Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q14246

- EMR1_HUMAN

UniProt

Q14246 - EMR1_HUMAN

Protein

EGF-like module-containing mucin-like hormone receptor-like 1

Gene

EMR1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 154 (01 Oct 2014)
      Sequence version 3 (02 Mar 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Could be involved in cell-cell interactions.

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. G-protein coupled receptor activity Source: ProtInc

    GO - Biological processi

    1. cell adhesion Source: ProtInc
    2. G-protein coupled receptor signaling pathway Source: ProtInc
    3. neuropeptide signaling pathway Source: InterPro

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    ReactomeiREACT_18372. Class B/2 (Secretin family receptors).

    Protein family/group databases

    MEROPSiS63.004.
    TCDBi9.A.14.6.1. the g-protein-coupled receptor (gpcr) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    EGF-like module-containing mucin-like hormone receptor-like 1
    Alternative name(s):
    EGF-like module receptor 1
    EMR1 hormone receptor
    Gene namesi
    Name:EMR1
    Synonyms:TM7LN3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:3336. EMR1.

    Subcellular locationi

    GO - Cellular componenti

    1. external side of plasma membrane Source: Ensembl
    2. integral component of plasma membrane Source: ProtInc

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA27773.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2020Sequence AnalysisAdd
    BLAST
    Chaini21 – 886866EGF-like module-containing mucin-like hormone receptor-like 1PRO_0000012873Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi35 ↔ 47PROSITE-ProRule annotation
    Disulfide bondi41 ↔ 56PROSITE-ProRule annotation
    Disulfide bondi58 ↔ 78PROSITE-ProRule annotation
    Disulfide bondi84 ↔ 97PROSITE-ProRule annotation
    Disulfide bondi91 ↔ 106PROSITE-ProRule annotation
    Glycosylationi94 – 941N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi99 – 991N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi108 ↔ 130PROSITE-ProRule annotation
    Glycosylationi127 – 1271N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi136 ↔ 148PROSITE-ProRule annotation
    Disulfide bondi142 ↔ 157PROSITE-ProRule annotation
    Disulfide bondi159 ↔ 170PROSITE-ProRule annotation
    Glycosylationi167 – 1671N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi176 ↔ 188PROSITE-ProRule annotation
    Disulfide bondi182 ↔ 197PROSITE-ProRule annotation
    Glycosylationi189 – 1891N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi194 – 1941N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi199 ↔ 219PROSITE-ProRule annotation
    Disulfide bondi225 ↔ 235PROSITE-ProRule annotation
    Disulfide bondi229 ↔ 244PROSITE-ProRule annotation
    Glycosylationi232 – 2321N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi246 ↔ 266PROSITE-ProRule annotation
    Glycosylationi258 – 2581N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi272 ↔ 285PROSITE-ProRule annotation
    Disulfide bondi279 ↔ 294PROSITE-ProRule annotation
    Disulfide bondi296 ↔ 315PROSITE-ProRule annotation
    Glycosylationi312 – 3121N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi366 – 3661N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi375 – 3751N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi448 – 4481N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ14246.
    PRIDEiQ14246.

    PTM databases

    PhosphoSiteiQ14246.

    Expressioni

    Tissue specificityi

    Wide expression; increased levels in peripheral blood mononuclear cells.

    Gene expression databases

    ArrayExpressiQ14246.
    BgeeiQ14246.
    CleanExiHS_EMR1.
    GenevestigatoriQ14246.

    Organism-specific databases

    HPAiHPA052809.

    Interactioni

    Protein-protein interaction databases

    IntActiQ14246. 1 interaction.
    STRINGi9606.ENSP00000311545.

