Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14246

- EMR1_HUMAN

UniProt

Q14246 - EMR1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

EGF-like module-containing mucin-like hormone receptor-like 1

Gene

EMR1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Could be involved in cell-cell interactions.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. G-protein coupled receptor activity Source: ProtInc

GO - Biological processi

  1. cell adhesion Source: ProtInc
  2. G-protein coupled receptor signaling pathway Source: ProtInc
  3. neuropeptide signaling pathway Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_18372. Class B/2 (Secretin family receptors).

Protein family/group databases

MEROPSiI63.001.
TCDBi9.A.14.6.1. the g-protein-coupled receptor (gpcr) family.

Names & Taxonomyi

Protein namesi
Recommended name:
EGF-like module-containing mucin-like hormone receptor-like 1
Alternative name(s):
EGF-like module receptor 1
EMR1 hormone receptor
Gene namesi
Name:EMR1
Synonyms:TM7LN3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:3336. EMR1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini21 – 599579ExtracellularSequence AnalysisAdd
BLAST
Transmembranei600 – 62728Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini628 – 6347CytoplasmicSequence Analysis
Transmembranei635 – 65622Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini657 – 66610ExtracellularSequence Analysis
Transmembranei667 – 69024Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini691 – 70919CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei710 – 73122Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini732 – 74716ExtracellularSequence AnalysisAdd
BLAST
Transmembranei748 – 77629Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini777 – 79418CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei795 – 81420Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini815 – 82915ExtracellularSequence AnalysisAdd
BLAST
Transmembranei830 – 85223Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini853 – 88634CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. external side of plasma membrane Source: Ensembl
  2. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27773.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence AnalysisAdd
BLAST
Chaini21 – 886866EGF-like module-containing mucin-like hormone receptor-like 1PRO_0000012873Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi35 ↔ 47PROSITE-ProRule annotation
Disulfide bondi41 ↔ 56PROSITE-ProRule annotation
Disulfide bondi58 ↔ 78PROSITE-ProRule annotation
Disulfide bondi84 ↔ 97PROSITE-ProRule annotation
Disulfide bondi91 ↔ 106PROSITE-ProRule annotation
Glycosylationi94 – 941N-linked (GlcNAc...)Sequence Analysis
Glycosylationi99 – 991N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi108 ↔ 130PROSITE-ProRule annotation
Glycosylationi127 – 1271N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi136 ↔ 148PROSITE-ProRule annotation
Disulfide bondi142 ↔ 157PROSITE-ProRule annotation
Disulfide bondi159 ↔ 170PROSITE-ProRule annotation
Glycosylationi167 – 1671N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi176 ↔ 188PROSITE-ProRule annotation
Disulfide bondi182 ↔ 197PROSITE-ProRule annotation
Glycosylationi189 – 1891N-linked (GlcNAc...)Sequence Analysis
Glycosylationi194 – 1941N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi199 ↔ 219PROSITE-ProRule annotation
Disulfide bondi225 ↔ 235PROSITE-ProRule annotation
Disulfide bondi229 ↔ 244PROSITE-ProRule annotation
Glycosylationi232 – 2321N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi246 ↔ 266PROSITE-ProRule annotation
Glycosylationi258 – 2581N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi272 ↔ 285PROSITE-ProRule annotation
Disulfide bondi279 ↔ 294PROSITE-ProRule annotation
Disulfide bondi296 ↔ 315PROSITE-ProRule annotation
Glycosylationi312 – 3121N-linked (GlcNAc...)Sequence Analysis
Glycosylationi366 – 3661N-linked (GlcNAc...)Sequence Analysis
Glycosylationi375 – 3751N-linked (GlcNAc...)Sequence Analysis
Glycosylationi448 – 4481N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ14246.
PRIDEiQ14246.

PTM databases

PhosphoSiteiQ14246.

Expressioni

Tissue specificityi

Wide expression; increased levels in peripheral blood mononuclear cells.

Gene expression databases

BgeeiQ14246.
CleanExiHS_EMR1.
ExpressionAtlasiQ14246. baseline and differential.
GenevestigatoriQ14246.

Organism-specific databases

HPAiHPA052809.

Interactioni

Protein-protein interaction databases

IntActiQ14246. 1 interaction.
STRINGi9606.ENSP00000311545.

Structurei

3D structure databases

ProteinModelPortaliQ14246.
SMRiQ14246. Positions 38-367, 604-848.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini31 – 7949EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini80 – 13152EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini132 – 17140EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini172 – 22049EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini221 – 26747EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini268 – 31649EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini547 – 59650GPSPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi317 – 599283Ser/Thr-richAdd
BLAST

Sequence similaritiesi

Contains 6 EGF-like domains.PROSITE-ProRule annotation
Contains 1 GPS domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG239437.
GeneTreeiENSGT00760000118787.
HOGENOMiHOG000294115.
HOVERGENiHBG048917.
InParanoidiQ14246.
KOiK04591.
OMAiRNHNTYL.
OrthoDBiEOG7WHH8Q.
PhylomeDBiQ14246.
TreeFamiTF316380.

Family and domain databases

InterProiIPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR017981. GPCR_2-like.
IPR001740. GPCR_2_EMR1_rcpt.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view]
PfamiPF00002. 7tm_2. 1 hit.
PF12662. cEGF. 1 hit.
PF07645. EGF_CA. 4 hits.
PF01825. GPS. 1 hit.
[Graphical view]
PRINTSiPR01128. EMR1HORMONER.
PR00249. GPCRSECRETIN.
SMARTiSM00181. EGF. 1 hit.
SM00179. EGF_CA. 5 hits.
SM00303. GPS. 1 hit.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 1 hit.
PROSITEiPS00010. ASX_HYDROXYL. 6 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 6 hits.
PS01187. EGF_CA. 5 hits.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Comment=Additional isoforms seem to exist.

Isoform 1 (identifier: Q14246-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRGFNLLLFW GCCVMHSWEG HIRPTRKPNT KGNNCRDSTL CPAYATCTNT
60 70 80 90 100
VDSYYCACKQ GFLSSNGQNH FKDPGVRCKD IDECSQSPQP CGPNSSCKNL
110 120 130 140 150
SGRYKCSCLD GFSSPTGNDW VPGKPGNFSC TDINECLTSS VCPEHSDCVN
160 170 180 190 200
SMGSYSCSCQ VGFISRNSTC EDVDECADPR ACPEHATCNN TVGNYSCFCN
210 220 230 240 250
PGFESSSGHL SFQGLKASCE DIDECTEMCP INSTCTNTPG SYFCTCHPGF
260 270 280 290 300
APSNGQLNFT DQGVECRDID ECRQDPSTCG PNSICTNALG SYSCGCIAGF
310 320 330 340 350
HPNPEGSQKD GNFSCQRVLF KCKEDVIPDN KQIQQCQEGT AVKPAYVSFC
360 370 380 390 400
AQINNIFSVL DKVCENKTTV VSLKNTTESF VPVLKQISTW TKFTKEETSS
410 420 430 440 450
LATVFLESVE SMTLASFWKP SANITPAVRT EYLDIESKVI NKECSEENVT
460 470 480 490 500
LDLVAKGDKM KIGCSTIEES ESTETTGVAF VSFVGMESVL NERFFKDHQA
510 520 530 540 550
PLTTSEIKLK MNSRVVGGIM TGEKKDGFSD PIIYTLENIQ PKQKFERPIC
560 570 580 590 600
VSWSTDVKGG RWTSFGCVIL EASETYTICS CNQMANLAVI MASGELTMDF
610 620 630 640 650
SLYIISHVGI IISLVCLVLA IATFLLCRSI RNHNTYLHLH LCVCLLLAKT
660 670 680 690 700
LFLAGIHKTD NKMGCAIIAG FLHYLFLACF FWMLVEAVIL FLMVRNLKVV
710 720 730 740 750
NYFSSRNIKM LHICAFGYGL PMLVVVISAS VQPQGYGMHN RCWLNTETGF
760 770 780 790 800
IWSFLGPVCT VIVINSLLLT WTLWILRQRL SSVNAEVSTL KDTRLLTFKA
810 820 830 840 850
FAQLFILGCS WVLGIFQIGP VAGVMAYLFT IINSLQGAFI FLIHCLLNGQ
860 870 880
VREEYKRWIT GKTKPSSQSQ TSRILLSSMP SASKTG
Length:886
Mass (Da):97,683
Last modified:March 2, 2010 - v3
Checksum:i07322996EEF5A6F1
GO
Isoform 2 (identifier: Q14246-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     599-663: Missing.

Note: No experimental confirmation available.

Show »
Length:821
Mass (Da):90,379
Checksum:i3F57FE01A3F8AC7F
GO
Isoform 3 (identifier: Q14246-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-131: Missing.
     764-764: I → VSKYYNSLAKCVLKEEQGDLRDLEFPGTCAAERI

Note: No experimental confirmation available.

Show »
Length:867
Mass (Da):95,944
Checksum:iDEC584294CD20916
GO
Isoform 4 (identifier: Q14246-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-316: Missing.

Note: No experimental confirmation available.

Show »
Length:709
Mass (Da):78,907
Checksum:i8A817BC4B479F950
GO
Isoform 5 (identifier: Q14246-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-131: Missing.
     132-220: Missing.

Note: No experimental confirmation available.

Show »
Length:745
Mass (Da):82,771
Checksum:i23007B9E3859C5C7
GO

Sequence cautioni

The sequence BAC06133.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti61 – 611G → R in BAH12472. (PubMed:14702039)Curated
Sequence conflicti212 – 2121F → C in CAA57232. (PubMed:7601460)Curated
Sequence conflicti424 – 4241I → A in BAH12475. (PubMed:14702039)Curated
Sequence conflicti430 – 4301T → A in CAA57232. (PubMed:7601460)Curated
Sequence conflicti545 – 5451F → L in BAH12475. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti2 – 21R → L.
Corresponds to variant rs34176643 [ dbSNP | Ensembl ].
VAR_046976
Natural varianti57 – 571A → T.2 Publications
Corresponds to variant rs330877 [ dbSNP | Ensembl ].
VAR_027616
Natural varianti140 – 1401S → R.1 Publication
Corresponds to variant rs330880 [ dbSNP | Ensembl ].
VAR_027617
Natural varianti174 – 1741D → N.1 Publication
Corresponds to variant rs897738 [ dbSNP | Ensembl ].
VAR_027618
Natural varianti254 – 2541N → S.1 Publication
Corresponds to variant rs443658 [ dbSNP | Ensembl ].
VAR_027619
Natural varianti298 – 2981A → V.1 Publication
Corresponds to variant rs370094 [ dbSNP | Ensembl ].
VAR_027620
Natural varianti389 – 3891T → M.1 Publication
Corresponds to variant rs466876 [ dbSNP | Ensembl ].
VAR_027621
Natural varianti424 – 4241I → V.3 Publications
Corresponds to variant rs457857 [ dbSNP | Ensembl ].
VAR_027622
Natural varianti496 – 4961K → Q.3 Publications
Corresponds to variant rs373533 [ dbSNP | Ensembl ].
VAR_027623
Natural varianti539 – 5391I → V.3 Publications
Corresponds to variant rs461645 [ dbSNP | Ensembl ].
VAR_027624
Natural varianti589 – 5891V → I.2 Publications
Corresponds to variant rs7256147 [ dbSNP | Ensembl ].
VAR_027625
Natural varianti663 – 6631M → T.1 Publication
Corresponds to variant rs2228539 [ dbSNP | Ensembl ].
VAR_046977
Natural varianti691 – 6911F → C.
Corresponds to variant rs2229769 [ dbSNP | Ensembl ].
VAR_027626
Natural varianti724 – 7241V → L.
Corresponds to variant rs10406580 [ dbSNP | Ensembl ].
VAR_027627

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei80 – 13152Missing in isoform 3 and isoform 5. 1 PublicationVSP_045521Add
BLAST
Alternative sequencei132 – 22089Missing in isoform 5. 1 PublicationVSP_045522Add
BLAST
Alternative sequencei140 – 316177Missing in isoform 4. 1 PublicationVSP_045523Add
BLAST
Alternative sequencei599 – 66365Missing in isoform 2. 1 PublicationVSP_009594Add
BLAST
Alternative sequencei764 – 7641I → VSKYYNSLAKCVLKEEQGDL RDLEFPGTCAAERI in isoform 3. 1 PublicationVSP_045524

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X81479 mRNA. Translation: CAA57232.1.
AB065918 Genomic DNA. Translation: BAC06133.1. Sequence problems.
DQ217942 Genomic DNA. Translation: ABB70739.1.
AK131562 mRNA. Translation: BAD18695.1.
AK297003 mRNA. Translation: BAH12472.1.
AK297011 mRNA. Translation: BAH12475.1.
AC020895 Genomic DNA. No translation available.
AC025278 Genomic DNA. No translation available.
BC059395 mRNA. Translation: AAH59395.1.
CCDSiCCDS12175.1. [Q14246-1]
CCDS58643.1. [Q14246-4]
CCDS58644.1. [Q14246-2]
CCDS58645.1. [Q14246-3]
CCDS58646.1. [Q14246-5]
PIRiA57172.
RefSeqiNP_001243181.1. NM_001256252.1. [Q14246-3]
NP_001243182.1. NM_001256253.1. [Q14246-2]
NP_001243183.1. NM_001256254.1. [Q14246-5]
NP_001243184.1. NM_001256255.1. [Q14246-4]
NP_001965.3. NM_001974.4. [Q14246-1]
UniGeneiHs.2375.

Genome annotation databases

EnsembliENST00000250572; ENSP00000250572; ENSG00000174837. [Q14246-2]
ENST00000312053; ENSP00000311545; ENSG00000174837. [Q14246-1]
ENST00000381404; ENSP00000370811; ENSG00000174837. [Q14246-3]
ENST00000381407; ENSP00000370814; ENSG00000174837. [Q14246-5]
ENST00000450315; ENSP00000405974; ENSG00000174837. [Q14246-4]
GeneIDi2015.
KEGGihsa:2015.
UCSCiuc002mfw.4. human. [Q14246-1]
uc010dvc.4. human. [Q14246-2]

Polymorphism databases

DMDMi290457673.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X81479 mRNA. Translation: CAA57232.1 .
AB065918 Genomic DNA. Translation: BAC06133.1 . Sequence problems.
DQ217942 Genomic DNA. Translation: ABB70739.1 .
AK131562 mRNA. Translation: BAD18695.1 .
AK297003 mRNA. Translation: BAH12472.1 .
AK297011 mRNA. Translation: BAH12475.1 .
AC020895 Genomic DNA. No translation available.
AC025278 Genomic DNA. No translation available.
BC059395 mRNA. Translation: AAH59395.1 .
CCDSi CCDS12175.1. [Q14246-1 ]
CCDS58643.1. [Q14246-4 ]
CCDS58644.1. [Q14246-2 ]
CCDS58645.1. [Q14246-3 ]
CCDS58646.1. [Q14246-5 ]
PIRi A57172.
RefSeqi NP_001243181.1. NM_001256252.1. [Q14246-3 ]
NP_001243182.1. NM_001256253.1. [Q14246-2 ]
NP_001243183.1. NM_001256254.1. [Q14246-5 ]
NP_001243184.1. NM_001256255.1. [Q14246-4 ]
NP_001965.3. NM_001974.4. [Q14246-1 ]
UniGenei Hs.2375.

3D structure databases

ProteinModelPortali Q14246.
SMRi Q14246. Positions 38-367, 604-848.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q14246. 1 interaction.
STRINGi 9606.ENSP00000311545.

Protein family/group databases

MEROPSi I63.001.
TCDBi 9.A.14.6.1. the g-protein-coupled receptor (gpcr) family.
GPCRDBi Search...

PTM databases

PhosphoSitei Q14246.

Polymorphism databases

DMDMi 290457673.

Proteomic databases

PaxDbi Q14246.
PRIDEi Q14246.

Protocols and materials databases

DNASUi 2015.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000250572 ; ENSP00000250572 ; ENSG00000174837 . [Q14246-2 ]
ENST00000312053 ; ENSP00000311545 ; ENSG00000174837 . [Q14246-1 ]
ENST00000381404 ; ENSP00000370811 ; ENSG00000174837 . [Q14246-3 ]
ENST00000381407 ; ENSP00000370814 ; ENSG00000174837 . [Q14246-5 ]
ENST00000450315 ; ENSP00000405974 ; ENSG00000174837 . [Q14246-4 ]
GeneIDi 2015.
KEGGi hsa:2015.
UCSCi uc002mfw.4. human. [Q14246-1 ]
uc010dvc.4. human. [Q14246-2 ]

Organism-specific databases

CTDi 2015.
GeneCardsi GC19P006838.
H-InvDB HIX0021954.
HIX0174373.
HGNCi HGNC:3336. EMR1.
HPAi HPA052809.
MIMi 600493. gene.
neXtProti NX_Q14246.
PharmGKBi PA27773.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG239437.
GeneTreei ENSGT00760000118787.
HOGENOMi HOG000294115.
HOVERGENi HBG048917.
InParanoidi Q14246.
KOi K04591.
OMAi RNHNTYL.
OrthoDBi EOG7WHH8Q.
PhylomeDBi Q14246.
TreeFami TF316380.

Enzyme and pathway databases

Reactomei REACT_18372. Class B/2 (Secretin family receptors).

Miscellaneous databases

GeneWikii EMR1.
GenomeRNAii 2015.
NextBioi 8163.
PROi Q14246.
SOURCEi Search...

Gene expression databases

Bgeei Q14246.
CleanExi HS_EMR1.
ExpressionAtlasi Q14246. baseline and differential.
Genevestigatori Q14246.

Family and domain databases

InterProi IPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR017981. GPCR_2-like.
IPR001740. GPCR_2_EMR1_rcpt.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view ]
Pfami PF00002. 7tm_2. 1 hit.
PF12662. cEGF. 1 hit.
PF07645. EGF_CA. 4 hits.
PF01825. GPS. 1 hit.
[Graphical view ]
PRINTSi PR01128. EMR1HORMONER.
PR00249. GPCRSECRETIN.
SMARTi SM00181. EGF. 1 hit.
SM00179. EGF_CA. 5 hits.
SM00303. GPS. 1 hit.
[Graphical view ]
SUPFAMi SSF57184. SSF57184. 1 hit.
PROSITEi PS00010. ASX_HYDROXYL. 6 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 6 hits.
PS01187. EGF_CA. 5 hits.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "EMR1, an unusual member in the family of hormone receptors with seven transmembrane segments."
    Baud V., Chissoe S.L., Viegas-Pequignot E., Diriong S., N'Guyen V.C., Roe B.A., Lipinski M.
    Genomics 26:334-344(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS THR-57; ARG-140; ASN-174; SER-254; VAL-298; MET-389; VAL-424; GLN-496; VAL-539 AND THR-663.
  2. "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
    Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
    Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-424; GLN-496 AND VAL-539.
  3. "Genetic variation in EMR1 gene."
    Tan J., Davila S., Hibberd M.L., Seielstad M.
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5), VARIANTS THR-57; VAL-424; GLN-496; VAL-539 AND ILE-589.
    Tissue: Thymus and Umbilical cord blood.
  5. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ILE-589.
    Tissue: Placenta.

Entry informationi

Entry nameiEMR1_HUMAN
AccessioniPrimary (citable) accession number: Q14246
Secondary accession number(s): A6NHV2
, B7Z486, B7Z489, E7EPX9, E9PD45, H9KV79, Q2I7G5, Q6ZMN0, Q8NGA7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 2, 2010
Last modified: October 29, 2014
This is version 155 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3