Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q14773

- ICAM4_HUMAN

UniProt

Q14773 - ICAM4_HUMAN

Protein

Intercellular adhesion molecule 4

Gene

ICAM4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 134 (01 Oct 2014)
      Sequence version 1 (01 Nov 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.1 Publication

    GO - Molecular functioni

    1. integrin binding Source: ProtInc

    GO - Biological processi

    1. extracellular matrix organization Source: Reactome
    2. regulation of immune response Source: Reactome
    3. single organismal cell-cell adhesion Source: InterPro

    Keywords - Molecular functioni

    Blood group antigen

    Keywords - Biological processi

    Cell adhesion

    Enzyme and pathway databases

    ReactomeiREACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
    REACT_13552. Integrin cell surface interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Intercellular adhesion molecule 4
    Short name:
    ICAM-4
    Alternative name(s):
    Landsteiner-Wiener blood group glycoprotein
    Short name:
    LW blood group protein
    CD_antigen: CD242
    Gene namesi
    Name:ICAM4
    Synonyms:LW
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:5347. ICAM4.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell
    2. integral component of membrane Source: ProtInc
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    Pathology & Biotechi

    Organism-specific databases

    MIMi111250. phenotype.
    PharmGKBiPA29595.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2222Sequence AnalysisAdd
    BLAST
    Chaini23 – 271249Intercellular adhesion molecule 4PRO_0000014796Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi68 – 681N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi69 ↔ 117By similarity
    Glycosylationi78 – 781N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi153 ↔ 210By similarity
    Glycosylationi190 – 1901N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi223 – 2231N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    N- and O-glycosylated.

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ14773.
    PRIDEiQ14773.

    Expressioni

    Tissue specificityi

    Erythrocytes.

    Gene expression databases

    BgeeiQ14773.
    CleanExiHS_ICAM4.
    GenevestigatoriQ14773.

    Interactioni

    Protein-protein interaction databases

    BioGridi109613. 1 interaction.
    IntActiQ14773. 2 interactions.
    STRINGi9606.ENSP00000342114.

    Structurei

    3D structure databases

    ProteinModelPortaliQ14773.
    SMRiQ14773. Positions 47-227.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini23 – 240218ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini262 – 27110CytoplasmicSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei241 – 26121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini62 – 12463Ig-like C2-type 1Add
    BLAST
    Domaini146 – 21772Ig-like C2-type 2Add
    BLAST

    Sequence similaritiesi

    Belongs to the immunoglobulin superfamily. ICAM family.Curated

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG47696.
    HOGENOMiHOG000112993.
    HOVERGENiHBG052076.
    KOiK06581.
    OMAiYVNTENE.
    OrthoDBiEOG7B31NV.
    PhylomeDBiQ14773.

    Family and domain databases

    Gene3Di2.60.40.10. 2 hits.
    InterProiIPR013768. ICAM_N.
    IPR003987. ICAM_VCAM_N.
    IPR013783. Ig-like_fold.
    [Graphical view]
    PfamiPF03921. ICAM_N. 1 hit.
    [Graphical view]
    PRINTSiPR01472. ICAMVCAM1.

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform Long (identifier: Q14773-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGSLFPLSLL FFLAAAYPGV GSALGRRTKR AQSPKGSPLA PSGTSVPFWV    50
    RMSPEFVAVQ PGKSVQLNCS NSCPQPQNSS LRTPLRQGKT LRGPGWVSYQ 100
    LLDVRAWSSL AHCLVTCAGK TRWATSRITA YKPPHSVILE PPVLKGRKYT 150
    LRCHVTQVFP VGYLVVTLRH GSRVIYSESL ERFTGLDLAN VTLTYEFAAG 200
    PRDFWQPVIC HARLNLDGLV VRNSSAPITL MLAWSPAPTA LASGSIAALV 250
    GILLTVGAAY LCKCLAMKSQ A 271
    Length:271
    Mass (Da):29,265
    Last modified:November 1, 1997 - v1
    Checksum:i2F6BC8BABD79E615
    GO
    Isoform Short (identifier: Q14773-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         233-271: AWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA → GEAPL

    Show »
    Length:237
    Mass (Da):25,931
    Checksum:iF74416D3FB52ADB2
    GO
    Isoform 3 (identifier: Q14773-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         132-271: KPPHSVILEP...CKCLAMKSQA → SVPGGLLGGD...QSGEMAIHGG

    Show »
    Length:272
    Mass (Da):29,649
    Checksum:i991DE1707703CA19
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti14 – 2916AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59538. (PubMed:8202485)CuratedAdd
    BLAST
    Sequence conflicti14 – 2916AAAYP…GRRTK → RPPTRELGARWDAGL in AAA59537. (PubMed:8202485)CuratedAdd
    BLAST

    Polymorphismi

    Responsible for the Landsteiner-Wiener blood group system [MIMi:111250]. The molecular basis of the LW(A)=LW5/LW(B)=LW7 blood group antigens is a single variation in position 100; Gln-100 corresponds to LW(A) and Arg-100 to LW(B).

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti100 – 1001Q → R in LW(B). 1 Publication
    Corresponds to variant rs77493670 [ dbSNP | Ensembl ].
    VAR_003912
    Natural varianti208 – 2081V → L.1 Publication
    Corresponds to variant rs36023325 [ dbSNP | Ensembl ].
    VAR_038721

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei132 – 271140KPPHS…MKSQA → SVPGGLLGGDPEAWKPGHLF RKPGALHRPGSGQRDLDLRV CCWTPRLLAARDLPRAPQSR RPGGPQQLGTHYTDARLEPR AHSFGLRFHRCPCRDPPHCG RCVPMQVPSYEVPGVKGDVL CRLSEKKRNMKQSGEMAIHG G in isoform 3. 2 PublicationsVSP_043229Add
    BLAST
    Alternative sequencei233 – 27139AWSPA…MKSQA → GEAPL in isoform Short. 1 PublicationVSP_002519Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L27671 mRNA. Translation: AAA59538.1.
    L27670 mRNA. Translation: AAA59537.1.
    X93093 Genomic DNA. Translation: CAA63646.1.
    BT009816 mRNA. Translation: AAP88818.1.
    DQ011692 Genomic DNA. Translation: AAY16986.1.
    AC011511 Genomic DNA. No translation available.
    CH471106 Genomic DNA. Translation: EAW84089.1.
    BC000046 mRNA. Translation: AAH00046.1.
    BC029364 mRNA. Translation: AAH29364.1.
    S78852 mRNA. Translation: AAB35046.1.
    CCDSiCCDS12232.1. [Q14773-1]
    CCDS32904.1. [Q14773-3]
    CCDS42500.1. [Q14773-2]
    PIRiI52612.
    I59300.
    I80159.
    RefSeqiNP_001034221.1. NM_001039132.2. [Q14773-3]
    NP_001535.1. NM_001544.4. [Q14773-1]
    NP_071772.1. NM_022377.3. [Q14773-2]
    UniGeneiHs.706750.

    Genome annotation databases

    EnsembliENST00000340992; ENSP00000342114; ENSG00000105371. [Q14773-3]
    ENST00000380770; ENSP00000370147; ENSG00000105371. [Q14773-1]
    ENST00000393717; ENSP00000377320; ENSG00000105371. [Q14773-2]
    GeneIDi3386.
    KEGGihsa:3386.
    UCSCiuc002mnr.2. human. [Q14773-3]
    uc002mns.2. human. [Q14773-1]
    uc002mnt.2. human. [Q14773-2]

    Polymorphism databases

    DMDMi2497309.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    dbRBC/BGMUT

    Blood group antigen gene mutation database

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L27671 mRNA. Translation: AAA59538.1 .
    L27670 mRNA. Translation: AAA59537.1 .
    X93093 Genomic DNA. Translation: CAA63646.1 .
    BT009816 mRNA. Translation: AAP88818.1 .
    DQ011692 Genomic DNA. Translation: AAY16986.1 .
    AC011511 Genomic DNA. No translation available.
    CH471106 Genomic DNA. Translation: EAW84089.1 .
    BC000046 mRNA. Translation: AAH00046.1 .
    BC029364 mRNA. Translation: AAH29364.1 .
    S78852 mRNA. Translation: AAB35046.1 .
    CCDSi CCDS12232.1. [Q14773-1 ]
    CCDS32904.1. [Q14773-3 ]
    CCDS42500.1. [Q14773-2 ]
    PIRi I52612.
    I59300.
    I80159.
    RefSeqi NP_001034221.1. NM_001039132.2. [Q14773-3 ]
    NP_001535.1. NM_001544.4. [Q14773-1 ]
    NP_071772.1. NM_022377.3. [Q14773-2 ]
    UniGenei Hs.706750.

    3D structure databases

    ProteinModelPortali Q14773.
    SMRi Q14773. Positions 47-227.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109613. 1 interaction.
    IntActi Q14773. 2 interactions.
    STRINGi 9606.ENSP00000342114.

    Polymorphism databases

    DMDMi 2497309.

    Proteomic databases

    PaxDbi Q14773.
    PRIDEi Q14773.

    Protocols and materials databases

    DNASUi 3386.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000340992 ; ENSP00000342114 ; ENSG00000105371 . [Q14773-3 ]
    ENST00000380770 ; ENSP00000370147 ; ENSG00000105371 . [Q14773-1 ]
    ENST00000393717 ; ENSP00000377320 ; ENSG00000105371 . [Q14773-2 ]
    GeneIDi 3386.
    KEGGi hsa:3386.
    UCSCi uc002mnr.2. human. [Q14773-3 ]
    uc002mns.2. human. [Q14773-1 ]
    uc002mnt.2. human. [Q14773-2 ]

    Organism-specific databases

    CTDi 3386.
    GeneCardsi GC19P010397.
    HGNCi HGNC:5347. ICAM4.
    MIMi 111250. phenotype.
    614088. gene.
    neXtProti NX_Q14773.
    PharmGKBi PA29595.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG47696.
    HOGENOMi HOG000112993.
    HOVERGENi HBG052076.
    KOi K06581.
    OMAi YVNTENE.
    OrthoDBi EOG7B31NV.
    PhylomeDBi Q14773.

    Enzyme and pathway databases

    Reactomei REACT_11152. Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
    REACT_13552. Integrin cell surface interactions.

    Miscellaneous databases

    GenomeRNAii 3386.
    NextBioi 13396.
    PROi Q14773.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q14773.
    CleanExi HS_ICAM4.
    Genevestigatori Q14773.

    Family and domain databases

    Gene3Di 2.60.40.10. 2 hits.
    InterProi IPR013768. ICAM_N.
    IPR003987. ICAM_VCAM_N.
    IPR013783. Ig-like_fold.
    [Graphical view ]
    Pfami PF03921. ICAM_N. 1 hit.
    [Graphical view ]
    PRINTSi PR01472. ICAMVCAM1.
    ProtoNeti Search...

    Publicationsi

    1. "The LW blood group glycoprotein is homologous to intercellular adhesion molecules."
      Bailly P., Hermand P., Callebaut I., Sonneborn H.H., Khamlichi S., Mornon J.-P., Cartron J.-P.
      Proc. Natl. Acad. Sci. U.S.A. 91:5306-5310(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT).
    2. "Characterization of the gene encoding the human LW blood group protein in LW+ and LW- phenotypes."
      Hermand P., le Pennec P.Y., Rouger P., Cartron J.-P., Bailly P.
      Blood 87:2962-2967(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM LONG).
    3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
      Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    4. SeattleSNPs variation discovery resource
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT LEU-208.
    5. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND 3).
      Tissue: Lung and Placenta.
    8. "Molecular basis and expression of the LWa/LWb blood group polymorphism."
      Hermand P., Gane P., Mattei M.-G., Sistonen P., Cartron J.-P., Bailly P.
      Blood 86:1590-1594(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-130, VARIANT BLOOD GROUP LW(B) ARG-100.
    9. "Intercellular adhesion molecule-4 binds alpha(4)beta(1) and alpha(V)-family integrins through novel integrin-binding mechanisms."
      Spring F.A., Parsons S.F., Ortlepp S., Olsson M.L., Sessions R., Brady R.L., Anstee D.J.
      Blood 98:458-466(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiICAM4_HUMAN
    AccessioniPrimary (citable) accession number: Q14773
    Secondary accession number(s): A0M8X2
    , Q14771, Q14772, Q16375, Q9BWR0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1997
    Last modified: October 1, 2014
    This is version 134 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Blood group antigen proteins
      Nomenclature of blood group antigens and list of entries
    2. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    3. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    4. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    5. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    6. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3