    Structurei

    3D structure databases

    ProteinModelPortaliQ14246.
    SMRiQ14246. Positions 38-367, 604-848.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini21 – 599579ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini628 – 6347CytoplasmicSequence Analysis
    Topological domaini657 – 66610ExtracellularSequence Analysis
    Topological domaini691 – 70919CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini732 – 74716ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini777 – 79418CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini815 – 82915ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini853 – 88634CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei600 – 62728Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei635 – 65622Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei667 – 69024Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei710 – 73122Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei748 – 77629Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei795 – 81420Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei830 – 85223Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini31 – 7949EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini80 – 13152EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini132 – 17140EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini172 – 22049EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini221 – 26747EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini268 – 31649EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini547 – 59650GPSPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi317 – 599283Ser/Thr-richAdd
    BLAST

    Sequence similaritiesi

    Contains 6 EGF-like domains.PROSITE-ProRule annotation
    Contains 1 GPS domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG239437.
    HOGENOMiHOG000294115.
    HOVERGENiHBG048917.
    InParanoidiQ14246.
    KOiK04591.
    OMAiRNHNTYL.
    OrthoDBiEOG7WHH8Q.
    PhylomeDBiQ14246.
    TreeFamiTF316380.

    Family and domain databases

    InterProiIPR026823. cEGF.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR017981. GPCR_2-like.
    IPR001740. GPCR_2_EMR1_rcpt.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    IPR009030. Growth_fac_rcpt_N_dom.
    [Graphical view]
    PfamiPF00002. 7tm_2. 1 hit.
    PF12662. cEGF. 1 hit.
    PF07645. EGF_CA. 4 hits.
    PF01825. GPS. 1 hit.
    [Graphical view]
    PRINTSiPR01128. EMR1HORMONER.
    PR00249. GPCRSECRETIN.
    SMARTiSM00181. EGF. 1 hit.
    SM00179. EGF_CA. 5 hits.
    SM00303. GPS. 1 hit.
    [Graphical view]
    SUPFAMiSSF57184. SSF57184. 1 hit.
    PROSITEiPS00010. ASX_HYDROXYL. 6 hits.
    PS01186. EGF_2. 1 hit.
    PS50026. EGF_3. 6 hits.
    PS01187. EGF_CA. 5 hits.
    PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Comment=Additional isoforms seem to exist.

    Isoform 1 (identifier: Q14246-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRGFNLLLFW GCCVMHSWEG HIRPTRKPNT KGNNCRDSTL CPAYATCTNT    50
    VDSYYCACKQ GFLSSNGQNH FKDPGVRCKD IDECSQSPQP CGPNSSCKNL 100
    SGRYKCSCLD GFSSPTGNDW VPGKPGNFSC TDINECLTSS VCPEHSDCVN 150
    SMGSYSCSCQ VGFISRNSTC EDVDECADPR ACPEHATCNN TVGNYSCFCN 200
    PGFESSSGHL SFQGLKASCE DIDECTEMCP INSTCTNTPG SYFCTCHPGF 250
    APSNGQLNFT DQGVECRDID ECRQDPSTCG PNSICTNALG SYSCGCIAGF 300
    HPNPEGSQKD GNFSCQRVLF KCKEDVIPDN KQIQQCQEGT AVKPAYVSFC 350
    AQINNIFSVL DKVCENKTTV VSLKNTTESF VPVLKQISTW TKFTKEETSS 400
    LATVFLESVE SMTLASFWKP SANITPAVRT EYLDIESKVI NKECSEENVT 450
    LDLVAKGDKM KIGCSTIEES ESTETTGVAF VSFVGMESVL NERFFKDHQA 500
    PLTTSEIKLK MNSRVVGGIM TGEKKDGFSD PIIYTLENIQ PKQKFERPIC 550
    VSWSTDVKGG RWTSFGCVIL EASETYTICS CNQMANLAVI MASGELTMDF 600
    SLYIISHVGI IISLVCLVLA IATFLLCRSI RNHNTYLHLH LCVCLLLAKT 650
    LFLAGIHKTD NKMGCAIIAG FLHYLFLACF FWMLVEAVIL FLMVRNLKVV 700
    NYFSSRNIKM LHICAFGYGL PMLVVVISAS VQPQGYGMHN RCWLNTETGF 750
    IWSFLGPVCT VIVINSLLLT WTLWILRQRL SSVNAEVSTL KDTRLLTFKA 800
    FAQLFILGCS WVLGIFQIGP VAGVMAYLFT IINSLQGAFI FLIHCLLNGQ 850
    VREEYKRWIT GKTKPSSQSQ TSRILLSSMP SASKTG 886
    Length:886
    Mass (Da):97,683
    Last modified:March 2, 2010 - v3
    Checksum:i07322996EEF5A6F1
    GO
    Isoform 2 (identifier: Q14246-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         599-663: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:821
    Mass (Da):90,379
    Checksum:i3F57FE01A3F8AC7F
    GO
    Isoform 3 (identifier: Q14246-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         80-131: Missing.
         764-764: I → VSKYYNSLAKCVLKEEQGDLRDLEFPGTCAAERI

