Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q14246 (EMR1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 152. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
EGF-like module-containing mucin-like hormone receptor-like 1
Alternative name(s):
EGF-like module receptor 1
EMR1 hormone receptor
Gene names
Name:EMR1
Synonyms:TM7LN3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length886 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Could be involved in cell-cell interactions.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Tissue specificity

Wide expression; increased levels in peripheral blood mononuclear cells.

Sequence similarities

Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.

Contains 6 EGF-like domains.

Contains 1 GPS domain.

Sequence caution

The sequence BAC06133.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]

Note: Comment=Additional isoforms seem to exist.
Isoform 1 (identifier: Q14246-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q14246-2)

The sequence of this isoform differs from the canonical sequence as follows:
     599-663: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q14246-3)

The sequence of this isoform differs from the canonical sequence as follows:
     80-131: Missing.
     764-764: I → VSKYYNSLAKCVLKEEQGDLRDLEFPGTCAAERI
Note: No experimental confirmation available.
Isoform 4 (identifier: Q14246-4)

The sequence of this isoform differs from the canonical sequence as follows:
     140-316: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q14246-5)

The sequence of this isoform differs from the canonical sequence as follows:
     80-131: Missing.
     132-220: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2020 Potential
Chain21 – 886866EGF-like module-containing mucin-like hormone receptor-like 1
PRO_0000012873

Regions

Topological domain21 – 599579Extracellular Potential
Transmembrane600 – 62728Helical; Name=1; Potential
Topological domain628 – 6347Cytoplasmic Potential
Transmembrane635 – 65622Helical; Name=2; Potential
Topological domain657 – 66610Extracellular Potential
Transmembrane667 – 69024Helical; Name=3; Potential
Topological domain691 – 70919Cytoplasmic Potential
Transmembrane710 – 73122Helical; Name=4; Potential
Topological domain732 – 74716Extracellular Potential
Transmembrane748 – 77629Helical; Name=5; Potential
Topological domain777 – 79418Cytoplasmic Potential
Transmembrane795 – 81420Helical; Name=6; Potential
Topological domain815 – 82915Extracellular Potential
Transmembrane830 – 85223Helical; Name=7; Potential
Topological domain853 – 88634Cytoplasmic Potential
Domain31 – 7949EGF-like 1
Domain80 – 13152EGF-like 2; calcium-binding Potential
Domain132 – 17140EGF-like 3; calcium-binding Potential
Domain172 – 22049EGF-like 4; calcium-binding Potential
Domain221 – 26747EGF-like 5; calcium-binding Potential
Domain268 – 31649EGF-like 6; calcium-binding Potential
Domain547 – 59650GPS
Compositional bias317 – 599283Ser/Thr-rich

Amino acid modifications

Glycosylation941N-linked (GlcNAc...) Potential
Glycosylation991N-linked (GlcNAc...) Potential
Glycosylation1271N-linked (GlcNAc...) Potential
Glycosylation1671N-linked (GlcNAc...) Potential
Glycosylation1891N-linked (GlcNAc...) Potential
Glycosylation1941N-linked (GlcNAc...) Potential
Glycosylation2321N-linked (GlcNAc...) Potential
Glycosylation2581N-linked (GlcNAc...) Potential
Glycosylation3121N-linked (GlcNAc...) Potential
Glycosylation3661N-linked (GlcNAc...) Potential
Glycosylation3751N-linked (GlcNAc...) Potential
Glycosylation4481N-linked (GlcNAc...) Potential
Disulfide bond35 ↔ 47 By similarity
Disulfide bond41 ↔ 56 By similarity
Disulfide bond58 ↔ 78 By similarity
Disulfide bond84 ↔ 97 By similarity
Disulfide bond91 ↔ 106 By similarity
Disulfide bond108 ↔ 130 By similarity
Disulfide bond136 ↔ 148 By similarity
Disulfide bond142 ↔ 157 By similarity
Disulfide bond159 ↔ 170 By similarity
Disulfide bond176 ↔ 188 By similarity
Disulfide bond182 ↔ 197 By similarity
Disulfide bond199 ↔ 219 By similarity
Disulfide bond225 ↔ 235 By similarity
Disulfide bond229 ↔ 244 By similarity
Disulfide bond246 ↔ 266 By similarity
Disulfide bond272 ↔ 285 By similarity
Disulfide bond279 ↔ 294 By similarity
Disulfide bond296 ↔ 315 By similarity

Natural variations

Alternative sequence80 – 13152Missing in isoform 3 and isoform 5.
VSP_045521
Alternative sequence132 – 22089Missing in isoform 5.
VSP_045522
Alternative sequence140 – 316177Missing in isoform 4.
VSP_045523
Alternative sequence599 – 66365Missing in isoform 2.
VSP_009594
Alternative sequence7641I → VSKYYNSLAKCVLKEEQGDL RDLEFPGTCAAERI in isoform 3.
VSP_045524
Natural variant21R → L.
Corresponds to variant rs34176643 [ dbSNP | Ensembl ].
VAR_046976
Natural variant571A → T. Ref.1 Ref.4
Corresponds to variant rs330877 [ dbSNP | Ensembl ].
VAR_027616
Natural variant1401S → R. Ref.1
Corresponds to variant rs330880 [ dbSNP | Ensembl ].
VAR_027617
Natural variant1741D → N. Ref.1
Corresponds to variant rs897738 [ dbSNP | Ensembl ].
VAR_027618
Natural variant2541N → S. Ref.1
Corresponds to variant rs443658 [ dbSNP | Ensembl ].
VAR_027619
Natural variant2981A → V. Ref.1
Corresponds to variant rs370094 [ dbSNP | Ensembl ].
VAR_027620
Natural variant3891T → M. Ref.1
Corresponds to variant rs466876 [ dbSNP | Ensembl ].
VAR_027621
Natural variant4241I → V. Ref.1 Ref.2 Ref.4
Corresponds to variant rs457857 [ dbSNP | Ensembl ].
VAR_027622
Natural variant4961K → Q. Ref.1 Ref.2 Ref.4
Corresponds to variant rs373533 [ dbSNP | Ensembl ].
VAR_027623
Natural variant5391I → V. Ref.1 Ref.2 Ref.4
Corresponds to variant rs461645 [ dbSNP | Ensembl ].
VAR_027624
Natural variant5891V → I. Ref.4 Ref.6
Corresponds to variant rs7256147 [ dbSNP | Ensembl ].
VAR_027625
Natural variant6631M → T. Ref.1
Corresponds to variant rs2228539 [ dbSNP | Ensembl ].
VAR_046977
Natural variant6911F → C.
Corresponds to variant rs2229769 [ dbSNP | Ensembl ].
VAR_027626
Natural variant7241V → L.
Corresponds to variant rs10406580 [ dbSNP | Ensembl ].
VAR_027627

Experimental info

Sequence conflict611G → R in BAH12472. Ref.4
Sequence conflict2121F → C in CAA57232. Ref.1
Sequence conflict4241I → A in BAH12475. Ref.4
Sequence conflict4301T → A in CAA57232. Ref.1
Sequence conflict5451F → L in BAH12475. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 2, 2010. Version 3.
Checksum: 07322996EEF5A6F1

FASTA88697,683
        10         20         30         40         50         60 
MRGFNLLLFW GCCVMHSWEG HIRPTRKPNT KGNNCRDSTL CPAYATCTNT VDSYYCACKQ 

        70         80         90        100        110        120 
GFLSSNGQNH FKDPGVRCKD IDECSQSPQP CGPNSSCKNL SGRYKCSCLD GFSSPTGNDW 

       130        140        150        160        170        180 
VPGKPGNFSC TDINECLTSS VCPEHSDCVN SMGSYSCSCQ VGFISRNSTC EDVDECADPR 

       190        200        210        220        230        240 
ACPEHATCNN TVGNYSCFCN PGFESSSGHL SFQGLKASCE DIDECTEMCP INSTCTNTPG 

