Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAGUK p55 subfamily member 2

Gene

MPP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • guanylate kinase activity Source: ProtInc

GO - Biological processi

  • signal transduction Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000108852-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
MAGUK p55 subfamily member 2
Alternative name(s):
Discs large homolog 2
Protein MPP2
Gene namesi
Name:MPP2
Synonyms:DLG2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:7220. MPP2.

Subcellular locationi

GO - Cellular componenti

  • integral component of plasma membrane Source: ProtInc
  • membrane Source: ProtInc
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi4355.
OpenTargetsiENSG00000108852.
PharmGKBiPA30925.

Polymorphism and mutation databases

DMDMi290457681.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945731 – 576MAGUK p55 subfamily member 2Add BLAST576

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei141PhosphothreonineCombined sources1
Modified residuei145PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ14168.
MaxQBiQ14168.
PaxDbiQ14168.
PeptideAtlasiQ14168.
PRIDEiQ14168.
TopDownProteomicsiQ14168-2. [Q14168-2]

PTM databases

iPTMnetiQ14168.
PhosphoSitePlusiQ14168.
SwissPalmiQ14168.

Expressioni

Gene expression databases

BgeeiENSG00000108852.
CleanExiHS_DLG2.
HS_MPP2.
ExpressionAtlasiQ14168. baseline and differential.

Organism-specific databases

HPAiHPA026486.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
LIN7AO149103EBI-10181752,EBI-2513988

Protein-protein interaction databases

BioGridi110495. 20 interactors.
IntActiQ14168. 7 interactors.
MINTiMINT-4532844.
STRINGi9606.ENSP00000269095.

Structurei

Secondary structure

1576
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi177 – 191Combined sources15
Beta strandi193 – 195Combined sources3
Helixi196 – 200Combined sources5
Beta strandi208 – 212Combined sources5
Helixi221 – 229Combined sources9
Beta strandi233 – 235Combined sources3
Beta strandi237 – 240Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E7KNMR-A163-240[»]
ProteinModelPortaliQ14168.
SMRiQ14168.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ14168.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini8 – 60L27 1PROSITE-ProRule annotationAdd BLAST53
Domaini84 – 142L27 2PROSITE-ProRule annotationAdd BLAST59
Domaini185 – 240PDZPROSITE-ProRule annotationAdd BLAST56
Domaini249 – 317SH3PROSITE-ProRule annotationAdd BLAST69
Domaini374 – 561Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST188

Sequence similaritiesi

Belongs to the MAGUK family.Curated
Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 2 L27 domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0609. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000233034.
HOVERGENiHBG001858.
InParanoidiQ14168.
PhylomeDBiQ14168.
TreeFamiTF314263.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR014775. L27_C.
IPR004172. L27_dom.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF02828. L27. 2 hits.
PF00595. PDZ. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
SMARTiSM00072. GuKc. 1 hit.
SM00569. L27. 2 hits.
SM00228. PDZ. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF101288. SSF101288. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 2 hits.
PS50106. PDZ. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14168-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVAATNSET AMQQVLDNLG SLPSATGAAE LDLIFLRGIM ESPIVRSLAK
60 70 80 90 100
VIMVLWFMQQ NVFVPMKYML KYFGAHERLE ETKLEAVRDN NLELVQEILR
110 120 130 140 150
DLAHVAEQSS TAAELAHILQ EPHFQSLLET HDSVASKTYE TPPPSPGLDP
160 170 180 190 200
TFSNQPVPPD AVRMVGIRKT AGEHLGVTFR VEGGELVIAR ILHGGMVAQQ
210 220 230 240 250
GLLHVGDIIK EVNGQPVGSD PRALQELLRN ASGSVILKIL PSYQEPHLPR
260 270 280 290 300
QVFVKCHFDY DPARDSLIPC KEAGLRFNAG DLLQIVNQDD ANWWQACHVE
310 320 330 340 350
GGSAGLIPSQ LLEEKRKAFV KRDLELTPNS GTLCGSLSGK KKKRMMYLTT
360 370 380 390 400
KNAEFDRHEL LIYEEVARMP PFRRKTLVLI GAQGVGRRSL KNKLIMWDPD
410 420 430 440 450
RYGTTVPYTS RRPKDSEREG QGYSFVSRGE MEADVRAGRY LEHGEYEGNL
460 470 480 490 500
YGTRIDSIRG VVAAGKVCVL DVNPQAVKVL RTAEFVPYVV FIEAPDFETL
510 520 530 540 550
RAMNRAALES GISTKQLTEA DLRRTVEESS RIQRGYGHYF DLCLVNSNLE
560 570
RTFRELQTAM EKLRTEPQWV PVSWVY
Length:576
Mass (Da):64,581
Last modified:March 2, 2010 - v3
Checksum:iA08E858EA646A305
GO
Isoform 2 (identifier: Q14168-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-74: Missing.

Show »
Length:552
Mass (Da):61,585
Checksum:i81BBB336B3C9DA89
GO
Isoform 3 (identifier: Q14168-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MPVAATNSET → MAGSPGSGVSLEGISLESSEEAELQRE
     51-74: Missing.

Show »
Length:569
Mass (Da):63,315
Checksum:i40FE59BE6B6D998C
GO
Isoform 4 (identifier: Q14168-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSWAPPPQVGQNLRSQTVLRILNGMEDLMWVAMEERRFRALASFTM
     51-74: Missing.

Show »
Length:597
Mass (Da):66,802
Checksum:i2D04EAC57B8C7934
GO
Isoform 5 (identifier: Q14168-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-163: Missing.

Show »
Length:413
Mass (Da):46,518
Checksum:i6F9ADB21579E5A2F
GO
Isoform 6 (identifier: Q14168-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: Missing.
     51-74: Missing.

Show »
Length:541
Mass (Da):60,512
Checksum:i83D4E1782E4D3C99
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti80E → G in CAI56746 (PubMed:17974005).Curated1
Sequence conflicti104 – 105HV → QL in CAA58067 (PubMed:7590743).Curated2
Sequence conflicti104 – 105HV → QL in BAD97280 (PubMed:11230166).Curated2
Sequence conflicti104 – 105HV → QL in CAB66489 (Ref. 5) Curated2
Sequence conflicti104 – 105HV → QL in CAI56746 (PubMed:17974005).Curated2
Sequence conflicti104 – 105HV → QL in AAH30287 (PubMed:15489334).Curated2
Sequence conflicti104 – 105HV → QL in BAG61302 (PubMed:14702039).Curated2
Sequence conflicti104 – 105HV → QL in BAH12204 (PubMed:14702039).Curated2
Sequence conflicti242S → N in CAA58067 (PubMed:7590743).Curated1
Sequence conflicti531R → C in BAG57760 (PubMed:14702039).Curated1
Sequence conflicti554R → C in BAG61302 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0551361 – 163Missing in isoform 5. 1 PublicationAdd BLAST163
Alternative sequenceiVSP_0551371 – 11Missing in isoform 6. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0229511 – 10MPVAATNSET → MAGSPGSGVSLEGISLESSE EAELQRE in isoform 3. 1 Publication10
Alternative sequenceiVSP_0551381M → MSWAPPPQVGQNLRSQTVLR ILNGMEDLMWVAMEERRFRA LASFTM in isoform 4. 1 Publication1
Alternative sequenceiVSP_00315651 – 74Missing in isoform 2, isoform 3, isoform 4 and isoform 6. 5 PublicationsAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X82895 mRNA. Translation: CAA58067.1.
AL136554 mRNA. Translation: CAB66489.1.
AK294564 mRNA. Translation: BAG57760.1.
AK295858 mRNA. Translation: BAH12204.1.
AK299286 mRNA. Translation: BAG61302.1.
CR936598 mRNA. Translation: CAI56746.1.
AK223560 mRNA. Translation: BAD97280.1.
AC007993 Genomic DNA. No translation available.
BC030287 mRNA. Translation: AAH30287.1.
CCDSiCCDS11471.1. [Q14168-2]
CCDS62206.1. [Q14168-5]
CCDS62207.1. [Q14168-6]
CCDS62208.1. [Q14168-3]
CCDS62209.1. [Q14168-1]
CCDS62210.1. [Q14168-4]
PIRiA57653.
RefSeqiNP_001265299.1. NM_001278370.1.
NP_001265300.1. NM_001278371.1.
NP_001265301.1. NM_001278372.1.
NP_001265302.1. NM_001278373.1.
NP_001265303.1. NM_001278374.1. [Q14168-5]
NP_001265304.1. NM_001278375.1.
NP_001265305.2. NM_001278376.2.
NP_001265310.1. NM_001278381.1.
NP_005365.4. NM_005374.4.
UniGeneiHs.514208.

Genome annotation databases

EnsembliENST00000520305; ENSP00000428136; ENSG00000108852. [Q14168-5]
GeneIDi4355.
KEGGihsa:4355.
UCSCiuc010win.3. human. [Q14168-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X82895 mRNA. Translation: CAA58067.1.
AL136554 mRNA. Translation: CAB66489.1.
AK294564 mRNA. Translation: BAG57760.1.
AK295858 mRNA. Translation: BAH12204.1.
AK299286 mRNA. Translation: BAG61302.1.
CR936598 mRNA. Translation: CAI56746.1.
AK223560 mRNA. Translation: BAD97280.1.
AC007993 Genomic DNA. No translation available.
BC030287 mRNA. Translation: AAH30287.1.
CCDSiCCDS11471.1. [Q14168-2]
CCDS62206.1. [Q14168-5]
CCDS62207.1. [Q14168-6]
CCDS62208.1. [Q14168-3]
CCDS62209.1. [Q14168-1]
CCDS62210.1. [Q14168-4]
PIRiA57653.
RefSeqiNP_001265299.1. NM_001278370.1.
NP_001265300.1. NM_001278371.1.
NP_001265301.1. NM_001278372.1.
NP_001265302.1. NM_001278373.1.
NP_001265303.1. NM_001278374.1. [Q14168-5]
NP_001265304.1. NM_001278375.1.
NP_001265305.2. NM_001278376.2.
NP_001265310.1. NM_001278381.1.
NP_005365.4. NM_005374.4.
UniGeneiHs.514208.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E7KNMR-A163-240[»]
ProteinModelPortaliQ14168.
SMRiQ14168.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110495. 20 interactors.
IntActiQ14168. 7 interactors.
MINTiMINT-4532844.
STRINGi9606.ENSP00000269095.

PTM databases

iPTMnetiQ14168.
PhosphoSitePlusiQ14168.
SwissPalmiQ14168.

Polymorphism and mutation databases

DMDMi290457681.

Proteomic databases

EPDiQ14168.
MaxQBiQ14168.
PaxDbiQ14168.
PeptideAtlasiQ14168.
PRIDEiQ14168.
TopDownProteomicsiQ14168-2. [Q14168-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000520305; ENSP00000428136; ENSG00000108852. [Q14168-5]
GeneIDi4355.
KEGGihsa:4355.
UCSCiuc010win.3. human. [Q14168-1]

Organism-specific databases

CTDi4355.
DisGeNETi4355.
GeneCardsiMPP2.
H-InvDBHIX0013870.
HGNCiHGNC:7220. MPP2.
HPAiHPA026486.
MIMi600723. gene.
neXtProtiNX_Q14168.
OpenTargetsiENSG00000108852.
PharmGKBiPA30925.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0609. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000233034.
HOVERGENiHBG001858.
InParanoidiQ14168.
PhylomeDBiQ14168.
TreeFamiTF314263.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000108852-MONOMER.

Miscellaneous databases

EvolutionaryTraceiQ14168.
GeneWikiiMPP2.
GenomeRNAii4355.
PROiQ14168.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000108852.
CleanExiHS_DLG2.
HS_MPP2.
ExpressionAtlasiQ14168. baseline and differential.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR014775. L27_C.
IPR004172. L27_dom.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF02828. L27. 2 hits.
PF00595. PDZ. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
SMARTiSM00072. GuKc. 1 hit.
SM00569. L27. 2 hits.
SM00228. PDZ. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF101288. SSF101288. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS51022. L27. 2 hits.
PS50106. PDZ. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMPP2_HUMAN
AccessioniPrimary (citable) accession number: Q14168
Secondary accession number(s): B4DGE9
, B4DRJ0, B7Z3G8, E7EV80, E7EV91, E7EX01, Q53ES9, Q5CZB9, Q9BQJ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: March 2, 2010
Last modified: November 2, 2016
This is version 157 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.