Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q14565 (DMC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 135. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Meiotic recombination protein DMC1/LIM15 homolog
Gene names
Name:DMC1
Synonyms:DMC1H, LIM15
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length340 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May participate in meiotic recombination, specifically in homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks By similarity.

Subunit structure

Interacts with the MND1-PSMC3IP heterodimer By similarity. Double stacked ring-shaped homooctamer. Interacts with BRCA2. Ref.8 Ref.9

Subcellular location

Nucleus Potential. Chromosome By similarity.

Sequence similarities

Belongs to the RecA family. DMC1 subfamily.

Contains 1 HhH domain.

Ontologies

Keywords
   Biological processCell cycle
Meiosis
   Cellular componentChromosome
Nucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandATP-binding
DNA-binding
Nucleotide-binding
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processfemale gamete generation

Traceable author statement Ref.2. Source: ProtInc

male meiosis I

Inferred from electronic annotation. Source: Ensembl

meiotic nuclear division

Traceable author statement Ref.2. Source: ProtInc

oocyte maturation

Inferred from electronic annotation. Source: Ensembl

ovarian follicle development

Inferred from electronic annotation. Source: Ensembl

reciprocal meiotic recombination

Traceable author statement Ref.2. Source: ProtInc

spermatid development

Inferred from electronic annotation. Source: Ensembl

spermatogenesis

Traceable author statement Ref.1. Source: ProtInc

synapsis

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentchromosome

Inferred from sequence or structural similarity. Source: UniProtKB

chromosome, telomeric region

Inferred from electronic annotation. Source: Ensembl

condensed nuclear chromosome

Traceable author statement Ref.2. Source: ProtInc

   Molecular_functionATP binding

Traceable author statement Ref.2. Source: ProtInc

DNA binding

Traceable author statement Ref.2. Source: ProtInc

DNA-dependent ATPase activity

Inferred from electronic annotation. Source: InterPro

protein binding

Inferred from physical interaction Ref.8. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

BRCA2P5158711EBI-930865,EBI-79792

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q14565-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q14565-2)

The sequence of this isoform differs from the canonical sequence as follows:
     141-196: VTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTS → G
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 340340Meiotic recombination protein DMC1/LIM15 homolog
PRO_0000122918

Regions

Nucleotide binding126 – 1338ATP Potential

Sites

Binding site2301ssDNA or dsDNA
Binding site2331ssDNA
Binding site2361ssDNA or dsDNA
Binding site2421ssDNA or dsDNA
Binding site3111ssDNA

Natural variations

Alternative sequence141 – 19656VTAQL…RAYTS → G in isoform 2.
VSP_055357
Natural variant1501G → D.
Corresponds to variant rs58396845 [ dbSNP | Ensembl ].
VAR_061757
Natural variant2001M → V. Ref.5
Corresponds to variant rs2227914 [ dbSNP | Ensembl ].
VAR_018960

Experimental info

Mutagenesis2581E → A or Q: Decreases octamer stability. Ref.9
Sequence conflict371I → N in BAA10970. Ref.2
Sequence conflict1831A → P in BAA09932. Ref.1

Secondary structure

.............................................. 340
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 27, 2001. Version 2.
Checksum: 040A6E4CF1FEBFA2

FASTA34037,681
        10         20         30         40         50         60 
MKEDQVVAEE PGFQDEEESL FQDIDLLQKH GINVADIKKL KSVGICTIKG IQMTTRRALC 

        70         80         90        100        110        120 
NVKGLSEAKV DKIKEAANKL IEPGFLTAFE YSEKRKMVFH ITTGSQEFDK LLGGGIESMA 

       130        140        150        160        170        180 
ITEAFGEFRT GKTQLSHTLC VTAQLPGAGG YPGGKIIFID TENTFRPDRL RDIADRFNVD 

       190        200        210        220        230        240 
HDAVLDNVLY ARAYTSEHQM ELLDYVAAKF HEEAGIFKLL IIDSIMALFR VDFSGRGELA 

       250        260        270        280        290        300 
ERQQKLAQML SRLQKISEEY NVAVFVTNQM TADPGATMTF QADPKKPIGG HILAHASTTR 

       310        320        330        340 
ISLRKGRGEL RIAKIYDSPE MPENEATFAI TAGGIGDAKE 

« Hide

Isoform 2 [UniParc].

