A major human epididymis-specific cDNA encodes a protein with sequence homology to extracellular proteinase inhibitors.

Q14508 A2A2A5 A2A2A6 A6PVD5 Q6IB27 Q8WXV9 Q8WXW0 Q8WXW1 Q8WXW2 Q96KJ1 WFDC2_HUMAN WAP four-disulfide core domain protein 2 Epididymal secretory protein E4 Major epididymis-specific protein E4 Putative protease inhibitor WAP5 WFDC2 HE4 WAP5 Homo sapiens Human Eukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mammalia Eutheria Euarchontoglires Primates Haplorrhini Catarrhini Hominidae Homo A major human epididymis-specific cDNA encodes a protein with sequence homology to extracellular proteinase inhibitors. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1) Epididymis The putative ovarian tumour marker gene HE4 (WFDC2), is expressed in normal tissues and undergoes complex alternative splicing to yield multiple protein isoforms. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5) The HE4 (WFDC2) protein is a biomarker for ovarian carcinoma. NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1) Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1) The DNA sequence and comparative analysis of human chromosome 20. NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1) Colon Human epididymis protein 4 (HE4) is a secreted glycoprotein that is overexpressed by serous and endometrioid ovarian carcinomas. SUBCELLULAR LOCATION TISSUE SPECIFICITY Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry. GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-44 MASS SPECTROMETRY Saliva Secreted Q14508-1 1 Q14508-2 2 HE4-V3 Q14508-3 3 HE4-V2 Q14508-4 4 HE4-V1 Q14508-5 5 HE4-V4 Additional isoforms seem to exist. Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis. Contains 2 WAP domains. Alternative splicing Complete proteome Disulfide bond Glycoprotein Protease inhibitor Reference proteome Repeat Secreted Serine protease inhibitor Signal PACRLGPLAAALLLSLLLFGFT LQVQVNLPVSPLPTYPYSFFYP SLPNDKEGS LLCPNGQLAE DKEGSCPQVNINFPQLGLCRDQCQVDSQ ALFHWHLKTRRLWEISGPRPRRPTWDSS SL LLC S T MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLK CCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCV TPNF Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms Distributed under the Creative Commons Attribution-NoDerivs License