Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phosphoribosyl pyrophosphate synthase-associated protein 1

Gene

PRPSAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.

GO - Molecular functioni

  • enzyme inhibitor activity Source: ProtInc
  • magnesium ion binding Source: InterPro
  • ribose phosphate diphosphokinase activity Source: InterPro

GO - Biological processi

  • nucleobase-containing compound metabolic process Source: ProtInc
  • nucleotide biosynthetic process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Nucleotide biosynthesis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000161542-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphoribosyl pyrophosphate synthase-associated protein 1
Short name:
PRPP synthase-associated protein 1
Alternative name(s):
39 kDa phosphoribosypyrophosphate synthase-associated protein
Short name:
PAP39
Gene namesi
Name:PRPSAP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:9466. PRPSAP1.

Pathology & Biotechi

Organism-specific databases

DisGeNETi5635.
OpenTargetsiENSG00000161542.
PharmGKBiPA33821.

Polymorphism and mutation databases

BioMutaiPRPSAP1.
DMDMi24418495.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001410791 – 356Phosphoribosyl pyrophosphate synthase-associated protein 1Add BLAST356

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei177PhosphoserineCombined sources1
Modified residuei215PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ14558.
MaxQBiQ14558.
PaxDbiQ14558.
PeptideAtlasiQ14558.
PRIDEiQ14558.

PTM databases

iPTMnetiQ14558.
PhosphoSitePlusiQ14558.

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

BgeeiENSG00000161542.
CleanExiHS_PRPSAP1.
ExpressionAtlasiQ14558. baseline and differential.
GenevisibleiQ14558. HS.

Organism-specific databases

HPAiHPA062396.

Interactioni

Subunit structurei

Binds to PRPS1 and PRPS2.

Binary interactionsi

WithEntry#Exp.IntActNotes
itself4EBI-724449,EBI-724449
PRPS1P608918EBI-724449,EBI-749195
PRPS2P119085EBI-724449,EBI-4290895
PRPSAP2O602564EBI-724449,EBI-724960

Protein-protein interaction databases

BioGridi111618. 31 interactors.
IntActiQ14558. 13 interactors.
MINTiMINT-1387668.
STRINGi9606.ENSP00000414624.

Structurei

Secondary structure

1356
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi9 – 12Combined sources4
Turni17 – 20Combined sources4
Helixi21 – 29Combined sources9
Beta strandi37 – 41Combined sources5
Beta strandi47 – 51Combined sources5
Beta strandi60 – 63Combined sources4
Helixi70 – 86Combined sources17
Beta strandi92 – 98Combined sources7
Turni100 – 105Combined sources6
Beta strandi109 – 111Combined sources3
Helixi114 – 124Combined sources11
Beta strandi129 – 134Combined sources6
Helixi138 – 143Combined sources6
Beta strandi148 – 151Combined sources4
Helixi154 – 164Combined sources11
Helixi168 – 170Combined sources3
Beta strandi172 – 177Combined sources6
Helixi178 – 180Combined sources3
Helixi181 – 191Combined sources11
Beta strandi194 – 198Combined sources5
Beta strandi243 – 245Combined sources3
Beta strandi250 – 255Combined sources6
Beta strandi257 – 261Combined sources5
Helixi263 – 273Combined sources11
Turni274 – 276Combined sources3
Beta strandi277 – 287Combined sources11
Helixi293 – 299Combined sources7
Beta strandi304 – 308Combined sources5
Helixi314 – 319Combined sources6
Beta strandi323 – 326Combined sources4
Helixi329 – 341Combined sources13
Helixi346 – 349Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2C4KX-ray2.65A/B/C/D/E/F5-351[»]
ProteinModelPortaliQ14558.
SMRiQ14558.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14558.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1503. Eukaryota.
COG0462. LUCA.
GeneTreeiENSGT00550000074583.
HOGENOMiHOG000210451.
HOVERGENiHBG001520.
InParanoidiQ14558.
OMAiEAQCTEQ.
OrthoDBiEOG091G0ZG8.
PhylomeDBiQ14558.
TreeFamiTF106367.

Family and domain databases

Gene3Di3.40.50.2020. 2 hits.
InterProiIPR029099. Pribosyltran_N.
IPR029057. PRTase-like.
IPR005946. Rib-P_diPkinase.
[Graphical view]
PfamiPF14572. Pribosyl_synth. 1 hit.
PF13793. Pribosyltran_N. 1 hit.
[Graphical view]
SUPFAMiSSF53271. SSF53271. 2 hits.
TIGRFAMsiTIGR01251. ribP_PPkin. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14558-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNAARTGYRV FSANSTAACT ELAKRITERL GAELGKSVVY QETNGETRVE
60 70 80 90 100
IKESVRGQDI FIIQTIPRDV NTAVMELLIM AYALKTACAR NIIGVIPYFP
110 120 130 140 150
YSKQSKMRKR GSIVCKLLAS MLAKAGLTHI ITMDLHQKEI QGFFSFPVDN
160 170 180 190 200
LRASPFLLQY IQEEIPNYRN AVIVAKSPDA AKRAQSYAER LRLGLAVIHG
210 220 230 240 250
EAQCTELDMD DGRHSPPMVK NATVHPGLEL PLMMAKEKPP ITVVGDVGGR
260 270 280 290 300
IAIIVDDIID DVESFVAAAE ILKERGAYKI YVMATHGILS AEAPRLIEES
310 320 330 340 350
SVDEVVVTNT VPHEVQKLQC PKIKTVDISL ILSEAIRRIH NGESMAYLFR

NITVDD
Length:356
Mass (Da):39,394
Last modified:October 25, 2002 - v2
Checksum:i38CC87AB2C555717
GO
Isoform 2 (identifier: Q14558-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPKKLLLLPPPSASSAFRVPRARPVPPPAM

Show »
Length:385
Mass (Da):42,467
Checksum:i3B9521CCB154F05D
GO

Sequence cautioni

The sequence BAG35521 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12S → L in BAA09612 (PubMed:8611620).Curated1
Sequence conflicti54S → F in BAA09612 (PubMed:8611620).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0390621M → MPKKLLLLPPPSASSAFRVP RARPVPPPAM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D61391 mRNA. Translation: BAA09612.1.
AK312637 mRNA. Translation: BAG35521.1. Different initiation.
AC090699 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89386.1.
BC009012 mRNA. Translation: AAH09012.1.
CCDSiCCDS11743.2. [Q14558-2]
PIRiS71460.
RefSeqiNP_002757.2. NM_002766.2. [Q14558-2]
UniGeneiHs.77498.

Genome annotation databases

EnsembliENST00000446526; ENSP00000414624; ENSG00000161542. [Q14558-2]
GeneIDi5635.
KEGGihsa:5635.
UCSCiuc010wta.2. human. [Q14558-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D61391 mRNA. Translation: BAA09612.1.
AK312637 mRNA. Translation: BAG35521.1. Different initiation.
AC090699 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89386.1.
BC009012 mRNA. Translation: AAH09012.1.
CCDSiCCDS11743.2. [Q14558-2]
PIRiS71460.
RefSeqiNP_002757.2. NM_002766.2. [Q14558-2]
UniGeneiHs.77498.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2C4KX-ray2.65A/B/C/D/E/F5-351[»]
ProteinModelPortaliQ14558.
SMRiQ14558.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111618. 31 interactors.
IntActiQ14558. 13 interactors.
MINTiMINT-1387668.
STRINGi9606.ENSP00000414624.

PTM databases

iPTMnetiQ14558.
PhosphoSitePlusiQ14558.

Polymorphism and mutation databases

BioMutaiPRPSAP1.
DMDMi24418495.

Proteomic databases

EPDiQ14558.
MaxQBiQ14558.
PaxDbiQ14558.
PeptideAtlasiQ14558.
PRIDEiQ14558.

Protocols and materials databases

DNASUi5635.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000446526; ENSP00000414624; ENSG00000161542. [Q14558-2]
GeneIDi5635.
KEGGihsa:5635.
UCSCiuc010wta.2. human. [Q14558-1]

Organism-specific databases

CTDi5635.
DisGeNETi5635.
GeneCardsiPRPSAP1.
HGNCiHGNC:9466. PRPSAP1.
HPAiHPA062396.
MIMi601249. gene.
neXtProtiNX_Q14558.
OpenTargetsiENSG00000161542.
PharmGKBiPA33821.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1503. Eukaryota.
COG0462. LUCA.
GeneTreeiENSGT00550000074583.
HOGENOMiHOG000210451.
HOVERGENiHBG001520.
InParanoidiQ14558.
OMAiEAQCTEQ.
OrthoDBiEOG091G0ZG8.
PhylomeDBiQ14558.
TreeFamiTF106367.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000161542-MONOMER.

Miscellaneous databases

EvolutionaryTraceiQ14558.
GeneWikiiPRPSAP1.
GenomeRNAii5635.
PROiQ14558.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000161542.
CleanExiHS_PRPSAP1.
ExpressionAtlasiQ14558. baseline and differential.
GenevisibleiQ14558. HS.

Family and domain databases

Gene3Di3.40.50.2020. 2 hits.
InterProiIPR029099. Pribosyltran_N.
IPR029057. PRTase-like.
IPR005946. Rib-P_diPkinase.
[Graphical view]
PfamiPF14572. Pribosyl_synth. 1 hit.
PF13793. Pribosyltran_N. 1 hit.
[Graphical view]
SUPFAMiSSF53271. SSF53271. 2 hits.
TIGRFAMsiTIGR01251. ribP_PPkin. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiKPRA_HUMAN
AccessioniPrimary (citable) accession number: Q14558
Secondary accession number(s): B2R6M4, Q96H06
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 25, 2002
Last sequence update: October 25, 2002
Last modified: November 30, 2016
This is version 146 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.