    Note: No experimental confirmation available.

    Show »
    Length:867
    Mass (Da):95,944
    Checksum:iDEC584294CD20916
    GO
    Isoform 4 (identifier: Q14246-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         140-316: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:709
    Mass (Da):78,907
    Checksum:i8A817BC4B479F950
    GO
    Isoform 5 (identifier: Q14246-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         80-131: Missing.
         132-220: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:745
    Mass (Da):82,771
    Checksum:i23007B9E3859C5C7
    GO

    Sequence cautioni

    The sequence BAC06133.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti61 – 611G → R in BAH12472. (PubMed:14702039)Curated
    Sequence conflicti212 – 2121F → C in CAA57232. (PubMed:7601460)Curated
    Sequence conflicti424 – 4241I → A in BAH12475. (PubMed:14702039)Curated
    Sequence conflicti430 – 4301T → A in CAA57232. (PubMed:7601460)Curated
    Sequence conflicti545 – 5451F → L in BAH12475. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti2 – 21R → L.
    Corresponds to variant rs34176643 [ dbSNP | Ensembl ].
    VAR_046976
    Natural varianti57 – 571A → T.2 Publications
    Corresponds to variant rs330877 [ dbSNP | Ensembl ].
    VAR_027616
    Natural varianti140 – 1401S → R.1 Publication
    Corresponds to variant rs330880 [ dbSNP | Ensembl ].
    VAR_027617
    Natural varianti174 – 1741D → N.1 Publication
    Corresponds to variant rs897738 [ dbSNP | Ensembl ].
    VAR_027618
    Natural varianti254 – 2541N → S.1 Publication
    Corresponds to variant rs443658 [ dbSNP | Ensembl ].
    VAR_027619
    Natural varianti298 – 2981A → V.1 Publication
    Corresponds to variant rs370094 [ dbSNP | Ensembl ].
    VAR_027620
    Natural varianti389 – 3891T → M.1 Publication
    Corresponds to variant rs466876 [ dbSNP | Ensembl ].
    VAR_027621
    Natural varianti424 – 4241I → V.3 Publications
    Corresponds to variant rs457857 [ dbSNP | Ensembl ].
    VAR_027622
    Natural varianti496 – 4961K → Q.3 Publications
    Corresponds to variant rs373533 [ dbSNP | Ensembl ].
    VAR_027623
    Natural varianti539 – 5391I → V.3 Publications
    Corresponds to variant rs461645 [ dbSNP | Ensembl ].
    VAR_027624
    Natural varianti589 – 5891V → I.2 Publications
    Corresponds to variant rs7256147 [ dbSNP | Ensembl ].
    VAR_027625
    Natural varianti663 – 6631M → T.1 Publication
    Corresponds to variant rs2228539 [ dbSNP | Ensembl ].
    VAR_046977
    Natural varianti691 – 6911F → C.
    Corresponds to variant rs2229769 [ dbSNP | Ensembl ].
    VAR_027626
    Natural varianti724 – 7241V → L.
    Corresponds to variant rs10406580 [ dbSNP | Ensembl ].
    VAR_027627

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei80 – 13152Missing in isoform 3 and isoform 5. 1 PublicationVSP_045521Add
    BLAST
    Alternative sequencei132 – 22089Missing in isoform 5. 1 PublicationVSP_045522Add
    BLAST
    Alternative sequencei140 – 316177Missing in isoform 4. 1 PublicationVSP_045523Add
    BLAST
    Alternative sequencei599 – 66365Missing in isoform 2. 1 PublicationVSP_009594Add
    BLAST
    Alternative sequencei764 – 7641I → VSKYYNSLAKCVLKEEQGDL RDLEFPGTCAAERI in isoform 3. 1 PublicationVSP_045524

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X81479 mRNA. Translation: CAA57232.1.
    AB065918 Genomic DNA. Translation: BAC06133.1. Sequence problems.
    DQ217942 Genomic DNA. Translation: ABB70739.1.
    AK131562 mRNA. Translation: BAD18695.1.
    AK297003 mRNA. Translation: BAH12472.1.
    AK297011 mRNA. Translation: BAH12475.1.
    AC020895 Genomic DNA. No translation available.
    AC025278 Genomic DNA. No translation available.
    BC059395 mRNA. Translation: AAH59395.1.
    CCDSiCCDS12175.1. [Q14246-1]
    CCDS58643.1. [Q14246-4]
    CCDS58644.1. [Q14246-2]
    CCDS58645.1. [Q14246-3]
    CCDS58646.1. [Q14246-5]
    PIRiA57172.
    RefSeqiNP_001243181.1. NM_001256252.1. [Q14246-3]
    NP_001243182.1. NM_001256253.1. [Q14246-2]
    NP_001243183.1. NM_001256254.1. [Q14246-5]
    NP_001243184.1. NM_001256255.1. [Q14246-4]
    NP_001965.3. NM_001974.4. [Q14246-1]
    UniGeneiHs.2375.

    Genome annotation databases

    EnsembliENST00000250572; ENSP00000250572; ENSG00000174837. [Q14246-2]
    ENST00000312053; ENSP00000311545; ENSG00000174837. [Q14246-1]
    ENST00000381404; ENSP00000370811; ENSG00000174837. [Q14246-3]
    ENST00000381407; ENSP00000370814; ENSG00000174837. [Q14246-5]
    ENST00000450315; ENSP00000405974; ENSG00000174837. [Q14246-4]
    GeneIDi2015.
    KEGGihsa:2015.
    UCSCiuc002mfw.4. human. [Q14246-1]
    uc010dvc.4. human. [Q14246-2]

    Polymorphism databases

    DMDMi290457673.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X81479 mRNA. Translation: CAA57232.1 .
    AB065918 Genomic DNA. Translation: BAC06133.1 . Sequence problems.
    DQ217942 Genomic DNA. Translation: ABB70739.1 .
    AK131562 mRNA. Translation: BAD18695.1 .
    AK297003 mRNA. Translation: BAH12472.1 .
    AK297011 mRNA. Translation: BAH12475.1 .
    AC020895 Genomic DNA. No translation available.
    AC025278 Genomic DNA. No translation available.
    BC059395 mRNA. Translation: AAH59395.1 .
    CCDSi CCDS12175.1. [Q14246-1 ]
    CCDS58643.1. [Q14246-4 ]
    CCDS58644.1. [Q14246-2 ]
    CCDS58645.1. [Q14246-3 ]
    CCDS58646.1. [Q14246-5 ]
    PIRi A57172.
    RefSeqi NP_001243181.1. NM_001256252.1. [Q14246-3 ]
    NP_001243182.1. NM_001256253.1. [Q14246-2 ]
    NP_001243183.1. NM_001256254.1. [Q14246-5 ]
    NP_001243184.1. NM_001256255.1. [Q14246-4 ]
    NP_001965.3. NM_001974.4. [Q14246-1 ]
    UniGenei Hs.2375.

    3D structure databases

    ProteinModelPortali Q14246.
    SMRi Q14246. Positions 38-367, 604-848.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q14246. 1 interaction.
    STRINGi 9606.ENSP00000311545.

    Protein family/group databases

    MEROPSi S63.004.
    TCDBi 9.A.14.6.1. the g-protein-coupled receptor (gpcr) family.
    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q14246.

    Polymorphism databases

    DMDMi 290457673.

    Proteomic databases

    PaxDbi Q14246.
    PRIDEi Q14246.

    Protocols and materials databases

    DNASUi 2015.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000250572 ; ENSP00000250572 ; ENSG00000174837 . [Q14246-2 ]
    ENST00000312053 ; ENSP00000311545 ; ENSG00000174837 . [Q14246-1 ]
    ENST00000381404 ; ENSP00000370811 ; ENSG00000174837 . [Q14246-3 ]
    ENST00000381407 ; ENSP00000370814 ; ENSG00000174837 . [Q14246-5 ]
    ENST00000450315 ; ENSP00000405974 ; ENSG00000174837 . [Q14246-4 ]
    GeneIDi 2015.
    KEGGi hsa:2015.
    UCSCi uc002mfw.4. human. [Q14246-1 ]
    uc010dvc.4. human. [Q14246-2 ]

    Organism-specific databases

    CTDi 2015.
    GeneCardsi GC19P006838.
    H-InvDB HIX0021954.
    HIX0174373.
    HGNCi HGNC:3336. EMR1.
    HPAi HPA052809.
    MIMi 600493. gene.
    neXtProti NX_Q14246.
    PharmGKBi PA27773.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG239437.
    HOGENOMi HOG000294115.
    HOVERGENi HBG048917.
    InParanoidi Q14246.
    KOi K04591.
    OMAi RNHNTYL.
    OrthoDBi EOG7WHH8Q.
    PhylomeDBi Q14246.
    TreeFami TF316380.

    Enzyme and pathway databases

    Reactomei REACT_18372. Class B/2 (Secretin family receptors).

    Miscellaneous databases

    GeneWikii EMR1.
    GenomeRNAii 2015.
    NextBioi 8163.
    PROi Q14246.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q14246.
    Bgeei Q14246.
    CleanExi HS_EMR1.
    Genevestigatori Q14246.

    Family and domain databases

    InterProi IPR026823. cEGF.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR017981. GPCR_2-like.
    IPR001740. GPCR_2_EMR1_rcpt.
    IPR000832. GPCR_2_secretin-like.
    IPR017983. GPCR_2_secretin-like_CS.
    IPR000203. GPS.
    IPR009030. Growth_fac_rcpt_N_dom.
    [Graphical view ]
    Pfami PF00002. 7tm_2. 1 hit.
    PF12662. cEGF. 1 hit.
    PF07645. EGF_CA. 4 hits.
    PF01825. GPS. 1 hit.
    [Graphical view ]
    PRINTSi PR01128. EMR1HORMONER.
    PR00249. GPCRSECRETIN.
    SMARTi SM00181. EGF. 1 hit.
    SM00179. EGF_CA. 5 hits.
    SM00303. GPS. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57184. SSF57184. 1 hit.
    PROSITEi PS00010. ASX_HYDROXYL. 6 hits.
    PS01186. EGF_2. 1 hit.
    PS50026. EGF_3. 6 hits.
    PS01187. EGF_CA. 5 hits.
    PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
    PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
    PS50221. GPS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "EMR1, an unusual member in the family of hormone receptors with seven transmembrane segments."
      Baud V., Chissoe S.L., Viegas-Pequignot E., Diriong S., N'Guyen V.C., Roe B.A., Lipinski M.
      Genomics 26:334-344(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS THR-57; ARG-140; ASN-174; SER-254; VAL-298; MET-389; VAL-424; GLN-496; VAL-539 AND THR-663.
    2. "Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
      Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
      Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-424; GLN-496 AND VAL-539.
    3. "Genetic variation in EMR1 gene."
      Tan J., Davila S., Hibberd M.L., Seielstad M.
      Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5), VARIANTS THR-57; VAL-424; GLN-496; VAL-539 AND ILE-589.
      Tissue: Thymus and Umbilical cord blood.
    5. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ILE-589.
      Tissue: Placenta.

    Entry informationi

    Entry nameiEMR1_HUMAN
    AccessioniPrimary (citable) accession number: Q14246
    Secondary accession number(s): A6NHV2
    , B7Z486, B7Z489, E7EPX9, E9PD45, H9KV79, Q2I7G5, Q6ZMN0, Q8NGA7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: March 2, 2010
    Last modified: October 1, 2014
    This is version 154 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3