Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BTG3

Gene

BTG3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Overexpression impairs serum-induced cell cycle progression from the G0/G1 to S phase.

GO - Biological processi

  • negative regulation of cell proliferation Source: ProtInc
  • negative regulation of mitotic cell cycle Source: MGI

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BTG3
Alternative name(s):
Abundant in neuroepithelium area protein
BTG family member 3
Protein Tob5
Gene namesi
Name:BTG3
Synonyms:ANA, TOB5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

EuPathDBiHostDB:ENSG00000154640.14
HGNCiHGNC:1132 BTG3
MIMi605674 gene
neXtProtiNX_Q14201

Subcellular locationi

Pathology & Biotechi

Organism-specific databases

DisGeNETi10950
OpenTargetsiENSG00000154640
PharmGKBiPA25452

Polymorphism and mutation databases

BioMutaiBTG3
DMDMi23830904

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001438071 – 252Protein BTG3Add BLAST252

Proteomic databases

EPDiQ14201
PeptideAtlasiQ14201
PRIDEiQ14201

PTM databases

iPTMnetiQ14201
PhosphoSitePlusiQ14201

Expressioni

Tissue specificityi

Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung.1 Publication

Developmental stagei

Expression is cell cycle dependent with the highest levels at the end of G1 phase, peaking at the G1-S transition.1 Publication

Gene expression databases

BgeeiENSG00000154640
CleanExiHS_BTG3
ExpressionAtlasiQ14201 baseline and differential
GenevisibleiQ14201 HS

Organism-specific databases

HPAiHPA018400

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
E2F1Q010943EBI-948192,EBI-448924

Protein-protein interaction databases

BioGridi11615015 interactors.
IntActiQ14201 4 interactors.
MINTiQ14201

Structurei

3D structure databases

ProteinModelPortaliQ14201
SMRiQ14201
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi144 – 149Poly-Ser6

Sequence similaritiesi

Belongs to the BTG family.Curated

Phylogenomic databases

GeneTreeiENSGT00550000074461
HOGENOMiHOG000234823
HOVERGENiHBG004332
InParanoidiQ14201
KOiK14443
OMAiCEVCCRR
OrthoDBiEOG091G0U1P
PhylomeDBiQ14201
TreeFamiTF105272

Family and domain databases

Gene3Di1.20.120.11201 hit
InterProiView protein in InterPro
IPR002087 Anti_prolifrtn
IPR036054 BTG-like_sf
PfamiView protein in Pfam
PF07742 BTG, 1 hit
PRINTSiPR00310 ANTIPRLFBTG1
SMARTiView protein in SMART
SM00099 btg1, 1 hit
SUPFAMiSSF160696 SSF160696, 1 hit
PROSITEiView protein in PROSITE
PS00960 BTG_1, 1 hit
PS01203 BTG_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14201-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKNEIAAVVF FFTRLVRKHD KLKKEAVERF AEKLTLILQE KYKNHWYPEK
60 70 80 90 100
PSKGQAYRCI RVNKFQRVDP DVLKACENSC ILYSDLGLPK ELTLWVDPCE
110 120 130 140 150
VCCRYGEKNN AFIVASFENK DENKDEISRK VTRALDKVTS DYHSGSSSSD
160 170 180 190 200
EETSKEMEVK PSSVTAAASP VYQISELIFP PLPMWHPLPR KKPGMYRGNG
210 220 230 240 250
HQNHYPPPVP FGYPNQGRKN KPYRPIPVTW VPPPGMHCDR NHWINPHMLA

PH
Length:252
Mass (Da):29,116
Last modified:October 10, 2002 - v3
Checksum:iBEBE7E15709D2CC7
GO
Isoform 2 (identifier: Q14201-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-104: R → RRDGVSPCWPDCSQTPDLVIRPPWPPKALDYRREPLRPASSFLIM

Show »
Length:296
Mass (Da):34,163
Checksum:i0AC870F223ECE2DE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti40E → G in BAA33788 (PubMed:9632145).Curated1
Sequence conflicti45H → P in BAA33788 (PubMed:9632145).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000578104R → RRDGVSPCWPDCSQTPDLVI RPPWPPKALDYRREPLRPAS SFLIM in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D64110 mRNA Translation: BAA33788.1
BT007276 mRNA Translation: AAP35940.1
CH471079 Genomic DNA Translation: EAX10026.1
CH471079 Genomic DNA Translation: EAX10029.1
BC011957 mRNA Translation: AAH11957.1
CCDSiCCDS13569.1 [Q14201-1]
CCDS46636.1 [Q14201-2]
PIRiT09539
RefSeqiNP_001124386.1, NM_001130914.1 [Q14201-2]
NP_006797.3, NM_006806.4 [Q14201-1]
XP_016883754.1, XM_017028265.1 [Q14201-1]
XP_016883755.1, XM_017028266.1 [Q14201-1]
UniGeneiHs.473420

Genome annotation databases

EnsembliENST00000339775; ENSP00000344609; ENSG00000154640 [Q14201-2]
ENST00000348354; ENSP00000284879; ENSG00000154640 [Q14201-1]
GeneIDi10950
KEGGihsa:10950
UCSCiuc002ykl.4 human [Q14201-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBTG3_HUMAN
AccessioniPrimary (citable) accession number: Q14201
Secondary accession number(s): D3DSC4, Q53XV1, Q96ET7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 10, 2002
Last modified: March 28, 2018
This is version 142 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome