Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q14773 (ICAM4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 130. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Intercellular adhesion molecule 4

Short name=ICAM-4
Alternative name(s):
Landsteiner-Wiener blood group glycoprotein
Short name=LW blood group protein
CD_antigen=CD242
Gene names
Name:ICAM4
Synonyms:LW
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length271 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins. Ref.9

Subcellular location

Isoform Long: Cell membrane; Single-pass type I membrane protein.

Isoform Short: Secreted.

Tissue specificity

Erythrocytes.

Post-translational modification

N- and O-glycosylated.

Polymorphism

Responsible for the Landsteiner-Wiener blood group system [MIM:111250]. The molecular basis of the LW(A)=LW5/LW(B)=LW7 blood group antigens is a single variation in position 100; Gln-100 corresponds to LW(A) and Arg-100 to LW(B).

Sequence similarities

Belongs to the immunoglobulin superfamily. ICAM family.

Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform Long (identifier: Q14773-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Short (identifier: Q14773-2)

The sequence of this isoform differs from the canonical sequence as follows:
     233-271: AWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA → GEAPL
Isoform 3 (identifier: Q14773-3)

The sequence of this isoform differs from the canonical sequence as follows:
     132-271: KPPHSVILEP...CKCLAMKSQA → SVPGGLLGGD...QSGEMAIHGG

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2222 Potential
Chain23 – 271249Intercellular adhesion molecule 4
PRO_0000014796

Regions

Topological domain23 – 240218Extracellular Potential
Transmembrane241 – 26121Helical; Potential
Topological domain262 – 27110Cytoplasmic Potential
Domain62 – 12463Ig-like C2-type 1
Domain146 – 21772Ig-like C2-type 2

Amino acid modifications

Glycosylation681N-linked (GlcNAc...) Potential
Glycosylation781N-linked (GlcNAc...) Potential
Glycosylation1901N-linked (GlcNAc...) Potential
Glycosylation2231N-linked (GlcNAc...) Potential
Disulfide bond69 ↔ 117 By similarity
Disulfide bond153 ↔ 210 By similarity

Natural variations

Alternative sequence132 – 271140KPPHS…MKSQA → SVPGGLLGGDPEAWKPGHLF RKPGALHRPGSGQRDLDLRV CCWTPRLLAARDLPRAPQSR RPGGPQQLGTHYTDARLEPR AHSFGLRFHRCPCRDPPHCG RCVPMQVPSYEVPGVKGDVL CRLSEKKRNMKQSGEMAIHG G in isoform 3.
VSP_043229
Alternative sequence233 – 27139AWSPA…MKSQA → GEAPL in isoform Short.
VSP_002519
Natural variant1001Q → R in LW(B). Ref.8
Corresponds to variant rs77493670 [ dbSNP | Ensembl ].
VAR_003912
Natural variant2081V → L. Ref.4
Corresponds to variant rs36023325 [ dbSNP | Ensembl ].
VAR_038721

Experimental info

Sequence conflict14 – 2916AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59538. Ref.1
Sequence conflict14 – 2916AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59537. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform Long [UniParc].

Last modified November 1, 1997. Version 1.
Checksum: 2F6BC8BABD79E615

FASTA27129,265
        10         20         30         40         50         60 
MGSLFPLSLL FFLAAAYPGV GSALGRRTKR AQSPKGSPLA PSGTSVPFWV RMSPEFVAVQ 

        70         80         90        100        110        120 
PGKSVQLNCS NSCPQPQNSS LRTPLRQGKT LRGPGWVSYQ LLDVRAWSSL AHCLVTCAGK 

       130        140        150        160        170        180 
TRWATSRITA YKPPHSVILE PPVLKGRKYT LRCHVTQVFP VGYLVVTLRH GSRVIYSESL 

       190        200        210        220        230        240 
ERFTGLDLAN VTLTYEFAAG PRDFWQPVIC HARLNLDGLV VRNSSAPITL MLAWSPAPTA 

       250        260        270 
LASGSIAALV GILLTVGAAY LCKCLAMKSQ A 

« Hide

Isoform Short [UniParc].

Checksum: F74416D3FB52ADB2
Show »

FASTA23725,931
Isoform 3 [UniParc].

Checksum: 991DE1707703CA19
Show »

FASTA27229,649

References

« Hide 'large scale' references
[1]"The LW blood group glycoprotein is homologous to intercellular adhesion molecules."
Bailly P., Hermand P., Callebaut I., Sonneborn H.H., Khamlichi S., Mornon J.-P., Cartron J.-P.
Proc. Natl. Acad. Sci. U.S.A. 91:5306-5310(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT).
[2]"Characterization of the gene encoding the human LW blood group protein in LW+ and LW- phenotypes."
Hermand P., le Pennec P.Y., Rouger P., Cartron J.-P., Bailly P.
Blood 87:2962-2967(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM LONG).
[3]"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[4]SeattleSNPs variation discovery resource
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT LEU-208.
[5]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND 3).
Tissue: Lung and Placenta.
[8]"Molecular basis and expression of the LWa/LWb blood group polymorphism."
Hermand P., Gane P., Mattei M.-G., Sistonen P., Cartron J.-P., Bailly P.
Blood 86:1590-1594(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-130, VARIANT BLOOD GROUP LW(B) ARG-100.
[9]"Intercellular adhesion molecule-4 binds alpha(4)beta(1) and alpha(V)-family integrins through novel integrin-binding mechanisms."
Spring F.A., Parsons S.F., Ortlepp S., Olsson M.L., Sessions R., Brady R.L., Anstee D.J.
Blood 98:458-466(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
+Additional computationally mapped references.

Web resources

dbRBC/BGMUT

Blood group antigen gene mutation database

SeattleSNPs

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L27671 mRNA. Translation: AAA59538.1.
L27670 mRNA. Translation: AAA59537.1.
X93093 Genomic DNA. Translation: CAA63646.1.
BT009816 mRNA. Translation: AAP88818.1.
DQ011692 Genomic DNA. Translation: AAY16986.1.
AC011511 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84089.1.
BC000046 mRNA. Translation: AAH00046.1.
BC029364 mRNA. Translation: AAH29364.1.
S78852 mRNA. Translation: AAB35046.1.
PIRI52612.
I59300.
I80159.
RefSeqNP_001034221.1. NM_001039132.2.
NP_001535.1. NM_001544.4.
NP_071772.1. NM_022377.3.
UniGeneHs.706750.

3D structure databases

ProteinModelPortalQ14773.
SMRQ14773. Positions 47-227.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid109613. 1 interaction.
IntActQ14773. 2 interactions.
STRING9606.ENSP00000342114.

Polymorphism databases

DMDM2497309.

Proteomic databases

PaxDbQ14773.
PRIDEQ14773.

Protocols and materials databases

DNASU3386.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000340992; ENSP00000342114; ENSG00000105371. [Q14773-3]
ENST00000380770; ENSP00000370147; ENSG00000105371. [Q14773-1]
ENST00000393717; ENSP00000377320; ENSG00000105371. [Q14773-2]
GeneID3386.
KEGGhsa:3386.
UCSCuc002mnr.2. human. [Q14773-3]
uc002mns.2. human. [Q14773-1]
uc002mnt.2. human. [Q14773-2]

Organism-specific databases

CTD3386.
GeneCardsGC19P010397.
HGNCHGNC:5347. ICAM4.
MIM111250. phenotype.
614088. gene.
neXtProtNX_Q14773.
PharmGKBPA29595.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG47696.
HOGENOMHOG000112993.
HOVERGENHBG052076.
KOK06581.
OMATLRCHVT.
OrthoDBEOG7B31NV.
PhylomeDBQ14773.

Enzyme and pathway databases

ReactomeREACT_118779. Extracellular matrix organization.
REACT_6900. Immune System.

Gene expression databases

BgeeQ14773.
CleanExHS_ICAM4.
GenevestigatorQ14773.

Family and domain databases

Gene3D2.60.40.10. 2 hits.
InterProIPR013768. ICAM_N.
IPR003987. ICAM_VCAM_N.
IPR013783. Ig-like_fold.
[Graphical view]
PfamPF03921. ICAM_N. 1 hit.
[Graphical view]
PRINTSPR01472. ICAMVCAM1.
ProtoNetSearch...

Other

GenomeRNAi3386.
NextBio13396.
PROQ14773.
SOURCESearch...

Entry information

Entry nameICAM4_HUMAN
AccessionPrimary (citable) accession number: Q14773
Secondary accession number(s): A0M8X2 expand/collapse secondary AC list , Q14771, Q14772, Q16375, Q9BWR0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: April 16, 2014
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries

Blood group antigen proteins

Nomenclature of blood group antigens and list of entries