Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q14168

- MPP2_HUMAN

UniProt

Q14168 - MPP2_HUMAN

Protein

MAGUK p55 subfamily member 2

Gene

MPP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 136 (01 Oct 2014)
      Sequence version 3 (02 Mar 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. guanylate kinase activity Source: ProtInc

    GO - Biological processi

    1. nucleotide phosphorylation Source: GOC
    2. signal transduction Source: ProtInc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MAGUK p55 subfamily member 2
    Alternative name(s):
    Discs large homolog 2
    Protein MPP2
    Gene namesi
    Name:MPP2
    Synonyms:DLG2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:7220. MPP2.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of plasma membrane Source: ProtInc
    2. membrane Source: ProtInc

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30925.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 576576MAGUK p55 subfamily member 2PRO_0000094573Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei141 – 1411Phosphothreonine1 Publication
    Modified residuei145 – 1451PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ14168.
    PaxDbiQ14168.
    PRIDEiQ14168.

    PTM databases

    PhosphoSiteiQ14168.

    Expressioni

    Gene expression databases

    ArrayExpressiQ14168.
    BgeeiQ14168.
    CleanExiHS_DLG2.
    HS_MPP2.
    GenevestigatoriQ14168.

    Organism-specific databases

    HPAiHPA026486.

    Interactioni

    Protein-protein interaction databases

    BioGridi110495. 7 interactions.
    IntActiQ14168. 7 interactions.
    MINTiMINT-4532844.
    STRINGi9606.ENSP00000269095.

    Structurei

    Secondary structure

    1
    576
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi177 – 19115
    Beta strandi193 – 1953
    Helixi196 – 2005
    Beta strandi208 – 2125
    Helixi221 – 2299
    Beta strandi233 – 2353
    Beta strandi237 – 2404

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2E7KNMR-A163-240[»]
    ProteinModelPortaliQ14168.
    SMRiQ14168. Positions 163-240, 252-571.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ14168.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini8 – 6053L27 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini84 – 14259L27 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini185 – 24056PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini249 – 31769SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini374 – 561188Guanylate kinase-likePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the MAGUK family.Curated
    Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
    Contains 2 L27 domains.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiCOG0194.
    HOGENOMiHOG000233034.
    HOVERGENiHBG001858.
    InParanoidiQ14168.
    OrthoDBiEOG79CXZ5.
    PhylomeDBiQ14168.
    TreeFamiTF314263.

    Family and domain databases

    Gene3Di2.30.42.10. 1 hit.
    3.40.50.300. 2 hits.
    InterProiIPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR004172. L27.
    IPR014775. L27_C.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    [Graphical view]
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF02828. L27. 2 hits.
    PF00595. PDZ. 1 hit.
    PF07653. SH3_2. 1 hit.
    [Graphical view]
    SMARTiSM00072. GuKc. 1 hit.
    SM00569. L27. 2 hits.
    SM00228. PDZ. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 1 hit.
    SSF50156. SSF50156. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS51022. L27. 2 hits.
    PS50106. PDZ. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q14168-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPVAATNSET AMQQVLDNLG SLPSATGAAE LDLIFLRGIM ESPIVRSLAK    50
    VIMVLWFMQQ NVFVPMKYML KYFGAHERLE ETKLEAVRDN NLELVQEILR 100
    DLAHVAEQSS TAAELAHILQ EPHFQSLLET HDSVASKTYE TPPPSPGLDP 150
    TFSNQPVPPD AVRMVGIRKT AGEHLGVTFR VEGGELVIAR ILHGGMVAQQ 200
    GLLHVGDIIK EVNGQPVGSD PRALQELLRN ASGSVILKIL PSYQEPHLPR 250
    QVFVKCHFDY DPARDSLIPC KEAGLRFNAG DLLQIVNQDD ANWWQACHVE 300
    GGSAGLIPSQ LLEEKRKAFV KRDLELTPNS GTLCGSLSGK KKKRMMYLTT 350
    KNAEFDRHEL LIYEEVARMP PFRRKTLVLI GAQGVGRRSL KNKLIMWDPD 400
    RYGTTVPYTS RRPKDSEREG QGYSFVSRGE MEADVRAGRY LEHGEYEGNL 450
    YGTRIDSIRG VVAAGKVCVL DVNPQAVKVL RTAEFVPYVV FIEAPDFETL 500
    RAMNRAALES GISTKQLTEA DLRRTVEESS RIQRGYGHYF DLCLVNSNLE 550
    RTFRELQTAM EKLRTEPQWV PVSWVY 576
    Length:576
    Mass (Da):64,581
    Last modified:March 2, 2010 - v3
    Checksum:iA08E858EA646A305
    GO
    Isoform 2 (identifier: Q14168-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         51-74: Missing.

    Show »
    Length:552
    Mass (Da):61,585
    Checksum:i81BBB336B3C9DA89
    GO
    Isoform 3 (identifier: Q14168-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-10: MPVAATNSET → MAGSPGSGVSLEGISLESSEEAELQRE
         51-74: Missing.

