Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14168

- MPP2_HUMAN

UniProt

Q14168 - MPP2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

MAGUK p55 subfamily member 2

Gene

MPP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. guanylate kinase activity Source: ProtInc

GO - Biological processi

  1. nucleotide phosphorylation Source: GOC
  2. signal transduction Source: ProtInc
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
MAGUK p55 subfamily member 2
Alternative name(s):
Discs large homolog 2
Protein MPP2
Gene namesi
Name:MPP2
Synonyms:DLG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:7220. MPP2.

Subcellular locationi

GO - Cellular componenti

  1. integral component of plasma membrane Source: ProtInc
  2. membrane Source: ProtInc
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30925.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 576576MAGUK p55 subfamily member 2PRO_0000094573Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei141 – 1411Phosphothreonine1 Publication
Modified residuei145 – 1451PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ14168.
PaxDbiQ14168.
PRIDEiQ14168.

PTM databases

PhosphoSiteiQ14168.

Expressioni

Gene expression databases

BgeeiQ14168.
CleanExiHS_DLG2.
HS_MPP2.
ExpressionAtlasiQ14168. baseline and differential.
GenevestigatoriQ14168.

Organism-specific databases

HPAiHPA026486.

Interactioni

Protein-protein interaction databases

BioGridi110495. 8 interactions.
IntActiQ14168. 7 interactions.
MINTiMINT-4532844.
STRINGi9606.ENSP00000269095.

Structurei

Secondary structure

1
576
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi177 – 19115
Beta strandi193 – 1953
Helixi196 – 2005
Beta strandi208 – 2125
Helixi221 – 2299
Beta strandi233 – 2353
Beta strandi237 – 2404

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2E7KNMR-A163-240[»]
ProteinModelPortaliQ14168.
SMRiQ14168. Positions 163-240, 252-571.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14168.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini8 – 6053L27 1PROSITE-ProRule annotationAdd
BLAST
Domaini84 – 14259L27 2PROSITE-ProRule annotationAdd
BLAST
Domaini185 – 24056PDZPROSITE-ProRule annotationAdd
BLAST
Domaini249 – 31769SH3PROSITE-ProRule annotationAdd
BLAST
Domaini374 – 561188Guanylate kinase-likePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the MAGUK family.Curated
Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 2 L27 domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiCOG0194.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000233034.
HOVERGENiHBG001858.
InParanoidiQ14168.
OrthoDBiEOG79CXZ5.
PhylomeDBiQ14168.
TreeFamiTF314263.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR004172. L27.
IPR014775. L27_C.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF02828. L27. 2 hits.
PF00595. PDZ. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
SMARTiSM00072. GuKc. 1 hit.
SM00569. L27. 2 hits.
SM00228. PDZ. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 2 hits.
PS50106. PDZ. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q14168-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVAATNSET AMQQVLDNLG SLPSATGAAE LDLIFLRGIM ESPIVRSLAK
60 70 80 90 100
VIMVLWFMQQ NVFVPMKYML KYFGAHERLE ETKLEAVRDN NLELVQEILR
110 120 130 140 150
DLAHVAEQSS TAAELAHILQ EPHFQSLLET HDSVASKTYE TPPPSPGLDP
160 170 180 190 200
TFSNQPVPPD AVRMVGIRKT AGEHLGVTFR VEGGELVIAR ILHGGMVAQQ
210 220 230 240 250
GLLHVGDIIK EVNGQPVGSD PRALQELLRN ASGSVILKIL PSYQEPHLPR
260 270 280 290 300
QVFVKCHFDY DPARDSLIPC KEAGLRFNAG DLLQIVNQDD ANWWQACHVE
310 320 330 340 350
GGSAGLIPSQ LLEEKRKAFV KRDLELTPNS GTLCGSLSGK KKKRMMYLTT
360 370 380 390 400
KNAEFDRHEL LIYEEVARMP PFRRKTLVLI GAQGVGRRSL KNKLIMWDPD
410 420 430 440 450
RYGTTVPYTS RRPKDSEREG QGYSFVSRGE MEADVRAGRY LEHGEYEGNL
460 470 480 490 500
YGTRIDSIRG VVAAGKVCVL DVNPQAVKVL RTAEFVPYVV FIEAPDFETL
510 520 530 540 550
RAMNRAALES GISTKQLTEA DLRRTVEESS RIQRGYGHYF DLCLVNSNLE
560 570
RTFRELQTAM EKLRTEPQWV PVSWVY
Length:576
Mass (Da):64,581
Last modified:March 2, 2010 - v3
Checksum:iA08E858EA646A305
GO
Isoform 2 (identifier: Q14168-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-74: Missing.

Show »
Length:552
Mass (Da):61,585
Checksum:i81BBB336B3C9DA89
GO
Isoform 3 (identifier: Q14168-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MPVAATNSET → MAGSPGSGVSLEGISLESSEEAELQRE
     51-74: Missing.

Show »
Length:569
Mass (Da):63,315
Checksum:i40FE59BE6B6D998C
GO
Isoform 4 (identifier: Q14168-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSWAPPPQVGQNLRSQTVLRILNGMEDLMWVAMEERRFRALASFTM
     51-74: Missing.

Show »
Length:597
Mass (Da):66,802
Checksum:i2D04EAC57B8C7934
GO
Isoform 5 (identifier: Q14168-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-163: Missing.

Show »
Length:413
Mass (Da):46,518
Checksum:i6F9ADB21579E5A2F
GO
Isoform 6 (identifier: Q14168-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: Missing.
     51-74: Missing.

Show »
Length:541
Mass (Da):60,512
Checksum:i83D4E1782E4D3C99
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti80 – 801E → G in CAI56746. (PubMed:17974005)Curated
Sequence conflicti104 – 1052HV → QL in CAA58067. (PubMed:7590743)Curated
Sequence conflicti104 – 1052HV → QL in BAD97280. (PubMed:11230166)Curated
Sequence conflicti104 – 1052HV → QL in CAB66489. 1 PublicationCurated
Sequence conflicti104 – 1052HV → QL in CAI56746. (PubMed:17974005)Curated
Sequence conflicti104 – 1052HV → QL in AAH30287. (PubMed:15489334)Curated
Sequence conflicti104 – 1052HV → QL in BAG61302. (PubMed:14702039)Curated
Sequence conflicti104 – 1052HV → QL in BAH12204. (PubMed:14702039)Curated
Sequence conflicti242 – 2421S → N in CAA58067. (PubMed:7590743)Curated
Sequence conflicti531 – 5311R → C in BAG57760. (PubMed:14702039)Curated
Sequence conflicti554 – 5541R → C in BAG61302. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 163163Missing in isoform 5. 1 PublicationVSP_055136Add
BLAST
Alternative sequencei1 – 1111Missing in isoform 6. 1 PublicationVSP_055137Add
BLAST
Alternative sequencei1 – 1010MPVAATNSET → MAGSPGSGVSLEGISLESSE EAELQRE in isoform 3. 1 PublicationVSP_022951
Alternative sequencei1 – 11M → MSWAPPPQVGQNLRSQTVLR ILNGMEDLMWVAMEERRFRA LASFTM in isoform 4. 1 PublicationVSP_055138
Alternative sequencei51 – 7424Missing in isoform 2, isoform 3, isoform 4 and isoform 6. 5 PublicationsVSP_003156Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X82895 mRNA. Translation: CAA58067.1.
AL136554 mRNA. Translation: CAB66489.1.
AK294564 mRNA. Translation: BAG57760.1.
AK295858 mRNA. Translation: BAH12204.1.
AK299286 mRNA. Translation: BAG61302.1.
CR936598 mRNA. Translation: CAI56746.1.
AK223560 mRNA. Translation: BAD97280.1.
AC007993 Genomic DNA. No translation available.
BC030287 mRNA. Translation: AAH30287.1.
CCDSiCCDS11471.1. [Q14168-2]
CCDS62206.1. [Q14168-5]
CCDS62207.1. [Q14168-6]
CCDS62208.1. [Q14168-3]
CCDS62209.1. [Q14168-1]
CCDS62210.1. [Q14168-4]
PIRiA57653.
RefSeqiNP_001265299.1. NM_001278370.1.
NP_001265300.1. NM_001278371.1.
NP_001265301.1. NM_001278372.1.
NP_001265302.1. NM_001278373.1.
NP_001265303.1. NM_001278374.1. [Q14168-5]
NP_001265304.1. NM_001278375.1.
NP_001265305.2. NM_001278376.2.
NP_001265310.1. NM_001278381.1.
NP_005365.4. NM_005374.4.
UniGeneiHs.514208.

Genome annotation databases

EnsembliENST00000518766; ENSP00000428182; ENSG00000108852.
ENST00000520305; ENSP00000428136; ENSG00000108852. [Q14168-5]
GeneIDi4355.
KEGGihsa:4355.
UCSCiuc002ien.1. human. [Q14168-3]
uc002ieo.1. human. [Q14168-2]
uc010wim.1. human.
uc010win.1. human. [Q14168-1]

Polymorphism databases

DMDMi290457681.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X82895 mRNA. Translation: CAA58067.1 .
AL136554 mRNA. Translation: CAB66489.1 .
AK294564 mRNA. Translation: BAG57760.1 .
AK295858 mRNA. Translation: BAH12204.1 .
AK299286 mRNA. Translation: BAG61302.1 .
CR936598 mRNA. Translation: CAI56746.1 .
AK223560 mRNA. Translation: BAD97280.1 .
AC007993 Genomic DNA. No translation available.
BC030287 mRNA. Translation: AAH30287.1 .
CCDSi CCDS11471.1. [Q14168-2 ]
CCDS62206.1. [Q14168-5 ]
CCDS62207.1. [Q14168-6 ]
CCDS62208.1. [Q14168-3 ]
CCDS62209.1. [Q14168-1 ]
CCDS62210.1. [Q14168-4 ]
PIRi A57653.
RefSeqi NP_001265299.1. NM_001278370.1.
NP_001265300.1. NM_001278371.1.
NP_001265301.1. NM_001278372.1.
NP_001265302.1. NM_001278373.1.
NP_001265303.1. NM_001278374.1. [Q14168-5 ]
NP_001265304.1. NM_001278375.1.
NP_001265305.2. NM_001278376.2.
NP_001265310.1. NM_001278381.1.
NP_005365.4. NM_005374.4.
UniGenei Hs.514208.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2E7K NMR - A 163-240 [» ]
ProteinModelPortali Q14168.
SMRi Q14168. Positions 163-240, 252-571.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110495. 8 interactions.
IntActi Q14168. 7 interactions.
MINTi MINT-4532844.
STRINGi 9606.ENSP00000269095.

PTM databases

PhosphoSitei Q14168.

Polymorphism databases

DMDMi 290457681.

Proteomic databases

MaxQBi Q14168.
PaxDbi Q14168.
PRIDEi Q14168.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000518766 ; ENSP00000428182 ; ENSG00000108852 .
ENST00000520305 ; ENSP00000428136 ; ENSG00000108852 . [Q14168-5 ]
GeneIDi 4355.
KEGGi hsa:4355.
UCSCi uc002ien.1. human. [Q14168-3 ]
uc002ieo.1. human. [Q14168-2 ]
uc010wim.1. human.
uc010win.1. human. [Q14168-1 ]

Organism-specific databases

CTDi 4355.
GeneCardsi GC17M041952.
H-InvDB HIX0013870.
HGNCi HGNC:7220. MPP2.
HPAi HPA026486.
MIMi 600723. gene.
neXtProti NX_Q14168.
PharmGKBi PA30925.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0194.
GeneTreei ENSGT00760000118866.
HOGENOMi HOG000233034.
HOVERGENi HBG001858.
InParanoidi Q14168.
OrthoDBi EOG79CXZ5.
PhylomeDBi Q14168.
TreeFami TF314263.

Miscellaneous databases

EvolutionaryTracei Q14168.
GeneWikii MPP2.
GenomeRNAii 4355.
NextBioi 17134.
PROi Q14168.
SOURCEi Search...

Gene expression databases

Bgeei Q14168.
CleanExi HS_DLG2.
HS_MPP2.
ExpressionAtlasi Q14168. baseline and differential.
Genevestigatori Q14168.

Family and domain databases

Gene3Di 2.30.42.10. 1 hit.
3.40.50.300. 2 hits.
InterProi IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR004172. L27.
IPR014775. L27_C.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF00625. Guanylate_kin. 1 hit.
PF02828. L27. 2 hits.
PF00595. PDZ. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view ]
SMARTi SM00072. GuKc. 1 hit.
SM00569. L27. 2 hits.
SM00228. PDZ. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 2 hits.
PS50106. PDZ. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A gene (DLG2) located at 17q12-q21 encodes a new homologue of the Drosophila tumor suppressor dlg-A."
    Mazoyer S., Gayther S.A., Nagai M.A., Smith S.A., Dunning A., van Rensburg E.J., Albertsen H., White R., Ponder B.A.J.
    Genomics 28:25-31(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Amygdala.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6).
    Tissue: Amygdala and Hippocampus.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Salivary gland.
  5. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  6. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-141, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Solution structure of the PDZ domain from human maguk p55 subfamily member 2."
    RIKEN structural genomics initiative (RSGI)
    Submitted (JAN-2008) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 163-240.

Entry informationi

Entry nameiMPP2_HUMAN
AccessioniPrimary (citable) accession number: Q14168
Secondary accession number(s): B4DGE9
, B4DRJ0, B7Z3G8, E7EV80, E7EV91, E7EX01, Q53ES9, Q5CZB9, Q9BQJ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 2, 2010
Last modified: October 29, 2014
This is version 137 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3