SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14587

- ZN268_HUMAN

UniProt

Q14587 - ZN268_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 268

Gene
ZNF268
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Isoform 1: Acts as a transcriptional repressor. Inhibits erythroid differentiation and tumor cell proliferation. Plays a role during ovarian cancer development and progression.6 Publications
Isoform 2: Contributes to cervical carcinogenesis in part through the TNF-alpha-induced NF-kappa-B signaling pathway by interacting with the I-kappa-B-kinase (IKK) core complex.6 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri276 – 29823C2H2-type 1Add
BLAST
Zinc fingeri304 – 32623C2H2-type 2Add
BLAST
Zinc fingeri332 – 35423C2H2-type 3Add
BLAST
Zinc fingeri360 – 38223C2H2-type 4Add
BLAST
Zinc fingeri388 – 41023C2H2-type 5Add
BLAST
Zinc fingeri416 – 43823C2H2-type 6Add
BLAST
Zinc fingeri444 – 46623C2H2-type 7Add
BLAST
Zinc fingeri472 – 49423C2H2-type 8Add
BLAST
Zinc fingeri500 – 52223C2H2-type 9Add
BLAST
Zinc fingeri528 – 55023C2H2-type 10Add
BLAST
Zinc fingeri556 – 57823C2H2-type 11Add
BLAST
Zinc fingeri584 – 60623C2H2-type 12Add
BLAST
Zinc fingeri612 – 63423C2H2-type 13Add
BLAST
Zinc fingeri640 – 66223C2H2-type 14Add
BLAST
Zinc fingeri668 – 69023C2H2-type 15Add
BLAST
Zinc fingeri696 – 71823C2H2-type 16Add
BLAST
Zinc fingeri724 – 74623C2H2-type 17Add
BLAST
Zinc fingeri752 – 77423C2H2-type 18Add
BLAST
Zinc fingeri780 – 80223C2H2-type 19Add
BLAST
Zinc fingeri808 – 83023C2H2-type 20Add
BLAST
Zinc fingeri836 – 85823C2H2-type 21Add
BLAST
Zinc fingeri864 – 88623C2H2-type 22Add
BLAST
Zinc fingeri892 – 91423C2H2-type 23Add
BLAST
Zinc fingeri920 – 94223C2H2-type 24Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB
  2. metal ion binding Source: UniProtKB-KW
  3. protein binding Source: UniProtKB
  4. sequence-specific DNA binding transcription factor activity Source: UniProtKB

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. cellular response to tumor necrosis factor Source: UniProtKB
  3. negative regulation of apoptotic process Source: UniProtKB
  4. negative regulation of cell cycle arrest Source: UniProtKB
  5. negative regulation of cell proliferation Source: UniProtKB
  6. negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  7. positive regulation of apoptotic process Source: UniProtKB
  8. positive regulation of cell differentiation Source: UniProtKB
  9. positive regulation of cell migration Source: UniProtKB
  10. positive regulation of cell proliferation Source: UniProtKB
  11. positive regulation of protein catabolic process Source: UniProtKB
  12. positive regulation of protein homodimerization activity Source: UniProtKB
  13. positive regulation of protein phosphorylation Source: UniProtKB
  14. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  15. positive regulation of transcription from RNA polymerase II promoter during mitosis Source: UniProtKB
  16. regulation of mitotic cell cycle Source: UniProtKB
  17. regulation of protein heterodimerization activity Source: UniProtKB
  18. regulation of transcription, DNA-templated Source: UniProtKB
  19. release of cytoplasmic sequestered NF-kappaB Source: UniProtKB
  20. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Differentiation, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_12627. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 268
Alternative name(s):
Zinc finger protein HZF3
Gene namesi
Name:ZNF268
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:13061. ZNF268.