    Show »
    Length:569
    Mass (Da):63,315
    Checksum:i40FE59BE6B6D998C
    GO
    Isoform 4 (identifier: Q14168-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSWAPPPQVGQNLRSQTVLRILNGMEDLMWVAMEERRFRALASFTM
         51-74: Missing.

    Show »
    Length:597
    Mass (Da):66,802
    Checksum:i2D04EAC57B8C7934
    GO
    Isoform 5 (identifier: Q14168-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-163: Missing.

    Show »
    Length:413
    Mass (Da):46,518
    Checksum:i6F9ADB21579E5A2F
    GO
    Isoform 6 (identifier: Q14168-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: Missing.
         51-74: Missing.

    Show »
    Length:541
    Mass (Da):60,512
    Checksum:i83D4E1782E4D3C99
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti80 – 801E → G in CAI56746. (PubMed:17974005)Curated
    Sequence conflicti104 – 1052HV → QL in CAA58067. (PubMed:7590743)Curated
    Sequence conflicti104 – 1052HV → QL in BAD97280. (PubMed:11230166)Curated
    Sequence conflicti104 – 1052HV → QL in CAB66489. 1 PublicationCurated
    Sequence conflicti104 – 1052HV → QL in CAI56746. (PubMed:17974005)Curated
    Sequence conflicti104 – 1052HV → QL in AAH30287. (PubMed:15489334)Curated
    Sequence conflicti104 – 1052HV → QL in BAG61302. (PubMed:14702039)Curated
    Sequence conflicti104 – 1052HV → QL in BAH12204. (PubMed:14702039)Curated
    Sequence conflicti242 – 2421S → N in CAA58067. (PubMed:7590743)Curated
    Sequence conflicti531 – 5311R → C in BAG57760. (PubMed:14702039)Curated
    Sequence conflicti554 – 5541R → C in BAG61302. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 163163Missing in isoform 5. 1 PublicationVSP_055136Add
    BLAST
    Alternative sequencei1 – 1111Missing in isoform 6. 1 PublicationVSP_055137Add
    BLAST
    Alternative sequencei1 – 1010MPVAATNSET → MAGSPGSGVSLEGISLESSE EAELQRE in isoform 3. 1 PublicationVSP_022951
    Alternative sequencei1 – 11M → MSWAPPPQVGQNLRSQTVLR ILNGMEDLMWVAMEERRFRA LASFTM in isoform 4. 1 PublicationVSP_055138
    Alternative sequencei51 – 7424Missing in isoform 2, isoform 3, isoform 4 and isoform 6. 5 PublicationsVSP_003156Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X82895 mRNA. Translation: CAA58067.1.
    AL136554 mRNA. Translation: CAB66489.1.
    AK294564 mRNA. Translation: BAG57760.1.
    AK295858 mRNA. Translation: BAH12204.1.
    AK299286 mRNA. Translation: BAG61302.1.
    CR936598 mRNA. Translation: CAI56746.1.
    AK223560 mRNA. Translation: BAD97280.1.
    AC007993 Genomic DNA. No translation available.
    BC030287 mRNA. Translation: AAH30287.1.
    CCDSiCCDS11471.1. [Q14168-2]
    CCDS62206.1. [Q14168-5]
    CCDS62207.1. [Q14168-6]
    CCDS62208.1. [Q14168-3]
    CCDS62209.1. [Q14168-1]
    CCDS62210.1. [Q14168-4]
    PIRiA57653.
    RefSeqiNP_001265299.1. NM_001278370.1.
    NP_001265300.1. NM_001278371.1.
    NP_001265301.1. NM_001278372.1.
    NP_001265302.1. NM_001278373.1.
    NP_001265303.1. NM_001278374.1.
    NP_001265304.1. NM_001278375.1.
    NP_001265305.2. NM_001278376.2.
    NP_001265310.1. NM_001278381.1.
    NP_005365.4. NM_005374.4.
    UniGeneiHs.514208.

    Genome annotation databases

    EnsembliENST00000269095; ENSP00000269095; ENSG00000108852. [Q14168-2]
    ENST00000377184; ENSP00000366389; ENSG00000108852. [Q14168-3]
    ENST00000461854; ENSP00000428286; ENSG00000108852. [Q14168-1]
    ENST00000518766; ENSP00000428182; ENSG00000108852. [Q14168-4]
    ENST00000520305; ENSP00000428136; ENSG00000108852. [Q14168-5]
    ENST00000523501; ENSP00000430540; ENSG00000108852. [Q14168-6]
    ENST00000536246; ENSP00000438012; ENSG00000108852. [Q14168-6]
    GeneIDi4355.
    KEGGihsa:4355.
    UCSCiuc002ien.1. human. [Q14168-3]
    uc002ieo.1. human. [Q14168-2]
    uc010win.1. human. [Q14168-1]

