Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ensconsin

Gene

MAP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Microtubule-stabilizing protein that may play an important role during reorganization of microtubules during polarization and differentiation of epithelial cells. Associates with microtubules in a dynamic manner. May play a role in the formation of intercellular contacts. Colocalization with TRPV4 results in the redistribution of TRPV4 toward the membrane and may link cytoskeletal microfilaments.3 Publications

GO - Molecular functioni

  • receptor binding Source: BHF-UCL
  • structural molecule activity Source: ProtInc

GO - Biological processi

  • establishment or maintenance of cell polarity Source: ProtInc
  • microtubule cytoskeleton organization Source: ProtInc
  • protein localization to plasma membrane Source: BHF-UCL
  • response to osmotic stress Source: BHF-UCL
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Ensconsin
Alternative name(s):
Epithelial microtubule-associated protein of 115 kDa
Short name:
E-MAP-115
Microtubule-associated protein 7
Short name:
MAP-7
Gene namesi
Name:MAP7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:6869. MAP7.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi9053.
OpenTargetsiENSG00000135525.
PharmGKBiPA30615.

Polymorphism and mutation databases

BioMutaiMAP7.
DMDMi74739817.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00002559492 – 749EnsconsinAdd BLAST748

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei161PhosphoserineCombined sources1
Modified residuei165PhosphoserineCombined sources1
Modified residuei183PhosphoserineCombined sources1
Modified residuei200PhosphoserineCombined sources1
Modified residuei202PhosphoserineCombined sources1
Modified residuei209PhosphoserineCombined sources1
Modified residuei219PhosphoserineCombined sources1
Modified residuei231PhosphothreonineCombined sources1
Modified residuei235PhosphoserineCombined sources1
Modified residuei254PhosphoserineCombined sources1
Modified residuei277PhosphothreonineCombined sources1
Modified residuei282PhosphoserineCombined sources1
Modified residuei335PhosphoserineCombined sources1
Modified residuei365PhosphoserineCombined sources1
Cross-linki406Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei673PhosphothreonineCombined sources1

Post-translational modificationi

The association with microtubules is regulated by phosphorylation during the cell cycle. During interphase only phosphorylated on serine. Phosphorylated on threonine in mitosis.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ14244.
MaxQBiQ14244.
PaxDbiQ14244.
PeptideAtlasiQ14244.
PRIDEiQ14244.

PTM databases

iPTMnetiQ14244.
PhosphoSitePlusiQ14244.

Expressioni

Tissue specificityi

Expressed in the skin and cells of epithelial origin. Predominantly expressed in the suprabasal layers of the normal epidermis and relatively abundant in squamous cell carcinomas but barely detectable in basal cell carcinomas.2 Publications

Inductioni

Up-regulated upon terminal differentiation of primary keratinocytes.

Gene expression databases

BgeeiENSG00000135525.
CleanExiHS_MAP7.
ExpressionAtlasiQ14244. baseline and differential.
GenevisibleiQ14244. HS.

Organism-specific databases

HPAiHPA029712.
HPA029713.

Interactioni

Subunit structurei

Interacts with TRPV4.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114515. 38 interactors.
IntActiQ14244. 18 interactors.
MINTiMINT-4532905.
STRINGi9606.ENSP00000414712.

Structurei

3D structure databases

ProteinModelPortaliQ14244.
SMRiQ14244.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili89 – 152Sequence analysisAdd BLAST64
Coiled coili477 – 612Sequence analysisAdd BLAST136

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi316 – 451Pro-richAdd BLAST136

Sequence similaritiesi

Belongs to the MAP7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IIRT. Eukaryota.
ENOG410XS5W. LUCA.
GeneTreeiENSGT00660000095160.
HOGENOMiHOG000231569.
HOVERGENiHBG081952.
InParanoidiQ14244.
KOiK10433.
PhylomeDBiQ14244.
TreeFamiTF332273.

Family and domain databases

InterProiIPR030707. MAP7.
IPR008604. MAP7_fam.
[Graphical view]
PANTHERiPTHR15073. PTHR15073. 1 hit.
PTHR15073:SF4. PTHR15073:SF4. 1 hit.
PfamiPF05672. MAP7. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14244-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAELGAGGDG HRGGDGAVRS ETAPDSYKVQ DKKNASSRPA SAISGQNNNH
60 70 80 90 100
SGNKPDPPPV LRVDDRQRLA RERREEREKQ LAAREIVWLE REERARQHYE
110 120 130 140 150
KHLEERKKRL EEQRQKEERR RAAVEEKRRQ RLEEDKERHE AVVRRTMERS
160 170 180 190 200
QKPKQKHNRW SWGGSLHGSP SIHSADPDRR SVSTMNLSKY VDPVISKRLS
210 220 230 240 250
SSSATLLNSP DRARRLQLSP WESSVVNRLL TPTHSFLARS KSTAALSGEA
260 270 280 290 300
ASCSPIIMPY KAAHSRNSMD RPKLFVTPPE GSSRRRIIHG TASYKKERER
310 320 330 340 350
ENVLFLTSGT RRAVSPSNPK ARQPARSRLW LPSKSLPHLP GTPRPTSSLP
360 370 380 390 400
PGSVKAAPAQ VRPPSPGNIR PVKREVKVEP EKKDPEKEPQ KVANEPSLKG
410 420 430 440 450
RAPLVKVEEA TVEERTPAEP EVGPAAPAMA PAPASAPAPA SAPAPAPVPT
460 470 480 490 500
PAMVSAPSST VNASASVKTS AGTTDPEEAT RLLAEKRRLA REQREKEERE
510 520 530 540 550
RREQEELERQ KREELAQRVA EERTTRREEE SRRLEAEQAR EKEEQLQRQA
560 570 580 590 600
EERALREREE AERAQRQKEE EARVREEAER VRQEREKHFQ REEQERLERK
610 620 630 640 650
KRLEEIMKRT RRTEATDKKT SDQRNGDIAK GALTGGTEVS ALPCTTNAPG
660 670 680 690 700
NGKPVGSPHV VTSHQSKVTV ESTPDLEKQP NENGVSVQNE NFEEIINLPI
710 720 730 740
GSKPSRLDVT NSESPEIPLN PILAFDDEGT LGPLPQVDGV QTQQTAEVI
Length:749
Mass (Da):84,052
Last modified:November 1, 1996 - v1
Checksum:iCB69BDE25C9540E3
GO
Isoform 2 (identifier: Q14244-2) [UniParc]FASTAAdd to basket
Also known as: E-MAP-115-105

The sequence of this isoform differs from the canonical sequence as follows:
     176-212: Missing.

Show »
Length:712
Mass (Da):79,976
Checksum:iECAA14610C717550
GO
Isoform 3 (identifier: Q14244-3) [UniParc]FASTAAdd to basket
Also known as: E-MAP-115-95

The sequence of this isoform differs from the canonical sequence as follows:
     82-175: Missing.

Show »
Length:655
Mass (Da):72,414
Checksum:i5DB5677DDD254C2E
GO
Isoform 4 (identifier: Q14244-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MAELGAGGDGHRGGDGAVRSET → MPGSATALRHERLKKTNARPIPLGLFTINEEDEQQKNGNSRRPK
     176-212: Missing.

Note: No experimental confirmation available.
Show »
Length:734
Mass (Da):82,877
Checksum:iECC44D5E7D550F48
GO
Isoform 5 (identifier: Q14244-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Note: No experimental confirmation available.
Show »
Length:603
Mass (Da):66,938
Checksum:i276DC81A68500D90
GO
Isoform 6 (identifier: Q14244-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: MAELGAGGDGHRGGDGAVRSETA → MEDTKLYS

Note: No experimental confirmation available.
Show »
Length:734
Mass (Da):82,867
Checksum:i442B7844C6097C72
GO
Isoform 7 (identifier: Q14244-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MAELGAGGDGHRGGDGAVRSET → MPGSATALRHERLKKTNARPIPLGLFTINEEDEQQKNGNSRRPK

Note: No experimental confirmation available.
Show »
Length:771
Mass (Da):86,952
Checksum:iF91E6CBDDD0DB6D9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti318N → D in BAH13013 (PubMed:14702039).Curated1
Sequence conflicti583Q → R in BAH12386 (PubMed:14702039).Curated1
Sequence conflicti725F → S in BAH13013 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034091361V → I.Corresponds to variant rs35350783dbSNPEnsembl.1
Natural variantiVAR_034092526R → P.Corresponds to variant rs35107962dbSNPEnsembl.1
Natural variantiVAR_028880558R → W.2 PublicationsCorresponds to variant rs2076190dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0433351 – 146Missing in isoform 5. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_0467581 – 23MAELG…RSETA → MEDTKLYS in isoform 6. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_0433361 – 22MAELG…VRSET → MPGSATALRHERLKKTNARP IPLGLFTINEEDEQQKNGNS RRPK in isoform 4 and isoform 7. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_02131682 – 175Missing in isoform 3. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_021317176 – 212Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X73882 mRNA. Translation: CAA52086.1.
AJ242501 mRNA. Translation: CAB88030.1.
AJ242502 mRNA. Translation: CAB88031.1.
AK294461 mRNA. Translation: BAH11776.1.
AK296556 mRNA. Translation: BAH12386.1.
AK299355 mRNA. Translation: BAH13013.1.
AK316062 mRNA. Translation: BAH14433.1.
AL024508, AL023284 Genomic DNA. Translation: CAD92557.2.
AL023284, AL024508 Genomic DNA. Translation: CAI20475.1.
AL133511 Genomic DNA. No translation available.
BC025777 mRNA. Translation: AAH25777.1.
CCDSiCCDS5178.1. [Q14244-1]
CCDS56452.1. [Q14244-5]
CCDS56453.1. [Q14244-6]
CCDS56454.1. [Q14244-4]
CCDS56455.1. [Q14244-7]
CCDS75528.1. [Q14244-3]
CCDS75529.1. [Q14244-2]
PIRiI37356.
RefSeqiNP_001185537.1. NM_001198608.1. [Q14244-7]
NP_001185538.1. NM_001198609.1.
NP_001185540.1. NM_001198611.1. [Q14244-4]
NP_001185543.1. NM_001198614.1. [Q14244-7]
NP_001185544.1. NM_001198615.1. [Q14244-6]
NP_001185545.1. NM_001198616.1. [Q14244-2]
NP_001185546.1. NM_001198617.1. [Q14244-3]
NP_001185547.1. NM_001198618.1. [Q14244-5]
NP_001185548.1. NM_001198619.1. [Q14244-5]
NP_003971.1. NM_003980.4. [Q14244-1]
XP_006715663.1. XM_006715600.2. [Q14244-7]
XP_016866960.1. XM_017011471.1. [Q14244-4]
UniGeneiHs.486548.

Genome annotation databases

EnsembliENST00000354570; ENSP00000346581; ENSG00000135525. [Q14244-1]
ENST00000432797; ENSP00000414879; ENSG00000135525. [Q14244-5]
ENST00000438100; ENSP00000400790; ENSG00000135525. [Q14244-4]
ENST00000454590; ENSP00000414712; ENSG00000135525. [Q14244-7]
ENST00000544465; ENSP00000445737; ENSG00000135525. [Q14244-6]
ENST00000611373; ENSP00000482998; ENSG00000135525. [Q14244-5]
ENST00000616617; ENSP00000483511; ENSG00000135525. [Q14244-3]
ENST00000618822; ENSP00000482356; ENSG00000135525. [Q14244-2]
GeneIDi9053.
KEGGihsa:9053.
UCSCiuc003qgz.4. human. [Q14244-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X73882 mRNA. Translation: CAA52086.1.
AJ242501 mRNA. Translation: CAB88030.1.
AJ242502 mRNA. Translation: CAB88031.1.
AK294461 mRNA. Translation: BAH11776.1.
AK296556 mRNA. Translation: BAH12386.1.
AK299355 mRNA. Translation: BAH13013.1.
AK316062 mRNA. Translation: BAH14433.1.
AL024508, AL023284 Genomic DNA. Translation: CAD92557.2.
AL023284, AL024508 Genomic DNA. Translation: CAI20475.1.
AL133511 Genomic DNA. No translation available.
BC025777 mRNA. Translation: AAH25777.1.
CCDSiCCDS5178.1. [Q14244-1]
CCDS56452.1. [Q14244-5]
CCDS56453.1. [Q14244-6]
CCDS56454.1. [Q14244-4]
CCDS56455.1. [Q14244-7]
CCDS75528.1. [Q14244-3]
CCDS75529.1. [Q14244-2]
PIRiI37356.
RefSeqiNP_001185537.1. NM_001198608.1. [Q14244-7]
NP_001185538.1. NM_001198609.1.
NP_001185540.1. NM_001198611.1. [Q14244-4]
NP_001185543.1. NM_001198614.1. [Q14244-7]
NP_001185544.1. NM_001198615.1. [Q14244-6]
NP_001185545.1. NM_001198616.1. [Q14244-2]
NP_001185546.1. NM_001198617.1. [Q14244-3]
NP_001185547.1. NM_001198618.1. [Q14244-5]
NP_001185548.1. NM_001198619.1. [Q14244-5]
NP_003971.1. NM_003980.4. [Q14244-1]
XP_006715663.1. XM_006715600.2. [Q14244-7]
XP_016866960.1. XM_017011471.1. [Q14244-4]
UniGeneiHs.486548.

3D structure databases

ProteinModelPortaliQ14244.
SMRiQ14244.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114515. 38 interactors.
IntActiQ14244. 18 interactors.
MINTiMINT-4532905.
STRINGi9606.ENSP00000414712.

PTM databases

iPTMnetiQ14244.
PhosphoSitePlusiQ14244.

Polymorphism and mutation databases

BioMutaiMAP7.
DMDMi74739817.

Proteomic databases

EPDiQ14244.
MaxQBiQ14244.
PaxDbiQ14244.
PeptideAtlasiQ14244.
PRIDEiQ14244.

Protocols and materials databases

DNASUi9053.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354570; ENSP00000346581; ENSG00000135525. [Q14244-1]
ENST00000432797; ENSP00000414879; ENSG00000135525. [Q14244-5]
ENST00000438100; ENSP00000400790; ENSG00000135525. [Q14244-4]
ENST00000454590; ENSP00000414712; ENSG00000135525. [Q14244-7]
ENST00000544465; ENSP00000445737; ENSG00000135525. [Q14244-6]
ENST00000611373; ENSP00000482998; ENSG00000135525. [Q14244-5]
ENST00000616617; ENSP00000483511; ENSG00000135525. [Q14244-3]
ENST00000618822; ENSP00000482356; ENSG00000135525. [Q14244-2]
GeneIDi9053.
KEGGihsa:9053.
UCSCiuc003qgz.4. human. [Q14244-1]

Organism-specific databases

CTDi9053.
DisGeNETi9053.
GeneCardsiMAP7.
HGNCiHGNC:6869. MAP7.
HPAiHPA029712.
HPA029713.
MIMi604108. gene.
neXtProtiNX_Q14244.
OpenTargetsiENSG00000135525.
PharmGKBiPA30615.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IIRT. Eukaryota.
ENOG410XS5W. LUCA.
GeneTreeiENSGT00660000095160.
HOGENOMiHOG000231569.
HOVERGENiHBG081952.
InParanoidiQ14244.
KOiK10433.
PhylomeDBiQ14244.
TreeFamiTF332273.

Miscellaneous databases

ChiTaRSiMAP7. human.
GeneWikiiMAP7.
GenomeRNAii9053.
PROiQ14244.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000135525.
CleanExiHS_MAP7.
ExpressionAtlasiQ14244. baseline and differential.
GenevisibleiQ14244. HS.

Family and domain databases

InterProiIPR030707. MAP7.
IPR008604. MAP7_fam.
[Graphical view]
PANTHERiPTHR15073. PTHR15073. 1 hit.
PTHR15073:SF4. PTHR15073:SF4. 1 hit.
PfamiPF05672. MAP7. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMAP7_HUMAN
AccessioniPrimary (citable) accession number: Q14244
Secondary accession number(s): B7Z290
, B7Z400, B7Z5S7, B7Z9U7, C9JPS0, E9PCP3, F5H1E2, Q7Z6S0, Q8TAU5, Q9NY82, Q9NY83
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: November 1, 1996
Last modified: November 30, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.