Subcellular locationi

Isoform 1 : Nucleus 4 Publications
Isoform 2 : Nucleus. Cytoplasm 4 Publications

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi85 – 851D → A: Strongly reduces nuclear localization and interaction with TRIM28; when associated with A-86. 1 Publication
Mutagenesisi86 – 861V → A: Reduces nuclear localization. Strongly reduces nuclear localization and interaction with TRIM28; when associated with A-85. 1 Publication
Mutagenesisi88 – 881V → A: Reduces nuclear localization. 1 Publication
Mutagenesisi90 – 901F → A: Reduces nuclear localization. 1 Publication
Mutagenesisi93 – 931E → A: Reduces nuclear localization. Strongly reduces nuclear localization; when associated with A-94 and A-95. 1 Publication
Mutagenesisi94 – 941E → A: Reduces nuclear localization. Inhibits nuclear localization; when associated with A-93 and A-95. 1 Publication
Mutagenesisi95 – 951W → A: Reduces nuclear localization. Inhibits nuclear localization; when associated with A-93 and A-94. 1 Publication

Organism-specific databases

PharmGKBiPA37639.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 947947Zinc finger protein 268PRO_0000047495Add
BLAST

Proteomic databases

MaxQBiQ14587.
PaxDbiQ14587.
PRIDEiQ14587.

PTM databases

PhosphoSiteiQ14587.

Expressioni

Tissue specificityi

Overexpressed in ovarian cancer tissues compared to normal ovarian tissues. Isoform 1 and isoform 2 are expressed in squamous epithelium tissues. Isoform 2 is overexpressed in squamous cervical cancer (at protein level). Expressed in blood cells. Isoform 1 is expressed in pancreas, lung, skeletal muscle, heart, placenta, liver, kidney and brain. Isoform 2 expressed in chronic lymphocytic leukemia (CLL) and several tumor cell lines. Isoform 3 is expressed in several tumor cells. Isoform 5 is expressed in fetal liver and several tumor cells. Isoform 6 is weakly expressed in brain, lung amd small intestin and in several tumor cells. Isoform 7 is expressed in fetal liver and several tumor cells.6 Publications

Developmental stagei

Expressed in fetal liver from 5 weeks until 4 months but drastically reduced by 6 months and became non-detectible by 7 months. Expressed in hematopoietic stem cells in 3 weeks and 5 weeks (at protein level). Expressed in fetal liver.2 Publications

Inductioni

Down-regulated during erythroid differentiation by GATA1. Down-regulated by HTLV-1 Tax through the CREB/ATF pathway. Up-regulated by the regulator of nonsense transcript UPF1. Up-regulated by the cyclic AMP-dependent transcription factor ATF4.4 Publications

Gene expression databases

ArrayExpressiQ14587.
BgeeiQ14587.
CleanExiHS_ZNF268.
GenevestigatoriQ14587.

Organism-specific databases

HPAiHPA001794.

Interactioni

Subunit structurei

Interacts (via the KRAB domain) with TRIM28 (via the RBCC domain); the interaction increases ZNF268 nuclear localization activity. Isoform 2 interacts with CHUK and IKBKB; the interaction is further increased in a TNF-alpha-dependent manner.2 Publications

Protein-protein interaction databases

STRINGi9606.ENSP00000228289.

