Reviewed,
UniProtKB/Swiss-Prot Q14773 (ICAM4_HUMAN)
Last modified
January 19, 2010.
Version 95.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Intercellular adhesion molecule 4 Short name=ICAM-4 Alternative name(s): Landsteiner-Wiener blood group glycoprotein Short name=LW blood group protein CD_antigen=CD242 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 271 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins. Ref.6 |
| Subcellular location | Isoform Long: Cell membrane; Single-pass type I membrane protein. Isoform Short: Secreted. |
| Tissue specificity | Erythrocytes. |
| Post-translational modification | N- and O-glycosylated. |
| Polymorphism | Responsible for the Landsteiner-Wiener blood group system. The molecular basis of the LW(A)=LW5/LW(B)=LW7 blood group antigens is a single variation in position 100; Gln-100 corresponds to LW(A) and Arg-100 to LW(B). |
| Sequence similarities | Belongs to the immunoglobulin superfamily. ICAM family. Contains 2 Ig-like C2-type (immunoglobulin-like) domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane |
| Molecular function | Blood group antigen |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell-cell adhesion Inferred from electronic annotation. Source: InterPro |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-KW integral to membraneTraceable author statement. Source: ProtInc plasma membraneInferred from Experiment. Source: Reactome |
| Molecular function | integrin binding Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: Q14773-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: Q14773-2) The sequence of this isoform differs from the canonical sequence as follows: 233-271: AWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA → GEAPL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | ||||||||
| Chain | 23 – 271 | 249 | Intercellular adhesion molecule 4 | PRO_0000014796 | |||||||
Regions | |||||||||||
| Topological domain | 23 – 240 | 218 | Extracellular Potential | ||||||||
| Transmembrane | 241 – 261 | 21 | Potential | ||||||||
| Topological domain | 262 – 271 | 10 | Cytoplasmic Potential | ||||||||
| Domain | 62 – 124 | 63 | Ig-like C2-type 1 | ||||||||
| Domain | 146 – 217 | 72 | Ig-like C2-type 2 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 68 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 78 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 190 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 223 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 69 ↔ 117 | By similarity | |||||||||
| Disulfide bond | 153 ↔ 210 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 233 – 271 | 39 | AWSPA…MKSQA → GEAPL in isoform Short. | VSP_002519 | |||||||
| Natural variant | 100 | 1 | Q → R in LW(B). Ref.5 | VAR_003912 | |||||||
| Natural variant | 208 | 1 | V → L | VAR_038721 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 14 – 29 | 16 | AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59538. Ref.1 | ||||||||
| Sequence conflict | 14 – 29 | 16 | AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59537. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The LW blood group glycoprotein is homologous to intercellular adhesion molecules." Bailly P., Hermand P., Callebaut I., Sonneborn H.H., Khamlichi S., Mornon J.-P., Cartron J.-P. Proc. Natl. Acad. Sci. U.S.A. 91:5306-5310(1994) [PubMed: 8202485] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT). |
| [2] | "Characterization of the gene encoding the human LW blood group protein in LW+ and LW- phenotypes." Hermand P., le Pennec P.Y., Rouger P., Cartron J.-P., Bailly P. Blood 87:2962-2967(1996) [PubMed: 8639917] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM LONG). |
| [3] | SeattleSNPs variation discovery resource Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT LEU-208. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG). Tissue: Lung. |
| [5] | "Molecular basis and expression of the LWa/LWb blood group polymorphism." Hermand P., Gane P., Mattei M.-G., Sistonen P., Cartron J.-P., Bailly P. Blood 86:1590-1594(1995) [PubMed: 7632968] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-130, VARIANT BLOOD GROUP LW(B) ARG-100. |
| [6] | "Intercellular adhesion molecule-4 binds alpha(4)beta(1) and alpha(V)-family integrins through novel integrin-binding mechanisms." Spring F.A., Parsons S.F., Ortlepp S., Olsson M.L., Sessions R., Brady R.L., Anstee D.J. Blood 98:458-466(2001) [PubMed: 11435317] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L27671 mRNA. Translation: AAA59538.1. L27670 mRNA. Translation: AAA59537.1. X93093 Genomic DNA. Translation: CAA63646.1. DQ011692 Genomic DNA. Translation: AAY16986.1. BC029364 mRNA. Translation: AAH29364.1. S78852 mRNA. Translation: AAB35046.1. |
| IPI | IPI00000118. IPI00396335. |
| PIR | I52612. I59300. I80159. |
| RefSeq | NP_001034221.1. NP_001535.1. NP_071772.1. |
| UniGene | Hs.706750 |
3D structure databases | |
| SMR | Q14773. Positions 47-132. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q14773. |
Proteomic databases | |
| PRIDE | Q14773. |
Genome annotation databases | |
| Ensembl | ENST00000380770; ENSP00000370147; ENSG00000105371; Homo sapiens. [Genome view] |
| GeneID | 3386. |
| KEGG | hsa:3386. |
| UCSC | uc002mns.1. human. uc002mnt.1. human. |
Organism-specific databases | |
| CTD | 3386. |
| GeneCards | GC19P010258. |
| H-InvDB | HIX0014739. |
| HGNC | HGNC:5347. ICAM4. |
| MIM | 111250. gene+phenotype. |
| PharmGKB | PA29595. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG20381. |
| HOVERGEN | Q14773. |
| OMA | VIYSESL. |
| PhylomeDB | Q14773. |
Enzyme and pathway databases | |
| Reactome | REACT_13552. Integrin cell surface interactions. REACT_6900. Signaling in Immune system. |
Gene expression databases | |
| ArrayExpress | Q14773. |
| Bgee | Q14773. |
| CleanEx | HS_ICAM4. |
| Genevestigator | Q14773. |
| GermOnline | ENSG00000105371. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013768. ICAM_N. IPR003987. ICAM_VCAM_N. IPR013783. Ig-like_fold. [Graphical view] |
| Gene3D | G3DSA:2.60.40.10. Ig-like_fold. 2 hits. |
| Pfam | PF03921. ICAM_N. 1 hit. [Graphical view] |
| PRINTS | PR01472. ICAMVCAM1. |
| PROSITE | PS50835. IG_LIKE. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 13396. |
| SOURCE | Search... |
Entry information
| Entry name | ICAM4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14773 Secondary accession number(s): A0M8X2 Q16375 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Blood group antigen proteins Nomenclature of blood group antigens and list of entries |
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


