular adhesion molecule 4Add BLAST249

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi68N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi69 ↔ 117By similarity
Disulfide bondi69 ↔ 113PROSITE-ProRule annotationBy similarity
Disulfide bondi73 ↔ 117By similarity
Glycosylationi78N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi153 ↔ 210By similarity
Glycosylationi190N-linked (GlcNAc...)Sequence analysis1
Glycosylationi223N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

N- and O-glycosylated.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ14773.
PRIDEiQ14773.
TopDownProteomicsiQ14773-1. [Q14773-1]

Expressioni

Tissue specificityi

Erythrocytes.

Gene expression databases

BgeeiENSG00000105371.
CleanExiHS_ICAM4.
ExpressionAtlasiQ14773. baseline and differential.
GenevisibleiQ14773. HS.

Organism-specific databases

HPAiHPA067629.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KRT31Q153235EBI-10233928,EBI-948001
NOTCH2NLQ7Z3S95EBI-10233928,EBI-945833

GO - Molecular functioni

  • integrin binding Source: ProtInc

Protein-protein interaction databases

BioGridi109613. 5 interactors.
IntActiQ14773. 6 interactors.
STRINGi9606.ENSP00000342114.

Structurei

3D structure databases

ProteinModelPortaliQ14773.
SMRiQ14773.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini62 – 124Ig-like C2-type 1Add BLAST63
Domaini146 – 217Ig-like C2-type 2Add BLAST72

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ICAM family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410JBEM. Eukaryota.
ENOG4111651. LUCA.
GeneTreeiENSGT00530000063246.
HOGENOMiHOG000112993.
HOVERGENiHBG052076.
InParanoidiQ14773.
KOiK06581.
OMAiLRCHVTH.
PhylomeDBiQ14773.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
[Graphical view]
PfamiPF03921. ICAM_N. 1 hit.
[Graphical view]
PRINTSiPR01472. ICAMVCAM1.
SUPFAMiSSF48726. SSF48726. 2 hits.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: Q14773-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSLFPLSLL FFLAAAYPGV GSALGRRTKR AQSPKGSPLA PSGTSVPFWV
60 70 80 90 100
RMSPEFVAVQ PGKSVQLNCS NSCPQPQNSS LRTPLRQGKT LRGPGWVSYQ
110 120 130 140 150
LLDVRAWSSL AHCLVTCAGK TRWATSRITA YKPPHSVILE PPVLKGRKYT
160 170 180 190 200
LRCHVTQVFP VGYLVVTLRH GSRVIYSESL ERFTGLDLAN VTLTYEFAAG
210 220 230 240 250
PRDFWQPVIC HARLNLDGLV VRNSSAPITL MLAWSPAPTA LASGSIAALV
260 270
GILLTVGAAY LCKCLAMKSQ A
Length:271
Mass (Da):29,265
Last modified:November 1, 1997 - v1
Checksum:i2F6BC8BABD79E615
GO
Isoform Short (identifier: Q14773-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-271: AWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA → GEAPL

Show »
Length:237
Mass (Da):25,931
Checksum:iF74416D3FB52ADB2
GO
Isoform 3 (identifier: Q14773-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     132-271: KPPHSVILEP...CKCLAMKSQA → SVPGGLLGGD...QSGEMAIHGG

Show »
Length:272
Mass (Da):29,649
Checksum:i991DE1707703CA19
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14 – 29AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59538 (PubMed:8202485).CuratedAdd BLAST16
Sequence conflicti14 – 29AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59537 (PubMed:8202485).CuratedAdd BLAST16

Polymorphismi

Responsible for the Landsteiner-Wiener blood group system [MIMi:111250]. The molecular basis of the LW(A)=LW5/LW(B)=LW7 blood group antigens is a single variation in position 100; Gln-100 corresponds to LW(A) and Arg-100 to LW(B).1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_003912100Q → R in LW(B). 1 PublicationCorresponds to variant rs77493670dbSNPEnsembl.1
Natural variantiVAR_038721208V → L.1 PublicationCorresponds to variant rs36023325dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043229132 – 271KPPHS…MKSQA → SVPGGLLGGDPEAWKPGHLF RKPGALHRPGSGQRDLDLRV CCWTPRLLAARDLPRAPQSR RPGGPQQLGTHYTDARLEPR AHSFGLRFHRCPCRDPPHCG RCVPMQVPSYEVPGVKGDVL CRLSEKKRNMKQSGEMAIHG G in isoform 3. 2 PublicationsAdd BLAST140
Alternative sequenceiVSP_002519233 – 271AWSPA…MKSQA → GEAPL in isoform Short. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27671 mRNA. Translation: AAA59538.1.
L27670 mRNA. Translation: AAA59537.1.
X93093 Genomic DNA. Translation: CAA63646.1.
BT009816 mRNA. Translation: AAP88818.1.
DQ011692 Genomic DNA. Translation: AAY16986.1.
AC011511 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84089.1.
BC000046 mRNA. Translation: AAH00046.1.
BC029364 mRNA. Translation: AAH29364.1.
S78852 mRNA. Translation: AAB35046.1.
CCDSiCCDS12232.1. [Q14773-1]
CCDS32904.1. [Q14773-3]
PIRiI52612.
I59300.
I80159.
RefSeqiNP_001034221.1. NM_001039132.2. [Q14773-3]
NP_001535.1. NM_001544.4. [Q14773-1]
UniGeneiHs.706750.

Genome annotation databases

EnsembliENST00000340992; ENSP00000342114; ENSG00000105371. [Q14773-3]
ENST00000380770; ENSP00000370147; ENSG00000105371. [Q14773-1]
ENST00000393717; ENSP00000377320; ENSG00000105371. [Q14773-2]
GeneIDi3386.
KEGGihsa:3386.
UCSCiuc002mns.3. human. [Q14773-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

dbRBC/BGMUT

Blood group antigen gene mutation database

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27671 mRNA. Translation: AAA59538.1.
L27670 mRNA. Translation: AAA59537.1.
X93093 Genomic DNA. Translation: CAA63646.1.
BT009816 mRNA. Translation: AAP88818.1.
DQ011692 Genomic DNA. Translation: AAY16986.1.
AC011511 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84089.1.
BC000046 mRNA. Translation: AAH00046.1.
BC029364 mRNA. Translation: AAH29364.1.
S78852 mRNA. Translation: AAB35046.1.
CCDSiCCDS12232.1. [Q14773-1]
CCDS32904.1. [Q14773-3]
PIRiI52612.
I59300.
I80159.
RefSeqiNP_001034221.1. NM_001039132.2. [Q14773-3]
NP_001535.1. NM_001544.4. [Q14773-1]
UniGeneiHs.706750.

3D structure databases

ProteinModelPortaliQ14773.
SMRiQ14773.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109613. 5 interactors.
IntActiQ14773. 6 interactors.
STRINGi9606.ENSP00000342114.

Polymorphism and mutation databases

BioMutaiICAM4.
DMDMi2497309.

Proteomic databases

PaxDbiQ14773.
PRIDEiQ14773.
TopDownProteomicsiQ14773-1. [Q14773-1]

Protocols and materials databases

DNASUi3386.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000340992; ENSP00000342114; ENSG00000105371. [Q14773-3]
ENST00000380770; ENSP00000370147; ENSG00000105371. [Q14773-1]
ENST00000393717; ENSP00000377320; ENSG00000105371. [Q14773-2]
GeneIDi3386.
KEGGihsa:3386.
UCSCiuc002mns.3. human. [Q14773-1]

Organism-specific databases

CTDi3386.
DisGeNETi3386.
GeneCardsiICAM4.
HGNCiHGNC:5347. ICAM4.
HPAiHPA067629.
MIMi111250. phenotype.
614088. gene.
neXtProtiNX_Q14773.
OpenTargetsiENSG00000105371.
PharmGKBiPA29595.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JBEM. Eukaryota.
ENOG4111651. LUCA.
GeneTreeiENSGT00530000063246.
HOGENOMiHOG000112993.
HOVERGENiHBG052076.
InParanoidiQ14773.
KOiK06581.
OMAiLRCHVTH.
PhylomeDBiQ14773.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000105371-MONOMER.
ReactomeiR-HSA-198933. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
R-HSA-216083. Integrin cell surface interactions.

Miscellaneous databases

GenomeRNAii3386.
PROiQ14773.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000105371.
CleanExiHS_ICAM4.
ExpressionAtlasiQ14773. baseline and differential.
GenevisibleiQ14773. HS.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
[Graphical view]
PfamiPF03921. ICAM_N. 1 hit.
[Graphical view]
PRINTSiPR01472. ICAMVCAM1.
SUPFAMiSSF48726. SSF48726. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiICAM4_HUMAN
AccessioniPrimary (citable) accession number: Q14773
Secondary accession number(s): A0M8X2
, Q14771, Q14772, Q16375, Q9BWR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: November 30, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Blood group antigen proteins
    Nomenclature of blood group antigens and list of entries
  2. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.