Structurei

Secondary structure

1
947
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi279 – 2824
Beta strandi284 – 2874
Helixi288 – 29811
Beta strandi304 – 3063
Turni307 – 3104
Beta strandi311 – 3155
Helixi316 – 3238
Turni324 – 3263
Beta strandi335 – 3373
Beta strandi340 – 3434
Helixi344 – 35411
Turni363 – 3664
Helixi372 – 3798
Beta strandi382 – 3854
Beta strandi391 – 3933
Beta strandi396 – 3994
Helixi400 – 41112
Beta strandi415 – 4173
Turni419 – 4213
Beta strandi424 – 4263
Helixi428 – 43710
Turni438 – 4403
Beta strandi443 – 4453
Beta strandi447 – 4493
Beta strandi452 – 4554
Helixi456 – 46510
Turni466 – 4683
Beta strandi495 – 5006
Turni503 – 5053
Helixi512 – 5198
Turni520 – 5223
Beta strandi527 – 5293
Beta strandi531 – 5333
Beta strandi536 – 5394
Helixi540 – 5478
Turni548 – 5503
Beta strandi559 – 5613
Beta strandi564 – 5674
Helixi568 – 57811
Turni587 – 5893
Beta strandi592 – 5965
Helixi597 – 60610
Beta strandi611 – 6133
Beta strandi615 – 6173
Beta strandi620 – 6234
Helixi624 – 6329
Beta strandi639 – 6424
Turni643 – 6464
Beta strandi647 – 6515
Helixi652 – 6598
Turni660 – 6623
Beta strandi667 – 6693
Beta strandi671 – 6744
Beta strandi676 – 6794
Helixi680 – 6867
Helixi687 – 6893
Beta strandi690 – 6923
Beta strandi699 – 7013
Helixi708 – 71912
Turni727 – 7293
Helixi736 – 7438
Turni744 – 7485
Beta strandi751 – 7533
Beta strandi755 – 7573
Beta strandi760 – 7634
Helixi764 – 7718
Helixi772 – 7743
Beta strandi783 – 7853
Helixi792 – 7998
Turni800 – 8023
Beta strandi807 – 8093
Beta strandi811 – 8133
Beta strandi816 – 8194
Helixi820 – 8278
Helixi828 – 8303
Beta strandi835 – 8373
Beta strandi839 – 8424
Beta strandi844 – 8474
Helixi848 – 8558
Helixi856 – 8583
Beta strandi862 – 8654
Beta strandi867 – 8693
Beta strandi872 – 8754
Helixi876 – 88611
Turni895 – 8973
Beta strandi900 – 9034
Helixi904 – 91411
Beta strandi919 – 9213
Beta strandi923 – 9253
Beta strandi928 – 9325
Helixi933 – 9419

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2EL4NMR-A663-695[»]
2EL5NMR-A749-777[»]
2EL6NMR-A831-863[»]
2EM1NMR-A637-667[»]
2EMVNMR-A859-889[»]
2EMWNMR-A301-331[»]
2EMXNMR-A273-303[»]
2EMYNMR-A551-583[»]
2EN0NMR-A385-413[»]
2EN6NMR-A887-919[»]
2EN7NMR-A495-525[»]
2EOFNMR-A411-441[»]
2EOGNMR-A693-723[»]
2EOINMR-A329-359[»]
2EOJNMR-A355-385[»]
2EOKNMR-A441-469[»]
2EOLNMR-A581-609[»]
2EOPNMR-A719-751[»]
2EPVNMR-A803-833[»]
2EPWNMR-A915-947[»]
2EPYNMR-A525-553[»]
2YTFNMR-A607-639[»]
2YTQNMR-A775-807[»]
ProteinModelPortaliQ14587.
SMRiQ14587. Positions 81-122, 199-947.

Miscellaneous databases

EvolutionaryTraceiQ14587.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini81 – 15272KRABAdd
BLAST

Domaini

The KRAB domain functions to reinforce the nuclear localization of isoform 1 in addition to its transcription repression activity.

Sequence similaritiesi

Contains 24 C2H2-type zinc fingers.
Contains 1 KRAB domain.

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri276 – 29823C2H2-type 1Add
BLAST
Zinc fingeri304 – 32623C2H2-type 2Add
BLAST
Zinc fingeri332 – 35423C2H2-type 3Add
BLAST
Zinc fingeri360 – 38223C2H2-type 4Add
BLAST
Zinc fingeri388 – 41023C2H2-type 5Add
BLAST
Zinc fingeri416 – 43823C2H2-type 6Add
BLAST
Zinc fingeri444 – 46623C2H2-type 7Add
BLAST
Zinc fingeri472 – 49423C2H2-type 8Add
BLAST
Zinc fingeri500 – 52223C2H2-type 9Add
BLAST
Zinc fingeri528 – 55023C2H2-type 10Add
BLAST
Zinc fingeri556 – 57823C2H2-type 11Add
BLAST
Zinc fingeri584 – 60623C2H2-type 12Add
BLAST
Zinc fingeri612 – 63423C2H2-type 13Add
BLAST
Zinc fingeri640 – 66223C2H2-type 14Add
BLAST
Zinc fingeri668 – 69023C2H2-type 15Add
BLAST
Zinc fingeri696 – 71823C2H2-type 16Add
BLAST
Zinc fingeri724 – 74623C2H2-type 17Add
BLAST
Zinc fingeri752 – 77423C2H2-type 18Add
BLAST
Zinc fingeri780 – 80223C2H2-type 19Add
BLAST
Zinc fingeri808 – 83023C2H2-type 20Add
BLAST
Zinc fingeri836 – 85823C2H2-type 21Add
BLAST
Zinc fingeri864 – 88623C2H2-type 22Add
BLAST
Zinc fingeri892 – 91423C2H2-type 23Add
BLAST
Zinc fingeri920 – 94223C2H2-type 24Add
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ14587.
KOiK09228.
OMAiLIVHQGA.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ14587.

Family and domain databases

Gene3Di3.30.160.60. 24 hits.
InterProiIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 24 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 24 hits.
PS50157. ZINC_FINGER_C2H2_2. 24 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q14587-1) [UniParc]FASTAAdd to Basket

Also known as: ZNF268a, KW-4 variant-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MATRVRTASI WVPPLQERNS SWDRIRKLQG QESILGQGTP GLQPLPGTPR    50
QKQKSRRIEK VLEWLFISQE QPKITKSWGP LSFMDVFVDF TWEEWQLLDP 100
AQKCLYRSVM LENYSNLVSL GYQHTKPDII FKLEQGEELC MVQAQVPNQT 150
CPNTVWKIDD LMDWHQENKD KLGSTAKSFE CTTFGKLCLL STKYLSRQKP 200
HKCGTHGKSL KYIDFTSDYA RNNPNGFQVH GKSFFHSKHE QTVIGIKYCE 250
SIESGKTVNK KSQLMCQQMY MGEKPFGCSC CEKAFSSKSY LLVHQQTHAE 300
EKPYGCNECG KDFSSKSYLI VHQRIHTGEK LHECSECRKT FSFHSQLVIH 350
QRIHTGENPY ECCECGKVFS RKDQLVSHQK THSGQKPYVC NECGKAFGLK 400
SQLIIHERIH TGEKPYECNE CQKAFNTKSN LMVHQRTHTG EKPYVCSDCG 450
KAFTFKSQLI VHQGIHTGVK PYGCIQCGKG FSLKSQLIVH QRSHTGMKPY 500
VCNECGKAFR SKSYLIIHTR THTGEKLHEC NNCGKAFSFK SQLIIHQRIH 550
TGENPYECHE CGKAFSRKYQ LISHQRTHAG EKPYECTDCG KAFGLKSQLI 600
IHQRTHTGEK PFECSECQKA FNTKSNLIVH QRTHTGEKPY SCNECGKAFT 650
FKSQLIVHKG VHTGVKPYGC SQCAKTFSLK SQLIVHQRSH TGVKPYGCSE 700
CGKAFRSKSY LIIHMRTHTG EKPHECRECG KSFSFNSQLI VHQRIHTGEN 750
PYECSECGKA FNRKDQLISH QRTHAGEKPY GCSECGKAFS SKSYLIIHMR 800
THSGEKPYEC NECGKAFIWK SLLIVHERTH AGVNPYKCSQ CEKSFSGKLR 850
LLVHQRMHTR EKPYECSECG KAFIRNSQLI VHQRTHSGEK PYGCNECGKT 900
FSQKSILSAH QRTHTGEKPC KCTECGKAFC WKSQLIMHQR THVDDKH 947
Length:947
Mass (Da):108,374
Last modified:August 29, 2001 - v2
Checksum:iAC78F4824F4BE1A0
GO
Isoform 2 (identifier: Q14587-2) [UniParc]FASTAAdd to Basket

Also known as: ZNF268s, KW-4 variant-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-161: Missing.

Show »
Length:786
Mass (Da):89,632
Checksum:i95F58663B2FEE18E
GO
Isoform 3 (identifier: Q14587-3) [UniParc]FASTAAdd to Basket

Also known as: ZNF268c

The sequence of this isoform differs from the canonical sequence as follows:
     1-140: Missing.
     222-947: Missing.

Show »
Length:81
Mass (Da):9,314
Checksum:iA48BA28E62F0BD17
GO
Isoform 4 (identifier: Q14587-4) [UniParc]FASTAAdd to Basket

Also known as: ZNF268d

The sequence of this isoform differs from the canonical sequence as follows:
     12-99: VPPLQERNSS...FTWEEWQLLD → GTNTPNLISS...LINVARMERV
     100-947: Missing.

Show »
Length:100
Mass (Da):11,720
Checksum:i74B1E1A3DE23D260
GO
Isoform 5 (identifier: Q14587-6) [UniParc]FASTAAdd to Basket

Also known as: ZNF268e

The sequence of this isoform differs from the canonical sequence as follows:
     79-135: GPLSFMDVFV...KPDIIFKLEQ → TQSGKLMILW...LINVARMERV
     136-947: Missing.

Show »
Length:135
Mass (Da):15,803
Checksum:iA3BD7C64C37509C4
GO
Isoform 6 (identifier: Q14587-7) [UniParc]FASTAAdd to Basket

Also known as: ZNF268f

The sequence of this isoform differs from the canonical sequence as follows:
     12-44: VPPLQERNSSWDRIRKLQGQESILGQGTPGLQP → GTNTPNLISSSSWNKEKSCVWCRPKFQIRPVQF
     45-947: Missing.

Show »
Length:44
Mass (Da):5,113
Checksum:i7B18E69B3EBB9DC7
GO
Isoform 7 (identifier: Q14587-8) [UniParc]FASTAAdd to Basket

Also known as: ZNF268g

The sequence of this isoform differs from the canonical sequence as follows:
     12-78: Missing.
     153-183: NTVWKIDDLMDWHQENKDKLGSTAKSFECTT → ILKAGKSKAKVLAGLVSGEGPLCASKMTPCC
     184-947: Missing.

Show »
Length:116
Mass (Da):12,931
Checksum:i107B06FCECC69F64
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti175 – 1751T → M.
Corresponds to variant rs7975069 [ dbSNP | Ensembl ].
VAR_033562

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 161161Missing in isoform 2. VSP_006909Add
BLAST
Alternative sequencei1 – 140140Missing in isoform 3. VSP_053461Add
BLAST
Alternative sequencei12 – 9988VPPLQ…WQLLD → GTNTPNLISSSSWNKEKSCV WCRPKFQIRPVQTQSGKLMI LWIGIRKIKTSWEVWQKALN ALHLENYVFLVQSIFQDKNL INVARMERV in isoform 4. VSP_053462Add
BLAST
Alternative sequencei12 – 7867Missing in isoform 7. VSP_053463Add
BLAST
Alternative sequencei12 – 4433VPPLQ…PGLQP → GTNTPNLISSSSWNKEKSCV WCRPKFQIRPVQF in isoform 6. VSP_053464Add
BLAST
Alternative sequencei45 – 947903Missing in isoform 6. VSP_053465Add
BLAST
Alternative sequencei79 – 13557GPLSF…FKLEQ → TQSGKLMILWIGIRKIKTSW EVRQKALNALHLENYVFLVQ SIFQDKNLINVARMERV in isoform 5. VSP_053466Add
BLAST
Alternative sequencei100 – 947848Missing in isoform 4. VSP_053467Add
BLAST
Alternative sequencei136 – 947812Missing in isoform 5. VSP_053468Add
BLAST
Alternative sequencei153 – 18331NTVWK…FECTT → ILKAGKSKAKVLAGLVSGEG PLCASKMTPCC in isoform 7. VSP_053469Add
BLAST
Alternative sequencei184 – 947764Missing in isoform 7. VSP_053470Add
BLAST
Alternative sequencei222 – 947726Missing in isoform 3. VSP_053471Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti323 – 3231Q → P in AAL99923. 1 Publication
Sequence conflicti335 – 3362SE → IN in AAL99923. 1 Publication
Sequence conflicti340 – 3401T → A in AAL99923. 1 Publication
Sequence conflicti344 – 3441H → Q in AAL99923. 1 Publication
Sequence conflicti363 – 3631C → D in AAL99923. 1 Publication
Sequence conflicti409 – 4091I → T in AAL99923. 1 Publication
Sequence conflicti860 – 8601R → T in AAL99923. 1 Publication
Sequence conflicti860 – 8601R → T in CAA55526. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF317549 mRNA. Translation: AAG59817.1.
AF385187 mRNA. Translation: AAK69307.1.
AF432217 mRNA. Translation: AAL99923.1.
AC026785 Genomic DNA. No translation available.
DQ057356 mRNA. No translation available.
DQ057357 mRNA. No translation available.
DQ057358 mRNA. No translation available.
DQ057359 mRNA. No translation available.
DQ057360 mRNA. No translation available.
X78926 mRNA. Translation: CAA55526.1.
CCDSiCCDS45012.1. [Q14587-1]
CCDS53853.1. [Q14587-4]
CCDS59240.1. [Q14587-6]
PIRiS47071.
RefSeqiNP_001159353.1. NM_001165881.2. [Q14587-1]
NP_001159355.1. NM_001165883.1. [Q14587-6]
NP_001159356.2. NM_001165884.2.
NP_001159357.1. NM_001165885.1.
NP_001159358.1. NM_001165886.1.
NP_001159359.1. NM_001165887.1.
NP_003406.1. NM_003415.2. [Q14587-1]
NP_694422.2. NM_152943.2.
UniGeneiHs.124047.