    Polymorphism databases

    DMDMi290457681.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X82895 mRNA. Translation: CAA58067.1 .
    AL136554 mRNA. Translation: CAB66489.1 .
    AK294564 mRNA. Translation: BAG57760.1 .
    AK295858 mRNA. Translation: BAH12204.1 .
    AK299286 mRNA. Translation: BAG61302.1 .
    CR936598 mRNA. Translation: CAI56746.1 .
    AK223560 mRNA. Translation: BAD97280.1 .
    AC007993 Genomic DNA. No translation available.
    BC030287 mRNA. Translation: AAH30287.1 .
    CCDSi CCDS11471.1. [Q14168-2 ]
    CCDS62206.1. [Q14168-5 ]
    CCDS62207.1. [Q14168-6 ]
    CCDS62208.1. [Q14168-3 ]
    CCDS62209.1. [Q14168-1 ]
    CCDS62210.1. [Q14168-4 ]
    PIRi A57653.
    RefSeqi NP_001265299.1. NM_001278370.1.
    NP_001265300.1. NM_001278371.1.
    NP_001265301.1. NM_001278372.1.
    NP_001265302.1. NM_001278373.1.
    NP_001265303.1. NM_001278374.1.
    NP_001265304.1. NM_001278375.1.
    NP_001265305.2. NM_001278376.2.
    NP_001265310.1. NM_001278381.1.
    NP_005365.4. NM_005374.4.
    UniGenei Hs.514208.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2E7K NMR - A 163-240 [» ]
    ProteinModelPortali Q14168.
    SMRi Q14168. Positions 163-240, 252-571.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110495. 7 interactions.
    IntActi Q14168. 7 interactions.
    MINTi MINT-4532844.
    STRINGi 9606.ENSP00000269095.

    PTM databases

    PhosphoSitei Q14168.

    Polymorphism databases

    DMDMi 290457681.

    Proteomic databases

    MaxQBi Q14168.
    PaxDbi Q14168.
    PRIDEi Q14168.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000269095 ; ENSP00000269095 ; ENSG00000108852 . [Q14168-2 ]
    ENST00000377184 ; ENSP00000366389 ; ENSG00000108852 . [Q14168-3 ]
    ENST00000461854 ; ENSP00000428286 ; ENSG00000108852 . [Q14168-1 ]
    ENST00000518766 ; ENSP00000428182 ; ENSG00000108852 . [Q14168-4 ]
    ENST00000520305 ; ENSP00000428136 ; ENSG00000108852 . [Q14168-5 ]
    ENST00000523501 ; ENSP00000430540 ; ENSG00000108852 . [Q14168-6 ]
    ENST00000536246 ; ENSP00000438012 ; ENSG00000108852 . [Q14168-6 ]
    GeneIDi 4355.
    KEGGi hsa:4355.
    UCSCi uc002ien.1. human. [Q14168-3 ]
    uc002ieo.1. human. [Q14168-2 ]
    uc010win.1. human. [Q14168-1 ]

    Organism-specific databases

    CTDi 4355.
    GeneCardsi GC17M041963.
    H-InvDB HIX0013870.
    HGNCi HGNC:7220. MPP2.
    HPAi HPA026486.
    MIMi 600723. gene.
    neXtProti NX_Q14168.
    PharmGKBi PA30925.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0194.
    HOGENOMi HOG000233034.
    HOVERGENi HBG001858.
    InParanoidi Q14168.
    OrthoDBi EOG79CXZ5.
    PhylomeDBi Q14168.
    TreeFami TF314263.

    Miscellaneous databases

    EvolutionaryTracei Q14168.
    GeneWikii MPP2.
    GenomeRNAii 4355.
    NextBioi 17134.
    PROi Q14168.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q14168.
    Bgeei Q14168.
    CleanExi HS_DLG2.
    HS_MPP2.
    Genevestigatori Q14168.

    Family and domain databases

    Gene3Di 2.30.42.10. 1 hit.
    3.40.50.300. 2 hits.
    InterProi IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR004172. L27.
    IPR014775. L27_C.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    [Graphical view ]
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF02828. L27. 2 hits.
    PF00595. PDZ. 1 hit.
    PF07653. SH3_2. 1 hit.
    [Graphical view ]
    SMARTi SM00072. GuKc. 1 hit.
    SM00569. L27. 2 hits.
    SM00228. PDZ. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 1 hit.
    SSF50156. SSF50156. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS51022. L27. 2 hits.
    PS50106. PDZ. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A gene (DLG2) located at 17q12-q21 encodes a new homologue of the Drosophila tumor suppressor dlg-A."
      Mazoyer S., Gayther S.A., Nagai M.A., Smith S.A., Dunning A., van Rensburg E.J., Albertsen H., White R., Ponder B.A.J.
      Genomics 28:25-31(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Amygdala.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6).
      Tissue: Amygdala and Hippocampus.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Salivary gland.
    5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    6. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-141, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Solution structure of the PDZ domain from human maguk p55 subfamily member 2."
      RIKEN structural genomics initiative (RSGI)
      Submitted (JAN-2008) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 163-240.

    Entry informationi

    Entry nameiMPP2_HUMAN
    AccessioniPrimary (citable) accession number: Q14168
    Secondary accession number(s): B4DGE9
    , B4DRJ0, B7Z3G8, E7EV80, E7EV91, E7EX01, Q53ES9, Q5CZB9, Q9BQJ2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: March 2, 2010
    Last modified: October 1, 2014
    This is version 136 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3