Q14694 (UBP10_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ubiquitin carboxyl-terminal hydrolase 10 EC=3.4.19.12 Alternative name(s): Deubiquitinating enzyme 10 Ubiquitin thiolesterase 10 Ubiquitin-specific-processing protease 10 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 798 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolase that can remove conjugated ubiquitin from target proteins such as p53/TP53, SNX3 and CFTR. Acts as an essential regulator of p53/TP53 stability: in unstressed cells, specifically deubiquitinates p53/TP53 in the cytoplasm, leading to counteract MDM2 action and stabilize p53/TP53. Following DNA damage, translocates to the nucleus and deubiquitinates p53/TP53, leading to regulate the p53/TP53-dependent DNA damage response. Does not deubiquitinate MDM2. Deubiquitinates CFTR in early endosomes, enhancing its endocytic recycling. Ref.1 Ref.13 Ref.17 Ref.20 |
| Catalytic activity | Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal). Ref.20 |
| Subunit structure | Interacts with G3BP, which may regulate its function. Interacts with p53/TP53, SNX3 and CFTR. Ref.1 Ref.13 Ref.17 Ref.20 |
| Subcellular location | Cytoplasm. Nucleus. Early endosome. Note: Cytoplasmic in normal conditions. After DNA damage, translocates to the nucleus following phosphorylation by ATM. Ref.17 Ref.20 |
| Tissue specificity | Widely expressed. Ref.1 |
| Induction | Following DNA damage. Down-regulated in renal cell carcinomas. Ref.20 |
| Post-translational modification | Phosphorylated by ATM following DNA damage, leading to stablization and translocation it to the nucleus. Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.14 Ref.15 Ref.16 Ref.18 Ref.19 Ref.20 |
| Sequence similarities | Belongs to the peptidase C19 family. USP10 subfamily. |
| Sequence caution | The sequence CAD97644.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q14694-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q14694-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCSKDTVLSVCALYWRKGIQSHTPLIGAWRRGKQREQPEDRGVPMKRAA | ||||||
| Isoform 3 (identifier: Q14694-3) The sequence of this isoform differs from the canonical sequence as follows: 1-6: MALHSP → MPWLPSPGIG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 798 | 798 | Ubiquitin carboxyl-terminal hydrolase 10 | PRO_0000080629 | |||||
Regions | |||||||||
| Region | 1 – 100 | 100 | Interaction with p53/TP53 | ||||||
Sites | |||||||||
| Active site | 424 | 1 | Nucleophile | ||||||
| Active site | 749 | 1 | Proton acceptor By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 42 | 1 | Phosphothreonine; by ATM Ref.20 | ||||||
| Modified residue | 100 | 1 | Phosphothreonine Ref.14 | ||||||
| Modified residue | 208 | 1 | Phosphothreonine Ref.16 | ||||||
| Modified residue | 211 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 220 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 226 | 1 | Phosphoserine Ref.14 | ||||||
| Modified residue | 337 | 1 | Phosphoserine; by ATM Ref.20 | ||||||
| Modified residue | 364 | 1 | Phosphotyrosine Ref.9 | ||||||
| Modified residue | 365 | 1 | Phosphoserine Ref.9 Ref.16 | ||||||
| Modified residue | 370 | 1 | Phosphoserine Ref.9 Ref.14 Ref.16 | ||||||
| Modified residue | 547 | 1 | Phosphoserine Ref.16 | ||||||
| Modified residue | 563 | 1 | Phosphoserine Ref.14 Ref.19 | ||||||
| Modified residue | 576 | 1 | Phosphoserine Ref.7 Ref.8 Ref.10 Ref.11 Ref.12 Ref.14 Ref.15 Ref.16 Ref.18 Ref.19 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 6 | 6 | MALHSP → MPWLPSPGIG in isoform 3. | VSP_038868 | |||||
| Alternative sequence | 1 | 1 | M → MCSKDTVLSVCALYWRKGIQ SHTPLIGAWRRGKQREQPED RGVPMKRAA in isoform 2. | VSP_038869 | |||||
| Natural variant | 200 | 1 | M → V. Ref.4 Corresponds to variant rs1862792 [ dbSNP | Ensembl ]. | VAR_015859 | |||||
| Natural variant | 203 | 1 | S → P. Ref.6 Corresponds to variant rs2326391 [ dbSNP | Ensembl ]. | VAR_015860 | |||||
| Natural variant | 204 | 1 | V → L. Ref.6 Corresponds to variant rs1812061 [ dbSNP | Ensembl ]. | VAR_015861 | |||||
Experimental info | |||||||||
| Mutagenesis | 42 | 1 | T → A: Abolishes phosphorylation by ATM; when associated with A-337. Ref.20 | ||||||
| Mutagenesis | 42 | 1 | T → E: Phospho-mimetic mutant that translocates to the nucleus in absence of genotoxic stress; when associated with D-337. Ref.20 | ||||||
| Mutagenesis | 337 | 1 | S → A: Abolishes phosphorylation by ATM; when associated with A-42. Ref.20 | ||||||
| Mutagenesis | 337 | 1 | S → D: Phospho-mimetic mutant that translocates to the nucleus in absence of genotoxic stress; when associated with E-42. Ref.20 | ||||||
| Mutagenesis | 424 | 1 | C → A: Abolishes de-ubiquitinating activity. Ref.1 Ref.17 | ||||||
| Sequence conflict | 108 | 1 | A → V in BAG61546. Ref.3 | ||||||
| Sequence conflict | 263 | 1 | T → A in BAG61546. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Ras-GAP SH3 domain binding protein (G3BP) is a modulator of USP10, a novel human ubiquitin specific protease." Soncini C., Berdo I., Draetta G. Oncogene 20:3869-3879(2001) [PubMed: 11439350] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH G3BP, MUTAGENESIS OF CYS-424. |
| [2] | "Prediction of the coding sequences of unidentified human genes. V. The coding sequences of 40 new genes (KIAA0161-KIAA0200) deduced by analysis of cDNA clones from human cell line KG-1." Nagase T., Seki N., Ishikawa K., Tanaka A., Nomura N. DNA Res. 3:17-24(1996) [PubMed: 8724849] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Bone marrow. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Brain and Placenta. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-200. Tissue: Melanoma and Retina. |
| [5] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed: 15616553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS PRO-203 AND LEU-204. Tissue: Brain. |
| [7] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-211 AND SER-576, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-576, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-364; SER-365 AND SER-370, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line." Giorgianni F., Zhao Y., Desiderio D.M., Beranova-Giorgianni S. Electrophoresis 28:2027-2034(2007) [PubMed: 17487921] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-576, MASS SPECTROMETRY. Tissue: Prostate cancer. |
| [11] | "Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction." Tang L.-Y., Deng N., Wang L.-S., Dai J., Wang Z.-L., Jiang X.-S., Li S.-J., Li L., Sheng Q.-H., Wu D.-Q., Li L., Zeng R. Mol. Cell. Proteomics 6:1952-1967(2007) [PubMed: 17693683] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-576, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [12] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-576, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [13] | "Vasopressin-inducible ubiquitin-specific protease 10 increases ENaC cell surface expression by deubiquitylating and stabilizing sorting nexin 3." Boulkroun S., Ruffieux-Daidie D., Vitagliano J.J., Poirot O., Charles R.P., Lagnaz D., Firsov D., Kellenberger S., Staub O. Am. J. Physiol. 295:F889-F900(2008) [PubMed: 18632802] [Abstract] Cited for: FUNCTION, INTERACTION WITH SNX3. |
| [14] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-100; SER-220; SER-226; SER-370; SER-563 AND SER-576, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed: 18318008] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-576, MASS SPECTROMETRY. Tissue: Liver. |
| [16] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-208; SER-365; SER-370; SER-547 AND SER-576, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [17] | "The deubiquitinating enzyme USP10 regulates the post-endocytic sorting of cystic fibrosis transmembrane conductance regulator in airway epithelial cells." Bomberger J.M., Barnaby R.L., Stanton B.A. J. Biol. Chem. 284:18778-18789(2009) [PubMed: 19398555] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CFTR, MUTAGENESIS OF CYS-424. |
| [18] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-576, MASS SPECTROMETRY. |
| [19] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-563 AND SER-576, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [20] | "USP10 regulates p53 localization and stability by deubiquitinating p53." Yuan J., Luo K., Zhang L., Cheville J.C., Lou Z. Cell 140:384-396(2010) [PubMed: 20096447] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION, INDUCTION, INTERACTION WITH TP53, PHOSPHORYLATION AT THR-42; SER-337 AND CYS-424, MUTAGENESIS OF THR-42 AND SER-337. |
| [21] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D80012 mRNA. Translation: BAA11507.1. AK299618 mRNA. Translation: BAG61546.1. AK315570 mRNA. Translation: BAG37945.1. AL162049 mRNA. Translation: CAB82392.2. BX537402 mRNA. Translation: CAD97644.1. Different initiation. AC009116 Genomic DNA. No translation available. AC025280 Genomic DNA. No translation available. BC000263 mRNA. Translation: AAH00263.1. |
| IPI | IPI00291946. IPI00941385. IPI00955965. |
| RefSeq | NP_005144.2. NM_005153.2. |
| UniGene | Hs.136778. |
3D structure databases | |
| ProteinModelPortal | Q14694. |
| SMR | Q14694. Positions 412-797. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q14694. 9 interactions. |
| STRING | Q14694. |
Protein family/group databases | |
| MEROPS | C19.018. |
PTM databases | |
| PhosphoSite | Q14694. |
Polymorphism databases | |
| DMDM | 2501458. |
Proteomic databases | |
| PRIDE | Q14694. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000219473; ENSP00000219473; ENSG00000103194. ENST00000397953; ENSP00000381044; ENSG00000103194. |
| GeneID | 9100. |
| KEGG | hsa:9100. |
| UCSC | uc002fii.1. human. |
Organism-specific databases | |
| CTD | 9100. |
| GeneCards | GC16P084734. |
| H-InvDB | HIX0013304. |
| HGNC | HGNC:12608. USP10. |
| HPA | HPA006731. HPA006749. |
| MIM | 609818. gene. |
| neXtProt | NX_Q14694. |
| PharmGKB | PA37234. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG19630. |
| HOVERGEN | HBG059823. |
| InParanoid | Q14694. |
| OMA | TPRTCNS. |
| OrthoDB | EOG4FN4H7. |
| PhylomeDB | Q14694. |
Gene expression databases | |
| ArrayExpress | Q14694. |
| Bgee | Q14694. |
| CleanEx | HS_USP10. |
| Genevestigator | Q14694. |
| GermOnline | ENSG00000103194. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR009818. Ataxin-2_C. IPR018200. Pept_C19ubi-hydrolase_C_CS. IPR001394. Peptidase_C19. [Graphical view] |
| KO | K11841. |
| Pfam | PF07145. PAM2. 1 hit. PF00443. UCH. 1 hit. [Graphical view] |
| PROSITE | PS00972. UCH_2_1. 1 hit. PS00973. UCH_2_2. 1 hit. PS50235. UCH_2_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 34113. |
| SOURCE | Search... |
Entry information
| Entry name | UBP10_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14694 Secondary accession number(s): B2RDJ8 Q9NSL7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with