Checksum: 0DDE121D137D5438
Show »

FASTA28531,559

References

« Hide 'large scale' references
[1]"Expression profiles of a human gene identified as a structural homologue of meiosis-specific recA-like genes."
Sato S., Seki N., Hotta Y., Tabata S.
DNA Res. 2:183-185(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Testis.
[2]"The mouse and human homologs of DMC1, the yeast meiosis-specific homologous recombination gene, have a common unique form of exon-skipped transcript in meiosis."
Habu T., Taki T., West A., Nishimune Y., Morita T.
Nucleic Acids Res. 24:470-477(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Testis.
[3]"A genome annotation-driven approach to cloning the human ORFeome."
Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.
Genome Biol. 5:R84.1-R84.11(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Heart and Thymus.
[5]NIEHS SNPs program
Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT VAL-200.
[6]"The DNA sequence of human chromosome 22."
Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M. expand/collapse author list , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[8]"Purified human BRCA2 stimulates RAD51-mediated recombination."
Jensen R.B., Carreira A., Kowalczykowski S.C.
Nature 467:678-683(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH BRCA2.
[9]"Structural basis for octameric ring formation and DNA interaction of the human homologous-pairing protein Dmc1."
Kinebuchi T., Kagawa W., Enomoto R., Tanaka K., Miyagawa K., Shibata T., Kurumizaka H., Yokoyama S.
Mol. Cell 14:363-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS), SUBUNIT, DNA-BINDING SITES, MUTAGENESIS OF GLU-258.
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D63882 mRNA. Translation: BAA09932.1.
D64108 mRNA. Translation: BAA10970.1.
CR456486 mRNA. Translation: CAG30372.1.
AK292617 mRNA. Translation: BAF85306.1.
AK297664 mRNA. Translation: BAG60028.1.
AY520538 Genomic DNA. Translation: AAR89915.1.
AL022320 Genomic DNA. Translation: CAB45656.1.
BC125163 mRNA. Translation: AAI25164.1.
BC125164 mRNA. Translation: AAI25165.1.
CCDSCCDS13973.1.
PIRS62354.
RefSeqNP_008999.2. NM_007068.3.
XP_006724173.1. XM_006724110.1.
UniGeneHs.339396.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1V5WX-ray3.20A/B1-340[»]
2ZJBX-ray3.50A/B1-340[»]
4HYYX-ray2.60A/B/C/D84-340[»]
ProteinModelPortalQ14565.
SMRQ14565. Positions 31-338.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116316. 4 interactions.
DIPDIP-24192N.
IntActQ14565. 4 interactions.
MINTMINT-3029876.
STRING9606.ENSP00000216024.

PTM databases

PhosphoSiteQ14565.

Polymorphism databases

DMDM13878923.

Proteomic databases

PaxDbQ14565.
PRIDEQ14565.

Protocols and materials databases

DNASU11144.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000216024; ENSP00000216024; ENSG00000100206.
ENST00000428462; ENSP00000412703; ENSG00000100206.
GeneID11144.
KEGGhsa:11144.
UCSCuc003avz.2. human.

Organism-specific databases

CTD11144.
GeneCardsGC22M038914.
HGNCHGNC:2927. DMC1.
HPACAB015397.
HPA001232.
MIM602721. gene.
neXtProtNX_Q14565.
PharmGKBPA27377.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0468.
HOGENOMHOG000227426.
HOVERGENHBG001504.
InParanoidQ14565.
KOK10872.
OMAINMADIK.
PhylomeDBQ14565.
TreeFamTF300698.

Enzyme and pathway databases

ReactomeREACT_115566. Cell Cycle.

Gene expression databases

ArrayExpressQ14565.
BgeeQ14565.
CleanExHS_DMC1.
GenevestigatorQ14565.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR003593. AAA+_ATPase.
IPR011940. DMC1_rcmbase.
IPR013632. DNA_recomb/repair_Rad51_C.
IPR016467. DNA_recomb/repair_RecA-like.
IPR010995. DNA_repair_Rad51/TF_NusA_a-hlx.
IPR027417. P-loop_NTPase.
IPR020588. RecA_ATP-bd.
IPR020587. RecA_monomer-monomer_interface.
[Graphical view]
PfamPF08423. Rad51. 1 hit.
[Graphical view]
PIRSFPIRSF005856. Rad51. 1 hit.
SMARTSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMSSF47794. SSF47794. 1 hit.
SSF52540. SSF52540. 1 hit.
TIGRFAMsTIGR02238. recomb_DMC1. 1 hit.
PROSITEPS50162. RECA_2. 1 hit.
PS50163. RECA_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ14565.
GeneWikiDMC1_(gene).
GenomeRNAi11144.
NextBio42364.
PROQ14565.
SOURCESearch...

Entry information

Entry nameDMC1_HUMAN
AccessionPrimary (citable) accession number: Q14565
Secondary accession number(s): A8K9A2 expand/collapse secondary AC list , B4DMW6, Q08AI1, Q99498, Q9UH11
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: April 27, 2001
Last modified: July 9, 2014
This is version 135 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 22

Human chromosome 22: entries, gene names and cross-references to MIM