Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hepatocyte nuclear factor 4-gamma

Gene

HNF4G

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Transcription factor. Has a lower transcription activation potential than HNF4-alpha.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi9 – 84Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
Zinc fingeri12 – 32NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri48 – 72NR C4-typePROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000164749-MONOMER.
ReactomeiR-HSA-210745. Regulation of gene expression in beta cells.
R-HSA-383280. Nuclear Receptor transcription pathway.
SignaLinkiQ14541.
SIGNORiQ14541.

Names & Taxonomyi

Protein namesi
Recommended name:
Hepatocyte nuclear factor 4-gamma
Short name:
HNF-4-gamma
Alternative name(s):
Nuclear receptor subfamily 2 group A member 2
Gene namesi
Name:HNF4G
Synonyms:NR2A2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:5026. HNF4G.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi3174.
OpenTargetsiENSG00000164749.
PharmGKBiPA29351.

Chemistry databases

ChEMBLiCHEMBL1961786.

Polymorphism and mutation databases

BioMutaiHNF4G.
DMDMi160110004.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000535621 – 408Hepatocyte nuclear factor 4-gammaAdd BLAST408

Proteomic databases

MaxQBiQ14541.
PaxDbiQ14541.
PeptideAtlasiQ14541.
PRIDEiQ14541.

PTM databases

iPTMnetiQ14541.
PhosphoSitePlusiQ14541.

Expressioni

Tissue specificityi

Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen.

Gene expression databases

BgeeiENSG00000164749.
CleanExiHS_HNF4G.
ExpressionAtlasiQ14541. baseline and differential.
GenevisibleiQ14541. HS.

Organism-specific databases

HPAiHPA005438.

Interactioni

Protein-protein interaction databases

BioGridi109416. 14 interactors.
STRINGi9606.ENSP00000379701.

Structurei

Secondary structure

1408
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi103 – 116Combined sources14
Helixi136 – 155Combined sources20
Helixi158 – 161Combined sources4
Helixi167 – 174Combined sources8
Helixi176 – 188Combined sources13
Beta strandi191 – 196Combined sources6
Beta strandi202 – 204Combined sources3
Turni210 – 212Combined sources3
Helixi213 – 222Combined sources10
Helixi224 – 230Combined sources7
Helixi234 – 245Combined sources12
Helixi256 – 275Combined sources20
Beta strandi277 – 280Combined sources4
Turni281 – 283Combined sources3
Helixi284 – 289Combined sources6
Helixi292 – 311Combined sources20
Helixi319 – 324Combined sources6
Turni325 – 327Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LV2X-ray2.70A103-328[»]
ProteinModelPortaliQ14541.
SMRiQ14541.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14541.

Family & Domainsi

Sequence similaritiesi

Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri12 – 32NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri48 – 72NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG4215. Eukaryota.
ENOG410XQT8. LUCA.
GeneTreeiENSGT00760000118948.
HOGENOMiHOG000260822.
HOVERGENiHBG005606.
InParanoidiQ14541.
KOiK08037.
OMAiEMANYSE.
PhylomeDBiQ14541.
TreeFamiTF352097.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR003068. COUP_TF.
IPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR01282. COUPTNFACTOR.
PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14541-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNTTDNGVNC LCAICGDRAT GKHYGASSCD GCKGFFRRSI RKSHVYSCRF
60 70 80 90 100
SRQCVVDKDK RNQCRYCRLR KCFRAGMKKE AVQNERDRIS TRRSTFDGSN
110 120 130 140 150
IPSINTLAQA EVRSRQISVS SPGSSTDINV KKIASIGDVC ESMKQQLLVL
160 170 180 190 200
VEWAKYIPAF CELPLDDQVA LLRAHAGEHL LLGATKRSMM YKDILLLGNN
210 220 230 240 250
YVIHRNSCEV EISRVANRVL DELVRPFQEI QIDDNEYACL KAIVFFDPDA
260 270 280 290 300
KGLSDPVKIK NMRFQVQIGL EDYINDRQYD SRGRFGELLL LLPTLQSITW
310 320 330 340 350
QMIEQIQFVK LFGMVKIDNL LQEMLLGGAS NDGSHLHHPM HPHLSQDPLT
360 370 380 390 400
GQTILLGPMS TLVHADQIST PETPLPSPPQ GSGQEQYKIA ANQASVISHQ

HLSKQKQL
Length:408
Mass (Da):45,877
Last modified:November 13, 2007 - v3
Checksum:iC75410E10251AE9F
GO
Isoform 2 (identifier: Q14541-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSM

Show »
Length:445
Mass (Da):50,041
Checksum:iCA8F19E4AF99E81B
GO

Sequence cautioni

The sequence CAE11875 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28S → T in CAA89990 (PubMed:8622695).Curated1
Sequence conflicti28S → T in AAF00110 (PubMed:10512380).Curated1
Sequence conflicti45V → I in CAA89990 (PubMed:8622695).Curated1
Sequence conflicti45V → I in AAF00110 (PubMed:10512380).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_009704190M → I.1 PublicationCorresponds to variant rs1805098dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0376911M → MDMANYSEVLDPTYTTLEFE TMQILYNSSDSSAPETSM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z49826 mRNA. Translation: CAA89990.2.
BX571750 mRNA. Translation: CAE11875.1. Different initiation.
AF133504
, AF133496, AF133497, AF133498, AF133499, AF133500, AF133501, AF133502, AF133503 Genomic DNA. Translation: AAF00110.1.
AF207953 Genomic DNA. No translation available.
BC105009 mRNA. Translation: AAI05010.1.
BC105011 mRNA. Translation: AAI05012.1.
CCDSiCCDS6220.2. [Q14541-2]
CCDS83303.1. [Q14541-1]
PIRiJC6095.
RefSeqiNP_001317490.1. NM_001330561.1.
NP_004124.4. NM_004133.4. [Q14541-2]
XP_016868862.1. XM_017013373.1. [Q14541-1]
XP_016868863.1. XM_017013374.1. [Q14541-1]
XP_016868864.1. XM_017013375.1. [Q14541-1]
XP_016868865.1. XM_017013376.1. [Q14541-1]
UniGeneiHs.241529.

Genome annotation databases

EnsembliENST00000354370; ENSP00000346339; ENSG00000164749. [Q14541-1]
ENST00000396423; ENSP00000379701; ENSG00000164749. [Q14541-2]
GeneIDi3174.
KEGGihsa:3174.
UCSCiuc003yaq.4. human. [Q14541-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Hepatocyte nuclear factors entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z49826 mRNA. Translation: CAA89990.2.
BX571750 mRNA. Translation: CAE11875.1. Different initiation.
AF133504
, AF133496, AF133497, AF133498, AF133499, AF133500, AF133501, AF133502, AF133503 Genomic DNA. Translation: AAF00110.1.
AF207953 Genomic DNA. No translation available.
BC105009 mRNA. Translation: AAI05010.1.
BC105011 mRNA. Translation: AAI05012.1.
CCDSiCCDS6220.2. [Q14541-2]
CCDS83303.1. [Q14541-1]
PIRiJC6095.
RefSeqiNP_001317490.1. NM_001330561.1.
NP_004124.4. NM_004133.4. [Q14541-2]
XP_016868862.1. XM_017013373.1. [Q14541-1]
XP_016868863.1. XM_017013374.1. [Q14541-1]
XP_016868864.1. XM_017013375.1. [Q14541-1]
XP_016868865.1. XM_017013376.1. [Q14541-1]
UniGeneiHs.241529.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LV2X-ray2.70A103-328[»]
ProteinModelPortaliQ14541.
SMRiQ14541.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109416. 14 interactors.
STRINGi9606.ENSP00000379701.

Chemistry databases

ChEMBLiCHEMBL1961786.

PTM databases

iPTMnetiQ14541.
PhosphoSitePlusiQ14541.

Polymorphism and mutation databases

BioMutaiHNF4G.
DMDMi160110004.

Proteomic databases

MaxQBiQ14541.
PaxDbiQ14541.
PeptideAtlasiQ14541.
PRIDEiQ14541.

Protocols and materials databases

DNASUi3174.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354370; ENSP00000346339; ENSG00000164749. [Q14541-1]
ENST00000396423; ENSP00000379701; ENSG00000164749. [Q14541-2]
GeneIDi3174.
KEGGihsa:3174.
UCSCiuc003yaq.4. human. [Q14541-1]

Organism-specific databases

CTDi3174.
DisGeNETi3174.
GeneCardsiHNF4G.
H-InvDBHIX0007597.
HGNCiHGNC:5026. HNF4G.
HPAiHPA005438.
MIMi605966. gene.
neXtProtiNX_Q14541.
OpenTargetsiENSG00000164749.
PharmGKBiPA29351.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4215. Eukaryota.
ENOG410XQT8. LUCA.
GeneTreeiENSGT00760000118948.
HOGENOMiHOG000260822.
HOVERGENiHBG005606.
InParanoidiQ14541.
KOiK08037.
OMAiEMANYSE.
PhylomeDBiQ14541.
TreeFamiTF352097.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000164749-MONOMER.
ReactomeiR-HSA-210745. Regulation of gene expression in beta cells.
R-HSA-383280. Nuclear Receptor transcription pathway.
SignaLinkiQ14541.
SIGNORiQ14541.

Miscellaneous databases

ChiTaRSiHNF4G. human.
EvolutionaryTraceiQ14541.
GeneWikiiHepatocyte_nuclear_factor_4_gamma.
GenomeRNAii3174.
PROiQ14541.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000164749.
CleanExiHS_HNF4G.
ExpressionAtlasiQ14541. baseline and differential.
GenevisibleiQ14541. HS.

Family and domain databases

Gene3Di1.10.565.10. 1 hit.
3.30.50.10. 1 hit.
InterProiIPR003068. COUP_TF.
IPR000536. Nucl_hrmn_rcpt_lig-bd.
IPR001723. Nuclear_hrmn_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR01282. COUPTNFACTOR.
PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiHNF4G_HUMAN
AccessioniPrimary (citable) accession number: Q14541
Secondary accession number(s): Q7Z2V9, Q9UH81, Q9UIS6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 13, 2007
Last modified: November 30, 2016
This is version 171 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.