Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Meiotic recombination protein DMC1/LIM15 homolog

Gene

DMC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May participate in meiotic recombination, specifically in homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei230ssDNA or dsDNA1
Binding sitei233ssDNA1
Binding sitei236ssDNA or dsDNA1
Binding sitei242ssDNA or dsDNA1
Binding sitei311ssDNA1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi126 – 133ATPSequence analysis8

GO - Molecular functioni

  • ATP binding Source: ProtInc
  • DNA binding Source: ProtInc
  • DNA-dependent ATPase activity Source: GO_Central
  • double-stranded DNA binding Source: GO_Central
  • four-way junction DNA binding Source: GO_Central
  • recombinase activity Source: GO_Central
  • single-stranded DNA binding Source: GO_Central

GO - Biological processi

  • chromosome organization involved in meiotic cell cycle Source: GO_Central
  • DNA recombinase assembly Source: GO_Central
  • female gamete generation Source: ProtInc
  • male meiosis I Source: Ensembl
  • meiotic nuclear division Source: ProtInc
  • mitotic recombination Source: GO_Central
  • oocyte maturation Source: Ensembl
  • ovarian follicle development Source: Ensembl
  • reciprocal meiotic recombination Source: ProtInc
  • response to ionizing radiation Source: GO_Central
  • spermatid development Source: Ensembl
  • spermatogenesis Source: ProtInc
  • strand invasion Source: GO_Central
  • synapsis Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Meiosis

Keywords - Ligandi

ATP-binding, DNA-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100206-MONOMER.
ReactomeiR-HSA-912446. Meiotic recombination.

Names & Taxonomyi

Protein namesi
Recommended name:
Meiotic recombination protein DMC1/LIM15 homolog
Gene namesi
Name:DMC1
Synonyms:DMC1H, LIM15
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:2927. DMC1.

Subcellular locationi

GO - Cellular componenti

  • chromosome Source: UniProtKB
  • chromosome, telomeric region Source: Ensembl
  • condensed nuclear chromosome Source: ProtInc
  • nucleoplasm Source: GO_Central
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi258E → A or Q: Decreases octamer stability. 1 Publication1

Organism-specific databases

DisGeNETi11144.
OpenTargetsiENSG00000100206.
PharmGKBiPA27377.

Polymorphism and mutation databases

DMDMi13878923.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001229181 – 340Meiotic recombination protein DMC1/LIM15 homologAdd BLAST340

Proteomic databases

PaxDbiQ14565.
PeptideAtlasiQ14565.
PRIDEiQ14565.

PTM databases

PhosphoSitePlusiQ14565.

Expressioni

Gene expression databases

BgeeiENSG00000100206.
CleanExiHS_DMC1.
ExpressionAtlasiQ14565. baseline and differential.
GenevisibleiQ14565. HS.

Organism-specific databases

HPAiCAB015397.
HPA001232.

Interactioni

Subunit structurei

Interacts with the MND1-PSMC3IP heterodimer (By similarity). Double stacked ring-shaped homooctamer. Interacts with BRCA2.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BRCA2P5158711EBI-930865,EBI-79792
GORASP2Q9H8Y83EBI-930865,EBI-739467
KCTD17Q8N5Z53EBI-930865,EBI-743960
NIF3L1Q9GZT85EBI-930865,EBI-740897
PSMA3P257883EBI-930865,EBI-348380
SDCBPO005603EBI-930865,EBI-727004
TRIM23P364063EBI-930865,EBI-740098

Protein-protein interaction databases

BioGridi116316. 17 interactors.
DIPiDIP-24192N.
IntActiQ14565. 14 interactors.
MINTiMINT-3029876.
STRINGi9606.ENSP00000216024.

Structurei

Secondary structure

1340
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi85 – 87Combined sources3
Helixi88 – 95Combined sources8
Helixi106 – 111Combined sources6
Beta strandi114 – 118Combined sources5
Beta strandi120 – 127Combined sources8
Helixi132 – 142Combined sources11
Helixi148 – 150Combined sources3
Beta strandi155 – 163Combined sources9
Helixi167 – 177Combined sources11
Helixi181 – 186Combined sources6
Beta strandi188 – 192Combined sources5
Helixi196 – 212Combined sources17
Beta strandi216 – 223Combined sources8
Helixi227 – 232Combined sources6
Helixi235 – 237Combined sources3
Helixi239 – 259Combined sources21
Beta strandi263 – 268Combined sources6
Beta strandi287 – 289Combined sources3
Helixi290 – 296Combined sources7
Beta strandi298 – 305Combined sources8
Beta strandi310 – 317Combined sources8
Helixi322 – 324Combined sources3
Beta strandi325 – 331Combined sources7
Beta strandi334 – 337Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V5WX-ray3.20A/B1-340[»]
2ZJBX-ray3.50A/B1-340[»]
4HYYX-ray2.60A/B/C/D84-340[»]
ProteinModelPortaliQ14565.
SMRiQ14565.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14565.

