Q14558 (KPRA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphoribosyl pyrophosphate synthase-associated protein 1 Short name=PRPP synthase-associated protein 1 Alternative name(s): 39 kDa phosphoribosypyrophosphate synthase-associated protein Short name=PAP39 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 356 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis. |
| Subunit structure | Binds to PRPS1 and PRPS2. |
| Tissue specificity | Ubiquitous. |
| Sequence similarities | Belongs to the ribose-phosphate pyrophosphokinase family. |
| Sequence caution | The sequence BAG35521.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Nucleotide biosynthesis |
| Coding sequence diversity | Alternative splicing |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | nucleotide biosynthetic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | enzyme inhibitor activity Traceable author statement. Source: ProtInc magnesium ion bindingInferred from electronic annotation. Source: InterPro ribose phosphate diphosphokinase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q14558-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q14558-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MPKKLLLLPPPSASSAFRVPRARPVPPPAM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 356 | 356 | Phosphoribosyl pyrophosphate synthase-associated protein 1 | PRO_0000141079 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 215 | 1 | Phosphoserine Ref.6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MPKKLLLLPPPSASSAFRVP RARPVPPPAM in isoform 2. | VSP_039062 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 12 | 1 | S → L in BAA09612. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 54 | 1 | S → F in BAA09612. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 9 – 12 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 17 – 20 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 21 – 29 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 37 – 41 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 47 – 51 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 60 – 63 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 70 – 86 | 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 92 – 98 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 100 – 105 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 109 – 111 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 114 – 124 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 134 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 138 – 143 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 148 – 151 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 154 – 164 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 168 – 170 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 172 – 177 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 178 – 180 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 181 – 191 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 194 – 198 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 243 – 245 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 250 – 255 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 257 – 261 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 263 – 273 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 274 – 276 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 277 – 287 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 293 – 299 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 304 – 308 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 314 – 319 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 323 – 326 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 329 – 341 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 346 – 349 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and sequencing of human complementary DNA for the phosphoribosylpyrophosphate synthetase-associated protein 39." Ishizuka T., Kita K., Sonoda T., Ishijima S., Sawa K., Suzuki N., Tatibana M. Biochim. Biophys. Acta 1306:27-30(1996) [PubMed: 8611620] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Hepatoma. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lung. |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1/2). Tissue: Brain. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [9] | "Crystal structure of human phosphoribosylpyrophosphate synthetase-associated protein 39 (Pap39)." Structural genomics consortium (SGC) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.65 ANGSTROMS) OF 5-361. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D61391 mRNA. Translation: BAA09612.1. AK312637 mRNA. Translation: BAG35521.1. Different initiation. AC090699 Genomic DNA. No translation available. CH471099 Genomic DNA. Translation: EAW89386.1. BC009012 mRNA. Translation: AAH09012.1. | ||||||||||||
| IPI | IPI00291578. IPI00797603. | ||||||||||||
| PIR | S71460. | ||||||||||||
| RefSeq | NP_002757.2. NM_002766.2. | ||||||||||||
| UniGene | Hs.77498. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q14558. | ||||||||||||
| SMR | Q14558. Positions 7-350. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q14558. 6 interactions. | ||||||||||||
| MINT | MINT-1387668. | ||||||||||||
| STRING | Q14558. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q14558. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 24418495. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q14558. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000446526; ENSP00000414624; ENSG00000161542. ENST00000448426; ENSP00000399690; ENSG00000161542. | ||||||||||||
| GeneID | 5635. | ||||||||||||
| KEGG | hsa:5635. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5635. | ||||||||||||
| GeneCards | GC17M074306. | ||||||||||||
| H-InvDB | HIX0014196. | ||||||||||||
| HGNC | HGNC:9466. PRPSAP1. | ||||||||||||
| MIM | 601249. gene. | ||||||||||||
| neXtProt | NX_Q14558. | ||||||||||||
| PharmGKB | PA33821. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG16660. | ||||||||||||
| GeneTree | ENSGT00550000074583. | ||||||||||||
| HOGENOM | HBG519284. | ||||||||||||
| HOVERGEN | HBG001520. | ||||||||||||
| InParanoid | Q14558. | ||||||||||||
| OMA | CAKNIIG. | ||||||||||||
| OrthoDB | EOG4C87SQ. | ||||||||||||
| PhylomeDB | Q14558. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q14558. | ||||||||||||
| Bgee | Q14558. | ||||||||||||
| CleanEx | HS_PRPSAP1. | ||||||||||||
| Genevestigator | Q14558. | ||||||||||||
| GermOnline | ENSG00000161542. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR005946. Rib-P_diPkinase. [Graphical view] | ||||||||||||
| TIGRFAMs | TIGR01251. RibP_PPkin. 1 hit. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 21898. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | KPRA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14558 Secondary accession number(s): B2R6M4, Q96H06 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with