Genome annotation databases

EnsembliENST00000228289; ENSP00000228289; ENSG00000090612. [Q14587-1]
ENST00000536435; ENSP00000444412; ENSG00000090612. [Q14587-1]
ENST00000537565; ENSP00000445713; ENSG00000090612. [Q14587-2]
ENST00000539248; ENSP00000467781; ENSG00000090612. [Q14587-6]
ENST00000588312; ENSP00000466622; ENSG00000090612. [Q14587-7]
GeneIDi10795.
KEGGihsa:10795.
UCSCiuc010tbv.1. human. [Q14587-1]

Polymorphism databases

DMDMi19863363.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF317549 mRNA. Translation: AAG59817.1 .
AF385187 mRNA. Translation: AAK69307.1 .
AF432217 mRNA. Translation: AAL99923.1 .
AC026785 Genomic DNA. No translation available.
DQ057356 mRNA. No translation available.
DQ057357 mRNA. No translation available.
DQ057358 mRNA. No translation available.
DQ057359 mRNA. No translation available.
DQ057360 mRNA. No translation available.
X78926 mRNA. Translation: CAA55526.1 .
CCDSi CCDS45012.1. [Q14587-1 ]
CCDS53853.1. [Q14587-4 ]
CCDS59240.1. [Q14587-6 ]
PIRi S47071.
RefSeqi NP_001159353.1. NM_001165881.2. [Q14587-1 ]
NP_001159355.1. NM_001165883.1. [Q14587-6 ]
NP_001159356.2. NM_001165884.2.
NP_001159357.1. NM_001165885.1.
NP_001159358.1. NM_001165886.1.
NP_001159359.1. NM_001165887.1.
NP_003406.1. NM_003415.2. [Q14587-1 ]
NP_694422.2. NM_152943.2.
UniGenei Hs.124047.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2EL4 NMR - A 663-695 [» ]
2EL5 NMR - A 749-777 [» ]
2EL6 NMR - A 831-863 [» ]
2EM1 NMR - A 637-667 [» ]
2EMV NMR - A 859-889 [» ]
2EMW NMR - A 301-331 [» ]
2EMX NMR - A 273-303 [» ]
2EMY NMR - A 551-583 [» ]
2EN0 NMR - A 385-413 [» ]
2EN6 NMR - A 887-919 [» ]
2EN7 NMR - A 495-525 [» ]
2EOF NMR - A 411-441 [» ]
2EOG NMR - A 693-723 [» ]
2EOI NMR - A 329-359 [» ]
2EOJ NMR - A 355-385 [» ]
2EOK NMR - A 441-469 [» ]
2EOL NMR - A 581-609 [» ]
2EOP NMR - A 719-751 [» ]
2EPV NMR - A 803-833 [» ]
2EPW NMR - A 915-947 [» ]
2EPY NMR - A 525-553 [» ]
2YTF NMR - A 607-639 [» ]
2YTQ NMR - A 775-807 [» ]
ProteinModelPortali Q14587.
SMRi Q14587. Positions 81-122, 199-947.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000228289.