Family & Domainsi

Sequence similaritiesi

Belongs to the RecA family. DMC1 subfamily.Curated
Contains 1 HhH domain.Curated

Phylogenomic databases

eggNOGiKOG1433. Eukaryota.
COG0468. LUCA.
GeneTreeiENSGT00760000119398.
HOGENOMiHOG000227426.
HOVERGENiHBG001504.
InParanoidiQ14565.
KOiK10872.
OMAiINMADIK.
OrthoDBiEOG091G09QY.
PhylomeDBiQ14565.
TreeFamiTF300698.

Family and domain databases

CDDicd01123. Rad51_DMC1_radA. 1 hit.
Gene3Di3.40.50.300. 1 hit.
InterProiIPR003593. AAA+_ATPase.
IPR011940. DMC1_rcmbase.
IPR013632. DNA_recomb/repair_Rad51_C.
IPR016467. DNA_recomb/repair_RecA-like.
IPR010995. DNA_repair_Rad51/TF_NusA_a-hlx.
IPR027417. P-loop_NTPase.
IPR033925. Rad51_DMC1_RadA.
IPR020588. RecA_ATP-bd.
IPR020587. RecA_monomer-monomer_interface.
[Graphical view]
PfamiPF08423. Rad51. 1 hit.
[Graphical view]
PIRSFiPIRSF005856. Rad51. 1 hit.
SMARTiSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF47794. SSF47794. 1 hit.
SSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR02238. recomb_DMC1. 1 hit.
PROSITEiPS50162. RECA_2. 1 hit.
PS50163. RECA_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14565-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKEDQVVAEE PGFQDEEESL FQDIDLLQKH GINVADIKKL KSVGICTIKG
60 70 80 90 100
IQMTTRRALC NVKGLSEAKV DKIKEAANKL IEPGFLTAFE YSEKRKMVFH
110 120 130 140 150
ITTGSQEFDK LLGGGIESMA ITEAFGEFRT GKTQLSHTLC VTAQLPGAGG
160 170 180 190 200
YPGGKIIFID TENTFRPDRL RDIADRFNVD HDAVLDNVLY ARAYTSEHQM
210 220 230 240 250
ELLDYVAAKF HEEAGIFKLL IIDSIMALFR VDFSGRGELA ERQQKLAQML
260 270 280 290 300
SRLQKISEEY NVAVFVTNQM TADPGATMTF QADPKKPIGG HILAHASTTR
310 320 330 340
ISLRKGRGEL RIAKIYDSPE MPENEATFAI TAGGIGDAKE
Length:340
Mass (Da):37,681
Last modified:April 27, 2001 - v2
Checksum:i040A6E4CF1FEBFA2
GO
Isoform 2 (identifier: Q14565-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-196: VTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTS → G

Note: No experimental confirmation available.
Show »
Length:285
Mass (Da):31,559
Checksum:i0DDE121D137D5438
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti37I → N in BAA10970 (PubMed:8602360).Curated1
Sequence conflicti183A → P in BAA09932 (PubMed:8590282).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061757150G → D.Corresponds to variant rs58396845dbSNPEnsembl.1
Natural variantiVAR_018960200M → V.1 PublicationCorresponds to variant rs2227914dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055357141 – 196VTAQL…RAYTS → G in isoform 2. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D63882 mRNA. Translation: BAA09932.1.
D64108 mRNA. Translation: BAA10970.1.
CR456486 mRNA. Translation: CAG30372.1.
AK292617 mRNA. Translation: BAF85306.1.
AK297664 mRNA. Translation: BAG60028.1.
AY520538 Genomic DNA. Translation: AAR89915.1.
AL022320 Genomic DNA. Translation: CAB45656.1.
BC125163 mRNA. Translation: AAI25164.1.
BC125164 mRNA. Translation: AAI25165.1.
CCDSiCCDS13973.1. [Q14565-1]
CCDS63477.1. [Q14565-2]
PIRiS62354.
RefSeqiNP_001265137.1. NM_001278208.1. [Q14565-2]
NP_008999.2. NM_007068.3. [Q14565-1]
XP_006724175.1. XM_006724112.2. [Q14565-2]
UniGeneiHs.339396.

Genome annotation databases

EnsembliENST00000216024; ENSP00000216024; ENSG00000100206. [Q14565-1]
ENST00000428462; ENSP00000412703; ENSG00000100206. [Q14565-2]
GeneIDi11144.
KEGGihsa:11144.
UCSCiuc003avz.3. human. [Q14565-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D63882 mRNA. Translation: BAA09932.1.
D64108 mRNA. Translation: BAA10970.1.
CR456486 mRNA. Translation: CAG30372.1.
AK292617 mRNA. Translation: BAF85306.1.
AK297664 mRNA. Translation: BAG60028.1.
AY520538 Genomic DNA. Translation: AAR89915.1.
AL022320 Genomic DNA. Translation: CAB45656.1.
BC125163 mRNA. Translation: AAI25164.1.
BC125164 mRNA. Translation: AAI25165.1.
CCDSiCCDS13973.1. [Q14565-1]
CCDS63477.1. [Q14565-2]
PIRiS62354.
RefSeqiNP_001265137.1. NM_001278208.1. [Q14565-2]
NP_008999.2. NM_007068.3. [Q14565-1]
XP_006724175.1. XM_006724112.2. [Q14565-2]
UniGeneiHs.339396.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V5WX-ray3.20A/B1-340[»]
2ZJBX-ray3.50A/B1-340[»]
4HYYX-ray2.60A/B/C/D84-340[»]
ProteinModelPortaliQ14565.
SMRiQ14565.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116316. 17 interactors.
DIPiDIP-24192N.
IntActiQ14565. 14 interactors.
MINTiMINT-3029876.
STRINGi9606.ENSP00000216024.

PTM databases

PhosphoSitePlusiQ14565.

Polymorphism and mutation databases

DMDMi13878923.

Proteomic databases

PaxDbiQ14565.
PeptideAtlasiQ14565.
PRIDEiQ14565.

Protocols and materials databases

DNASUi11144.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000216024; ENSP00000216024; ENSG00000100206. [Q14565-1]
ENST00000428462; ENSP00000412703; ENSG00000100206. [Q14565-2]
GeneIDi11144.
KEGGihsa:11144.
UCSCiuc003avz.3. human. [Q14565-1]

Organism-specific databases

CTDi11144.
DisGeNETi11144.
GeneCardsiDMC1.
HGNCiHGNC:2927. DMC1.
HPAiCAB015397.
HPA001232.
MIMi602721. gene.
neXtProtiNX_Q14565.
OpenTargetsiENSG00000100206.
PharmGKBiPA27377.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1433. Eukaryota.
COG0468. LUCA.
GeneTreeiENSGT00760000119398.
HOGENOMiHOG000227426.
HOVERGENiHBG001504.
InParanoidiQ14565.
KOiK10872.
OMAiINMADIK.
OrthoDBiEOG091G09QY.
PhylomeDBiQ14565.
TreeFamiTF300698.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100206-MONOMER.
ReactomeiR-HSA-912446. Meiotic recombination.

Miscellaneous databases

EvolutionaryTraceiQ14565.
GeneWikiiDMC1_(gene).
GenomeRNAii11144.
PROiQ14565.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100206.
CleanExiHS_DMC1.
ExpressionAtlasiQ14565. baseline and differential.
GenevisibleiQ14565. HS.

Family and domain databases

CDDicd01123. Rad51_DMC1_radA. 1 hit.
Gene3Di3.40.50.300. 1 hit.
InterProiIPR003593. AAA+_ATPase.
IPR011940. DMC1_rcmbase.
IPR013632. DNA_recomb/repair_Rad51_C.
IPR016467. DNA_recomb/repair_RecA-like.
IPR010995. DNA_repair_Rad51/TF_NusA_a-hlx.
IPR027417. P-loop_NTPase.
IPR033925. Rad51_DMC1_RadA.
IPR020588. RecA_ATP-bd.
IPR020587. RecA_monomer-monomer_interface.
[Graphical view]
PfamiPF08423. Rad51. 1 hit.
[Graphical view]
PIRSFiPIRSF005856. Rad51. 1 hit.
SMARTiSM00382. AAA. 1 hit.
[Graphical view]
SUPFAMiSSF47794. SSF47794. 1 hit.
SSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR02238. recomb_DMC1. 1 hit.
PROSITEiPS50162. RECA_2. 1 hit.
PS50163. RECA_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDMC1_HUMAN
AccessioniPrimary (citable) accession number: Q14565
Secondary accession number(s): A8K9A2
, B4DMW6, Q08AI1, Q99498, Q9UH11
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: April 27, 2001
Last modified: November 30, 2016
This is version 157 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.