Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hepatocyte nuclear factor 4-gamma

Gene

HNF4G

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcription factor. Has a lower transcription activation potential than HNF4-alpha.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi9 – 84Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
Zinc fingeri12 – 32NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri48 – 72NR C4-typePROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-210745 Regulation of gene expression in beta cells
R-HSA-383280 Nuclear Receptor transcription pathway
SignaLinkiQ14541
SIGNORiQ14541

Names & Taxonomyi

Protein namesi
Recommended name:
Hepatocyte nuclear factor 4-gamma
Short name:
HNF-4-gamma
Alternative name(s):
Nuclear receptor subfamily 2 group A member 2
Gene namesi
Name:HNF4G
Synonyms:NR2A2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000164749.11
HGNCiHGNC:5026 HNF4G
MIMi605966 gene
neXtProtiNX_Q14541

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi3174
OpenTargetsiENSG00000164749
PharmGKBiPA29351

Chemistry databases

ChEMBLiCHEMBL1961786
DrugBankiDB03796 Palmitic Acid

Polymorphism and mutation databases

BioMutaiHNF4G
DMDMi160110004

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000535621 – 408Hepatocyte nuclear factor 4-gammaAdd BLAST408

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei94PhosphoserineBy similarity1
Modified residuei370PhosphothreonineBy similarity1
Modified residuei373PhosphothreonineBy similarity1
Modified residuei377PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ14541
PaxDbiQ14541
PeptideAtlasiQ14541
PRIDEiQ14541

PTM databases

iPTMnetiQ14541
PhosphoSitePlusiQ14541

Expressioni

Tissue specificityi

Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen.

Gene expression databases

BgeeiENSG00000164749
CleanExiHS_HNF4G
ExpressionAtlasiQ14541 baseline and differential
GenevisibleiQ14541 HS

Organism-specific databases

HPAiHPA005438
HPA010610

Interactioni

Protein-protein interaction databases

BioGridi109416, 14 interactors
STRINGi9606.ENSP00000379701

Structurei

Secondary structure

1408
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi103 – 116Combined sources14
Helixi136 – 155Combined sources20
Helixi158 – 161Combined sources4
Helixi167 – 174Combined sources8
Helixi176 – 188Combined sources13
Beta strandi191 – 196Combined sources6
Beta strandi202 – 204Combined sources3
Turni210 – 212Combined sources3
Helixi213 – 222Combined sources10
Helixi224 – 230Combined sources7
Helixi234 – 245Combined sources12
Helixi256 – 275Combined sources20
Beta strandi277 – 280Combined sources4
Turni281 – 283Combined sources3
Helixi284 – 289Combined sources6
Helixi292 – 311Combined sources20
Helixi319 – 324Combined sources6
Turni325 – 327Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LV2X-ray2.70A103-328[»]
ProteinModelPortaliQ14541
SMRiQ14541
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14541

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini99 – 328NR LBDPROSITE-ProRule annotationAdd BLAST230

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri12 – 32NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri48 – 72NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG4215 Eukaryota
ENOG410XQT8 LUCA
GeneTreeiENSGT00760000118948
HOGENOMiHOG000260822
HOVERGENiHBG005606
InParanoidiQ14541
KOiK08037
OMAiHTDQIST
PhylomeDBiQ14541
TreeFamiTF352097

Family and domain databases

Gene3Di3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR003068 COUP_TF
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR01282 COUPTNFACTOR
PR00398 STRDHORMONER
PR00047 STROIDFINGER
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14541-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNTTDNGVNC LCAICGDRAT GKHYGASSCD GCKGFFRRSI RKSHVYSCRF
60 70 80 90 100
SRQCVVDKDK RNQCRYCRLR KCFRAGMKKE AVQNERDRIS TRRSTFDGSN
110 120 130 140 150
IPSINTLAQA EVRSRQISVS SPGSSTDINV KKIASIGDVC ESMKQQLLVL
160 170 180 190 200
VEWAKYIPAF CELPLDDQVA LLRAHAGEHL LLGATKRSMM YKDILLLGNN
210 220 230 240 250
YVIHRNSCEV EISRVANRVL DELVRPFQEI QIDDNEYACL KAIVFFDPDA
260 270 280 290 300
KGLSDPVKIK NMRFQVQIGL EDYINDRQYD SRGRFGELLL LLPTLQSITW
310 320 330 340 350
QMIEQIQFVK LFGMVKIDNL LQEMLLGGAS NDGSHLHHPM HPHLSQDPLT
360 370 380 390 400
GQTILLGPMS TLVHADQIST PETPLPSPPQ GSGQEQYKIA ANQASVISHQ

HLSKQKQL
Length:408
Mass (Da):45,877
Last modified:November 13, 2007 - v3
Checksum:iC75410E10251AE9F
GO
Isoform 2 (identifier: Q14541-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSM

Show »
Length:445
Mass (Da):50,041
Checksum:iCA8F19E4AF99E81B
GO

Sequence cautioni

The sequence CAE11875 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti28S → T in CAA89990 (PubMed:8622695).Curated1
Sequence conflicti28S → T in AAF00110 (PubMed:10512380).Curated1
Sequence conflicti45V → I in CAA89990 (PubMed:8622695).Curated1
Sequence conflicti45V → I in AAF00110 (PubMed:10512380).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_009704190M → I1 PublicationCorresponds to variant dbSNP:rs1805098Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0376911M → MDMANYSEVLDPTYTTLEFE TMQILYNSSDSSAPETSM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z49826 mRNA Translation: CAA89990.2
BX571750 mRNA Translation: CAE11875.1 Different initiation.
AF133504
, AF133496, AF133497, AF133498, AF133499, AF133500, AF133501, AF133502, AF133503 Genomic DNA Translation: AAF00110.1
AF207953 Genomic DNA No translation available.
BC105009 mRNA Translation: AAI05010.1
BC105011 mRNA Translation: AAI05012.1
CCDSiCCDS6220.2 [Q14541-2]
CCDS83303.1 [Q14541-1]
PIRiJC6095
RefSeqiNP_001317490.1, NM_001330561.1 [Q14541-1]
NP_004124.4, NM_004133.4 [Q14541-2]
XP_016868862.1, XM_017013373.1 [Q14541-1]
XP_016868863.1, XM_017013374.1 [Q14541-1]
XP_016868864.1, XM_017013375.1 [Q14541-1]
XP_016868865.1, XM_017013376.1 [Q14541-1]
UniGeneiHs.241529

Genome annotation databases

EnsembliENST00000354370; ENSP00000346339; ENSG00000164749 [Q14541-1]
ENST00000396423; ENSP00000379701; ENSG00000164749 [Q14541-2]
GeneIDi3174
KEGGihsa:3174
UCSCiuc003yaq.4 human [Q14541-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiHNF4G_HUMAN
AccessioniPrimary (citable) accession number: Q14541
Secondary accession number(s): Q7Z2V9, Q9UH81, Q9UIS6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: November 13, 2007
Last modified: May 23, 2018
This is version 185 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health