Reviewed,
UniProtKB/Swiss-Prot Q14201 (BTG3_HUMAN)
Last modified
November 4, 2008.
Version 70.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Protein BTG3 Alternative name(s): BTG family member 3 Protein Tob5 Abundant in neuroepithelium area protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 252 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase. |
| Tissue specificity | Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung. |
| Developmental stage | Expression is cell cycle dependent with the highest levels at the end of G1 phase, peaking at the G1-S transition. |
| Sequence similarities | Belongs to the BTG family. |
Ontologies
Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
Gene Ontology (GO) | |
| Biological process | negative regulation of cell proliferation Ref.1 Traceable author statement. Source: ProtInc negative regulation of mitotic cell cycle Ref.1Inferred from direct assay. Source: MGI |
| Cellular component | cytoplasm Ref.1 Inferred from direct assay. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q14201-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q14201-2) The sequence of this isoform differs from the canonical sequence as follows: 104-104: R → RRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIM | ||||||
| Notes: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 252 | 252 | Protein BTG3 | PRO_0000143807 | |||||
Regions | |||||||||
| Compositional bias | 144 – 149 | 6 | Poly-Ser | ||||||
Natural variations | |||||||||
| Alternative sequence | 104 | 1 | R → RRDGVSPCWPDCSQTPDLVI RPPWPPKALDYRREPLRPAS SFLIM in isoform 2. | VSP_000578 | |||||
Experimental info | |||||||||
| Sequence conflict | 40 | 1 | E → G in BAA33788. Ref.1 | ||||||
| Sequence conflict | 45 | 1 | H → P in BAA33788. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ANA, a novel member of Tob/BTG1 family, is expressed in the ventricular zone of the developing central nervous system." Yoshida Y., Matsuda S., Ikematsu N., Kawamura-Tsuzuku J., Inazawa J., Umemori H., Yamamoto T. Oncogene 16:2687-2693(1998) [PubMed: 9632145] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Ovary. |
| [3] | "Cloning of the mouse BTG3 gene and definition of a new gene family (the BTG family) involved in the negative control of the cell cycle." Guehenneux F., Duret L., Callanan M.B., Bouhas R., Hayette S., Berthet C., Samarut C., Rimokh R., Birot A.M., Wang Q., Magaud J.-P., Rouault J.-P. Leukemia 11:370-375(1997) [PubMed: 9067576] [Abstract] Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| D64110 mRNA. Translation: BAA33788.1. BC011957 mRNA. Translation: AAH11957.1. | |
| PIR | T09539. |
| RefSeq | NP_001124386.1. NP_006797.3. |
| UniGene | Hs.473420 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q14201. |
PTM databases | |
| PhosphoSite | Q14201. |
Genome annotation databases | |
| Ensembl | ENSG00000154640. Homo sapiens. [Contig view] |
| GeneID | 10950. |
| KEGG | hsa:10950. |
Organism-specific databases | |
| H-InvDB | HIX0020731. |
| HGNC | HGNC:1132. BTG3. |
| HPA | HPA018400. |
| MIM | 605674. gene. |
| PharmGKB | PA25452. |
| GenAtlas | Search... |
| GeneCards | Search... |
Phylogenomic databases | |
| HOVERGEN | Q14201. |
Gene expression databases | |
| CleanEx | HS_BTG3. |
| GermOnline | ENSG00000154640. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002087. Anti_prolifrtn. [Graphical view] |
| Pfam | PF07742. BTG. 1 hit. [Graphical view] |
| PRINTS | PR00310. ANTIPRLFBTG1. |
| SMART | SM00099. btg1. 1 hit. [Graphical view] |
| PROSITE | PS00960. BTG_1. 1 hit. PS01203. BTG_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| LinkHub | Q14201. |
| NextBio | 41605. |
| SOURCE | Search... |
Entry information
| Entry name | BTG3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14201 Secondary accession number(s): Q96ET7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| UniProtKB secondary accession numbers Index of UniProtKB secondary accession numbers |
| SIMILARITY comments Index of protein domains and families |

Clusters with