       250        260        270        280        290        300 
SYFCTCHPGF APSNGQLNFT DQGVECRDID ECRQDPSTCG PNSICTNALG SYSCGCIAGF 

       310        320        330        340        350        360 
HPNPEGSQKD GNFSCQRVLF KCKEDVIPDN KQIQQCQEGT AVKPAYVSFC AQINNIFSVL 

       370        380        390        400        410        420 
DKVCENKTTV VSLKNTTESF VPVLKQISTW TKFTKEETSS LATVFLESVE SMTLASFWKP 

       430        440        450        460        470        480 
SANITPAVRT EYLDIESKVI NKECSEENVT LDLVAKGDKM KIGCSTIEES ESTETTGVAF 

       490        500        510        520        530        540 
VSFVGMESVL NERFFKDHQA PLTTSEIKLK MNSRVVGGIM TGEKKDGFSD PIIYTLENIQ 

       550        560        570        580        590        600 
PKQKFERPIC VSWSTDVKGG RWTSFGCVIL EASETYTICS CNQMANLAVI MASGELTMDF 

       610        620        630        640        650        660 
SLYIISHVGI IISLVCLVLA IATFLLCRSI RNHNTYLHLH LCVCLLLAKT LFLAGIHKTD 

       670        680        690        700        710        720 
NKMGCAIIAG FLHYLFLACF FWMLVEAVIL FLMVRNLKVV NYFSSRNIKM LHICAFGYGL 

       730        740        750        760        770        780 
PMLVVVISAS VQPQGYGMHN RCWLNTETGF IWSFLGPVCT VIVINSLLLT WTLWILRQRL 

       790        800        810        820        830        840 
SSVNAEVSTL KDTRLLTFKA FAQLFILGCS WVLGIFQIGP VAGVMAYLFT IINSLQGAFI 

       850        860        870        880 
FLIHCLLNGQ VREEYKRWIT GKTKPSSQSQ TSRILLSSMP SASKTG 

« Hide

Isoform 2 [UniParc].

Checksum: 3F57FE01A3F8AC7F
Show »

FASTA82190,379
Isoform 3 [UniParc].

Checksum: DEC584294CD20916
Show »

FASTA86795,944
Isoform 4 [UniParc].

Checksum: 8A817BC4B479F950
Show »

FASTA70978,907
Isoform 5 [UniParc].

Checksum: 23007B9E3859C5C7
Show »

FASTA74582,771

References

« Hide 'large scale' references
[1]"EMR1, an unusual member in the family of hormone receptors with seven transmembrane segments."
Baud V., Chissoe S.L., Viegas-Pequignot E., Diriong S., N'Guyen V.C., Roe B.A., Lipinski M.
Genomics 26:334-344(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS THR-57; ARG-140; ASN-174; SER-254; VAL-298; MET-389; VAL-424; GLN-496; VAL-539 AND THR-663.
[2]"Genome-wide discovery and analysis of human seven transmembrane helix receptor genes."
Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S., Tsutsumi S., Aburatani H., Asai K., Akiyama Y.
Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-424; GLN-496 AND VAL-539.
[3]"Genetic variation in EMR1 gene."
Tan J., Davila S., Hibberd M.L., Seielstad M.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5), VARIANTS THR-57; VAL-424; GLN-496; VAL-539 AND ILE-589.
Tissue: Thymus and Umbilical cord blood.
[5]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ILE-589.
Tissue: Placenta.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
X81479 mRNA. Translation: CAA57232.1.
AB065918 Genomic DNA. Translation: BAC06133.1. Sequence problems.
DQ217942 Genomic DNA. Translation: ABB70739.1.
AK131562 mRNA. Translation: BAD18695.1.
AK297003 mRNA. Translation: BAH12472.1.
AK297011 mRNA. Translation: BAH12475.1.
AC020895 Genomic DNA. No translation available.
AC025278 Genomic DNA. No translation available.
BC059395 mRNA. Translation: AAH59395.1.
CCDSCCDS12175.1. [Q14246-1]
CCDS58643.1. [Q14246-4]
CCDS58644.1. [Q14246-2]
CCDS58645.1. [Q14246-3]
CCDS58646.1. [Q14246-5]
PIRA57172.
RefSeqNP_001243181.1. NM_001256252.1. [Q14246-3]
NP_001243182.1. NM_001256253.1. [Q14246-2]
NP_001243183.1. NM_001256254.1. [Q14246-5]
NP_001243184.1. NM_001256255.1. [Q14246-4]
NP_001965.3. NM_001974.4. [Q14246-1]
UniGeneHs.2375.

3D structure databases

ProteinModelPortalQ14246.
SMRQ14246. Positions 38-367, 604-848.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ14246. 1 interaction.
STRING9606.ENSP00000311545.

Protein family/group databases

MEROPSS63.004.
TCDB9.A.14.6.1. the g-protein-coupled receptor (gpcr) family.
GPCRDBSearch...

PTM databases

PhosphoSiteQ14246.

Polymorphism databases

DMDM290457673.

Proteomic databases

PaxDbQ14246.
PRIDEQ14246.

Protocols and materials databases

DNASU2015.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000250572; ENSP00000250572; ENSG00000174837. [Q14246-2]
ENST00000312053; ENSP00000311545; ENSG00000174837. [Q14246-1]
ENST00000381404; ENSP00000370811; ENSG00000174837. [Q14246-3]
ENST00000381407; ENSP00000370814; ENSG00000174837. [Q14246-5]
ENST00000450315; ENSP00000405974; ENSG00000174837. [Q14246-4]
GeneID2015.
KEGGhsa:2015.
UCSCuc002mfw.4. human. [Q14246-1]
uc010dvc.4. human. [Q14246-2]

Organism-specific databases

CTD2015.
GeneCardsGC19P006838.
H-InvDBHIX0021954.
HIX0174373.
HGNCHGNC:3336. EMR1.
HPAHPA052809.
MIM600493. gene.
neXtProtNX_Q14246.
PharmGKBPA27773.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG239437.
HOGENOMHOG000294115.
HOVERGENHBG048917.
InParanoidQ14246.
KOK04591.
OMARNHNTYL.
OrthoDBEOG7WHH8Q.
PhylomeDBQ14246.
TreeFamTF316380.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressQ14246.
BgeeQ14246.
CleanExHS_EMR1.
GenevestigatorQ14246.

Family and domain databases

InterProIPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR017981. GPCR_2-like.
IPR001740. GPCR_2_EMR1_rcpt.
IPR000832. GPCR_2_secretin-like.
IPR017983. GPCR_2_secretin-like_CS.
IPR000203. GPS.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view]
PfamPF00002. 7tm_2. 1 hit.
PF12662. cEGF. 1 hit.
PF07645. EGF_CA. 4 hits.
PF01825. GPS. 1 hit.
[Graphical view]
PRINTSPR01128. EMR1HORMONER.
PR00249. GPCRSECRETIN.
SMARTSM00181. EGF. 1 hit.
SM00179. EGF_CA. 5 hits.
SM00303. GPS. 1 hit.
[Graphical view]
SUPFAMSSF57184. SSF57184. 1 hit.
PROSITEPS00010. ASX_HYDROXYL. 6 hits.
PS01186. EGF_2. 1 hit.
PS50026. EGF_3. 6 hits.
PS01187. EGF_CA. 5 hits.
PS00650. G_PROTEIN_RECEP_F2_2. 1 hit.
PS50261. G_PROTEIN_RECEP_F2_4. 1 hit.
PS50221. GPS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiEMR1.
GenomeRNAi2015.
NextBio8163.
PROQ14246.
SOURCESearch...

Entry information

Entry nameEMR1_HUMAN
AccessionPrimary (citable) accession number: Q14246
Secondary accession number(s): A6NHV2 expand/collapse secondary AC list , B7Z486, B7Z489, E7EPX9, E9PD45, H9KV79, Q2I7G5, Q6ZMN0, Q8NGA7
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 2, 2010
Last modified: July 9, 2014
This is version 152 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries