Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BTG3

Gene

BTG3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.

GO - Biological processi

  • negative regulation of cell proliferation Source: ProtInc
  • negative regulation of mitotic cell cycle Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BTG3
Alternative name(s):
Abundant in neuroepithelium area protein
BTG family member 3
Protein Tob5
Gene namesi
Name:BTG3
Synonyms:ANA, TOB5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

HGNCiHGNC:1132. BTG3.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25452.

Polymorphism and mutation databases

BioMutaiBTG3.
DMDMi23830904.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 252252Protein BTG3PRO_0000143807Add
BLAST

Proteomic databases

EPDiQ14201.
PRIDEiQ14201.

PTM databases

iPTMnetiQ14201.
PhosphoSiteiQ14201.

Expressioni

Tissue specificityi

Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung.1 Publication

Developmental stagei

Expression is cell cycle dependent with the highest levels at the end of G1 phase, peaking at the G1-S transition.1 Publication

Gene expression databases

BgeeiQ14201.
CleanExiHS_BTG3.
ExpressionAtlasiQ14201. baseline and differential.
GenevisibleiQ14201. HS.

Organism-specific databases

HPAiHPA018400.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
E2F1Q010943EBI-948192,EBI-448924

Protein-protein interaction databases

BioGridi116150. 12 interactions.
IntActiQ14201. 4 interactions.
MINTiMINT-203099.

Structurei

3D structure databases

ProteinModelPortaliQ14201.
SMRiQ14201. Positions 1-107.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi144 – 1496Poly-Ser

Sequence similaritiesi

Belongs to the BTG family.Curated

Phylogenomic databases

GeneTreeiENSGT00550000074461.
HOGENOMiHOG000234823.
HOVERGENiHBG004332.
InParanoidiQ14201.
KOiK14443.
OMAiCEVCCRR.
OrthoDBiEOG786H63.
PhylomeDBiQ14201.
TreeFamiTF105272.

Family and domain databases

InterProiIPR002087. Anti_prolifrtn.
[Graphical view]
PfamiPF07742. BTG. 1 hit.
[Graphical view]
PRINTSiPR00310. ANTIPRLFBTG1.
SMARTiSM00099. btg1. 1 hit.
[Graphical view]
SUPFAMiSSF160696. SSF160696. 1 hit.
PROSITEiPS00960. BTG_1. 1 hit.
PS01203. BTG_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14201-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKNEIAAVVF FFTRLVRKHD KLKKEAVERF AEKLTLILQE KYKNHWYPEK
60 70 80 90 100
PSKGQAYRCI RVNKFQRVDP DVLKACENSC ILYSDLGLPK ELTLWVDPCE
110 120 130 140 150
VCCRYGEKNN AFIVASFENK DENKDEISRK VTRALDKVTS DYHSGSSSSD
160 170 180 190 200
EETSKEMEVK PSSVTAAASP VYQISELIFP PLPMWHPLPR KKPGMYRGNG
210 220 230 240 250
HQNHYPPPVP FGYPNQGRKN KPYRPIPVTW VPPPGMHCDR NHWINPHMLA

PH
Length:252
Mass (Da):29,116
Last modified:October 10, 2002 - v3
Checksum:iBEBE7E15709D2CC7
GO
Isoform 2 (identifier: Q14201-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-104: R → RRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIM

Show »
Length:296
Mass (Da):34,163
Checksum:i0AC870F223ECE2DE
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti40 – 401E → G in BAA33788 (PubMed:9632145).Curated
Sequence conflicti45 – 451H → P in BAA33788 (PubMed:9632145).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei104 – 1041R → RRDGVSPCWPDCSQTPDLVI RPPWPPKALDYRREPLRPAS SFLIM in isoform 2. 2 PublicationsVSP_000578

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D64110 mRNA. Translation: BAA33788.1.
BT007276 mRNA. Translation: AAP35940.1.
CH471079 Genomic DNA. Translation: EAX10026.1.
CH471079 Genomic DNA. Translation: EAX10029.1.
BC011957 mRNA. Translation: AAH11957.1.
CCDSiCCDS13569.1. [Q14201-1]
CCDS46636.1. [Q14201-2]
PIRiT09539.
RefSeqiNP_001124386.1. NM_001130914.1. [Q14201-2]
NP_006797.3. NM_006806.4. [Q14201-1]
UniGeneiHs.473420.

Genome annotation databases

EnsembliENST00000339775; ENSP00000344609; ENSG00000154640. [Q14201-2]
ENST00000348354; ENSP00000284879; ENSG00000154640. [Q14201-1]
GeneIDi10950.
KEGGihsa:10950.
UCSCiuc002ykl.4. human. [Q14201-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D64110 mRNA. Translation: BAA33788.1.
BT007276 mRNA. Translation: AAP35940.1.
CH471079 Genomic DNA. Translation: EAX10026.1.
CH471079 Genomic DNA. Translation: EAX10029.1.
BC011957 mRNA. Translation: AAH11957.1.
CCDSiCCDS13569.1. [Q14201-1]
CCDS46636.1. [Q14201-2]
PIRiT09539.
RefSeqiNP_001124386.1. NM_001130914.1. [Q14201-2]
NP_006797.3. NM_006806.4. [Q14201-1]
UniGeneiHs.473420.

3D structure databases

ProteinModelPortaliQ14201.
SMRiQ14201. Positions 1-107.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116150. 12 interactions.
IntActiQ14201. 4 interactions.
MINTiMINT-203099.

PTM databases

iPTMnetiQ14201.
PhosphoSiteiQ14201.

Polymorphism and mutation databases

BioMutaiBTG3.
DMDMi23830904.

Proteomic databases

EPDiQ14201.
PRIDEiQ14201.

Protocols and materials databases

DNASUi10950.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339775; ENSP00000344609; ENSG00000154640. [Q14201-2]
ENST00000348354; ENSP00000284879; ENSG00000154640. [Q14201-1]
GeneIDi10950.
KEGGihsa:10950.
UCSCiuc002ykl.4. human. [Q14201-1]

Organism-specific databases

CTDi10950.
GeneCardsiBTG3.
HGNCiHGNC:1132. BTG3.
HPAiHPA018400.
MIMi605674. gene.
neXtProtiNX_Q14201.
PharmGKBiPA25452.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00550000074461.
HOGENOMiHOG000234823.
HOVERGENiHBG004332.
InParanoidiQ14201.
KOiK14443.
OMAiCEVCCRR.
OrthoDBiEOG786H63.
PhylomeDBiQ14201.
TreeFamiTF105272.

Miscellaneous databases

ChiTaRSiBTG3. human.
GeneWikiiBTG3.
GenomeRNAii10950.
PROiQ14201.
SOURCEiSearch...

Gene expression databases

BgeeiQ14201.
CleanExiHS_BTG3.
ExpressionAtlasiQ14201. baseline and differential.
GenevisibleiQ14201. HS.

Family and domain databases

InterProiIPR002087. Anti_prolifrtn.
[Graphical view]
PfamiPF07742. BTG. 1 hit.
[Graphical view]
PRINTSiPR00310. ANTIPRLFBTG1.
SMARTiSM00099. btg1. 1 hit.
[Graphical view]
SUPFAMiSSF160696. SSF160696. 1 hit.
PROSITEiPS00960. BTG_1. 1 hit.
PS01203. BTG_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "ANA, a novel member of Tob/BTG1 family, is expressed in the ventricular zone of the developing central nervous system."
    Yoshida Y., Matsuda S., Ikematsu N., Kawamura-Tsuzuku J., Inazawa J., Umemori H., Yamamoto T.
    Oncogene 16:2687-2693(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Ovary.
  5. "Cloning of the mouse BTG3 gene and definition of a new gene family (the BTG family) involved in the negative control of the cell cycle."
    Guehenneux F., Duret L., Callanan M.B., Bouhas R., Hayette S., Berthet C., Samarut C., Rimokh R., Birot A.-M., Wang Q., Magaud J.-P., Rouault J.-P.
    Leukemia 11:370-375(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.

Entry informationi

Entry nameiBTG3_HUMAN
AccessioniPrimary (citable) accession number: Q14201
Secondary accession number(s): D3DSC4, Q53XV1, Q96ET7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 10, 2002
Last modified: June 8, 2016
This is version 130 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.