PTM databases

PhosphoSitei Q14587.

Polymorphism databases

DMDMi 19863363.

Proteomic databases

MaxQBi Q14587.
PaxDbi Q14587.
PRIDEi Q14587.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000228289 ; ENSP00000228289 ; ENSG00000090612 . [Q14587-1 ]
ENST00000536435 ; ENSP00000444412 ; ENSG00000090612 . [Q14587-1 ]
ENST00000537565 ; ENSP00000445713 ; ENSG00000090612 . [Q14587-2 ]
ENST00000539248 ; ENSP00000467781 ; ENSG00000090612 . [Q14587-6 ]
ENST00000588312 ; ENSP00000466622 ; ENSG00000090612 . [Q14587-7 ]
GeneIDi 10795.
KEGGi hsa:10795.
UCSCi uc010tbv.1. human. [Q14587-1 ]

Organism-specific databases

CTDi 10795.
GeneCardsi GC12P133757.
HGNCi HGNC:13061. ZNF268.
HPAi HPA001794.
MIMi 604753. gene.
neXtProti NX_Q14587.
PharmGKBi PA37639.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
HOGENOMi HOG000234617.
HOVERGENi HBG018163.
InParanoidi Q14587.
KOi K09228.
OMAi LIVHQGA.
OrthoDBi EOG7KSX7Q.
PhylomeDBi Q14587.

Enzyme and pathway databases

Reactomei REACT_12627. Generic Transcription Pathway.

Miscellaneous databases

EvolutionaryTracei Q14587.
GeneWikii ZNF268.
GenomeRNAii 10795.
NextBioi 40999.
PROi Q14587.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q14587.
Bgeei Q14587.
CleanExi HS_ZNF268.
Genevestigatori Q14587.

Family and domain databases

Gene3Di 3.30.160.60. 24 hits.
InterProi IPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF01352. KRAB. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view ]
SMARTi SM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 24 hits.
[Graphical view ]
SUPFAMi SSF109640. SSF109640. 1 hit.
PROSITEi PS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 24 hits.
PS50157. ZINC_FINGER_C2H2_2. 24 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel Kruppel-like zinc finger gene, ZNF268, expressed in early human embryo."
    Gou D.M., Sun Y., Gao L., Chow L.M.C., Huang J., Feng Y.D., Jiang D.H., Li W.X.
    Biochim. Biophys. Acta 1518:306-310(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Embryo.
  2. "Identification of tumor-associated antigens in chronic lymphocytic leukemia by SEREX."
    Krackhardt A.M., Witzens M., Harig S., Hodi F.S., Zauls A.J., Chessia M., Barrett P., Gribben J.G.
    Blood 100:2123-2131(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
  3. "KRAB-containing zinc finger gene ZNF268 encodes multiple alternatively spliced isoforms that contain transcription regulatory domains."
    Shao H., Zhu C., Zhao Z., Guo M., Qiu H., Liu H., Wang D., Xue L., Gao L., Sun C., Li W.
    Int. J. Mol. Med. 18:457-463(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4; 5; 6 AND 7), TISSUE SPECIFICITY.
  4. "Aberrant alternative splicing of human zinc finger gene ZNF268 in human hematological malignancy."
    Zhao Z., Wang D., Zhu C., Shao H., Sun C., Qiu H., Xue L., Xu J., Guo M., Li W.
    Oncol. Rep. 20:1243-1248(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4; 5; 6 AND 7), TISSUE SPECIFICITY.
  5. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "Isolation of cDNA clones for 42 different Kruppel-related zinc finger proteins expressed in the human monoblast cell line U-937."
    Abrink M., Aveskogh M., Hellman L.
    DNA Cell Biol. 14:125-136(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 549-947.
  7. "The KRAB domain of zinc finger gene ZNF268: a potential transcriptional repressor."
    Sun Y., Gou D.M., Liu H., Peng X., Li W.X.
    IUBMB Life 55:127-131(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION (ISOFORM 1), SUBCELLULAR LOCATION.
  8. "ZNF268, a novel kruppel-like zinc finger protein, is implicated in early human liver development."
    Sun Y., Shao H., Li Z., Liu J., Gao L., Peng X., Meng Y., Li W.
    Int. J. Mol. Med. 14:971-975(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE.
  9. "Transcription of human zinc finger ZNF268 gene requires an intragenic promoter element."
    Guo M.X., Wang D., Shao H.J., Qiu H.L., Xue L., Zhao Z.Z., Zhu C.G., Shi Y.B., Li W.X.
    J. Biol. Chem. 281:24623-24636(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION BY ATF4.
  10. "Cloning and characterization of two novel alternatively spliced transcripts of ZNF268."
    Sun C., Zhao Z.Z., Gao L., Sun Y., Shao H.J., Li W.X.
    Yi Chuan 28:513-517(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  11. Cited for: INDUCTION BY UPF1.
  12. "Human T-cell leukemia virus type 1 oncoprotein tax represses ZNF268 expression through the cAMP-responsive element-binding protein/activating transcription factor pathway."
    Wang D., Guo M.X., Hu H.M., Zhao Z.Z., Qiu H.L., Shao H.J., Zhu C.G., Xue L., Shi Y.B., Li W.X.
    J. Biol. Chem. 283:16299-16308(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION BY HTLV-1 TAX.
  13. "A splice variant of the C(2)H(2)-type zinc finger protein, ZNF268s, regulates NF-kappaB activation by TNF-alpha."
    Chun J.N., Song I.S., Kang D.H., Song H.J., Kim H.I., Seo J., Suh J.W., Lee K.J., Lee K.J., Kim J., Kang S.W.
    Mol. Cells 26:175-180(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, ALTERNATIVE SPLICING (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, IDENTIFICATION BY MASS SPECTROMETRY.
  14. "The zinc finger protein ZNF268 is overexpressed in human cervical cancer and contributes to tumorigenesis via enhancing NF-kappaB signaling."
    Wang W., Guo M., Hu L., Cai J., Zeng Y., Luo J., Shu Z., Li W., Huang Z.
    J. Biol. Chem. 287:42856-42866(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION (ISOFORMS 1 AND 2), INTERACTION WITH CHUK AND IKBKB, TISSUE SPECIFICITY.
  15. "Knockdown of ZNF268, which is transcriptionally downregulated by GATA-1, promotes proliferation of K562 cells."
    Zeng Y., Wang W., Ma J., Wang X., Guo M., Li W.
    PLoS ONE 7:E29518-E29518(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INDUCTION.
  16. "Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1."
    Wang W., Cai J., Wu Y., Hu L., Chen Z., Hu J., Chen Z., Li W., Guo M., Huang Z.
    Cell. Mol. Life Sci. 70:3947-3958(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TRIM28, SUBCELLULAR LOCATION (ISOFORMS 1 AND 2), MUTAGENESIS OF ASP-85; VAL-86; VAL-88; PHE-90; GLU-93; GLU-94 AND TRP-95.
  17. "Aberrant expression of ZNF268 alters the growth and migration of ovarian cancer cells."
    Hu L., Wang W., Cai J., Luo J., Huang Y., Xiong S., Li W., Guo M.
    Oncol. Lett. 6:49-54(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  18. "Solution structure of the C2H2 type zinc finger region of human zinc finger protein 268."
    RIKEN structural genomics initiative (RSGI)
    Submitted (OCT-2007) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 272-947.

Entry informationi

Entry nameiZN268_HUMAN
AccessioniPrimary (citable) accession number: Q14587
Secondary accession number(s): Q8TDG8, Q96RH4, Q9BZJ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: August 29, 2001
Last modified: September 3, 2014
This is version 143 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi