Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

G-protein coupled receptor 176

Gene

GPR176

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Orphan receptor involved in normal circadian rhythm behavior. Acts through the G-protein subclass G(z)-alpha and has an agonist-independent basal activity to repress cAMP production.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer
Biological processBiological rhythms

Enzyme and pathway databases

ReactomeiR-HSA-418555. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
G-protein coupled receptor 176
Alternative name(s):
HB-954
Gene namesi
Name:GPR176
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:32370. GPR176.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 42ExtracellularCuratedAdd BLAST42
Transmembranei43 – 63Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini64 – 82CytoplasmicCuratedAdd BLAST19
Transmembranei83 – 103Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini104 – 118ExtracellularCuratedAdd BLAST15
Transmembranei119 – 139Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini140 – 160CytoplasmicCuratedAdd BLAST21
Transmembranei161 – 181Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini182 – 207ExtracellularCuratedAdd BLAST26
Transmembranei208 – 228Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini229 – 267CytoplasmicCuratedAdd BLAST39
Transmembranei268 – 288Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini289 – 299ExtracellularCuratedAdd BLAST11
Transmembranei300 – 320Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini321 – 515CytoplasmicCuratedAdd BLAST195

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • plasma membrane Source: UniProtKB

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi11245.
OpenTargetsiENSG00000166073.
PharmGKBiPA142671712.

Polymorphism and mutation databases

DMDMi74754475.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000696561 – 515G-protein coupled receptor 176Add BLAST515

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi4N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi11N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi17N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi27N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ14439.
PaxDbiQ14439.
PeptideAtlasiQ14439.
PRIDEiQ14439.

PTM databases

iPTMnetiQ14439.
PhosphoSitePlusiQ14439.

Expressioni

Gene expression databases

BgeeiENSG00000166073.
CleanExiHS_GPR176.
ExpressionAtlasiQ14439. baseline and differential.
GenevisibleiQ14439. HS.

Organism-specific databases

HPAiHPA039943.
HPA039979.

Interactioni

Protein-protein interaction databases

IntActiQ14439. 2 interactors.
STRINGi9606.ENSP00000453076.

Structurei

3D structure databases

ProteinModelPortaliQ14439.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00790000123027.
HOGENOMiHOG000231854.
HOVERGENiHBG080463.
InParanoidiQ14439.
KOiK08442.
OMAiIWAHAVV.
OrthoDBiEOG091G032V.
PhylomeDBiQ14439.
TreeFamiTF331506.

Family and domain databases

InterProiView protein in InterPro
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
PfamiView protein in Pfam
PF00001. 7tm_1. 1 hit.
PRINTSiPR00237. GPCRRHODOPSN.
PROSITEiView protein in PROSITE
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14439-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGHNGSWISP NASEPHNASG AEAAGVNRSA LGEFGEAQLY RQFTTTVQVV
60 70 80 90 100
IFIGSLLGNF MVLWSTCRTT VFKSVTNRFI KNLACSGICA SLVCVPFDII
110 120 130 140 150
LSTSPHCCWW IYTMLFCKVV KFLHKVFCSV TILSFPAIAL DRYYSVLYPL
160 170 180 190 200
ERKISDAKSR ELVMYIWAHA VVASVPVFAV TNVADIYATS TCTEVWSNSL
210 220 230 240 250
GHLVYVLVYN ITTVIVPVVV VFLFLILIRR ALSASQKKKV IIAALRTPQN
260 270 280 290 300
TISIPYASQR EAELHATLLS MVMVFILCSV PYATLVVYQT VLNVPDTSVF
310 320 330 340 350
LLLTAVWLPK VSLLANPVLF LTVNKSVRKC LIGTLVQLHH RYSRRNVVST
360 370 380 390 400
GSGMAEASLE PSIRSGSQLL EMFHIGQQQI FKPTEDEEES EAKYIGSADF
410 420 430 440 450
QAKEIFSTCL EGEQGPQFAP SAPPLSTVDS VSQVAPAAPV EPETFPDKYS
460 470 480 490 500
LQFGFGPFEL PPQWLSETRN SKKRLLPPLG NTPEELIQTK VPKVGRVERK
510
MSRNNKVSIF PKVDS
Length:515
Mass (Da):56,998
Last modified:November 1, 1996 - v1
Checksum:iDE21C57952BB6D12
GO
Isoform 2 (identifier: Q14439-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MGHNGSWISPNASEPHNASGAEAAGVNRSALGEFGEAQLYRQFTTTVQVVIFIGSL → MPAPLLLISRT

Show »
Length:470
Mass (Da):52,333
Checksum:i4AFF31FDABA55D2F
GO
Isoform 3 (identifier: Q14439-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-78: GNFMVLWSTCRTTVFKSVTNR → EFGNMEVTRKLDKSRLPGIK

Show »
Length:514
Mass (Da):56,869
Checksum:iF87CC40FAC5D5D66
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0588451 – 56MGHNG…FIGSL → MPAPLLLISRT in isoform 2. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_05884658 – 78GNFMV…SVTNR → EFGNMEVTRKLDKSRLPGIK in isoform 3. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D38449 mRNA. Translation: BAA07481.1.
JQ308174 mRNA. Translation: AFF59484.1.
AK302715 mRNA. Translation: BAG63935.1.
AC012377 Genomic DNA. No translation available.
AC023908 Genomic DNA. No translation available.
CH471125 Genomic DNA. Translation: EAW92386.1.
BC067106 mRNA. Translation: AAH67106.1.
CCDSiCCDS10051.1. [Q14439-1]
PIRiS53525.
RefSeqiNP_001258783.1. NM_001271854.1.
NP_001258784.1. NM_001271855.1.
NP_009154.1. NM_007223.2.
UniGeneiHs.37196.

Genome annotation databases

EnsembliENST00000299092; ENSP00000299092; ENSG00000166073. [Q14439-3]
ENST00000561100; ENSP00000453076; ENSG00000166073. [Q14439-1]
GeneIDi11245.
KEGGihsa:11245.
UCSCiuc001zkj.3. human. [Q14439-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D38449 mRNA. Translation: BAA07481.1.
JQ308174 mRNA. Translation: AFF59484.1.
AK302715 mRNA. Translation: BAG63935.1.
AC012377 Genomic DNA. No translation available.
AC023908 Genomic DNA. No translation available.
CH471125 Genomic DNA. Translation: EAW92386.1.
BC067106 mRNA. Translation: AAH67106.1.
CCDSiCCDS10051.1. [Q14439-1]
PIRiS53525.
RefSeqiNP_001258783.1. NM_001271854.1.
NP_001258784.1. NM_001271855.1.
NP_009154.1. NM_007223.2.
UniGeneiHs.37196.

3D structure databases

ProteinModelPortaliQ14439.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ14439. 2 interactors.
STRINGi9606.ENSP00000453076.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiQ14439.
PhosphoSitePlusiQ14439.

Polymorphism and mutation databases

DMDMi74754475.

Proteomic databases

EPDiQ14439.
PaxDbiQ14439.
PeptideAtlasiQ14439.
PRIDEiQ14439.

Protocols and materials databases

DNASUi11245.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000299092; ENSP00000299092; ENSG00000166073. [Q14439-3]
ENST00000561100; ENSP00000453076; ENSG00000166073. [Q14439-1]
GeneIDi11245.
KEGGihsa:11245.
UCSCiuc001zkj.3. human. [Q14439-1]

Organism-specific databases

CTDi11245.
DisGeNETi11245.
GeneCardsiGPR176.
HGNCiHGNC:32370. GPR176.
HPAiHPA039943.
HPA039979.
MIMi612183. gene.
neXtProtiNX_Q14439.
OpenTargetsiENSG00000166073.
PharmGKBiPA142671712.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
GeneTreeiENSGT00790000123027.
HOGENOMiHOG000231854.
HOVERGENiHBG080463.
InParanoidiQ14439.
KOiK08442.
OMAiIWAHAVV.
OrthoDBiEOG091G032V.
PhylomeDBiQ14439.
TreeFamiTF331506.

Enzyme and pathway databases

ReactomeiR-HSA-418555. G alpha (s) signalling events.

Miscellaneous databases

GeneWikiiGPR176.
GenomeRNAii11245.
PROiPR:Q14439.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000166073.
CleanExiHS_GPR176.
ExpressionAtlasiQ14439. baseline and differential.
GenevisibleiQ14439. HS.

Family and domain databases

InterProiView protein in InterPro
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
PfamiView protein in Pfam
PF00001. 7tm_1. 1 hit.
PRINTSiPR00237. GPCRRHODOPSN.
PROSITEiView protein in PROSITE
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiGP176_HUMAN
AccessioniPrimary (citable) accession number: Q14439
Secondary accession number(s): B4DZ23
, H9NIL9, J3KNC6, Q6NXF6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: November 1, 1996
Last modified: May 10, 2017
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.