Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA repair-scaffolding protein

Gene

SPIDR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in DNA double-strand break (DBS) repair via homologous recombination (HR). Serves as a scaffolding protein that helps to promote the recruitment of DNA-processing enzymes like the helicase BLM and recombinase RAD51 to site of DNA damage, and hence contributes to maintain genomic integrity.2 Publications

GO - Biological processi

  • cellular response to camptothecin Source: UniProtKB
  • cellular response to DNA damage stimulus Source: UniProtKB
  • cellular response to hydroxyurea Source: UniProtKB
  • cellular response to ionizing radiation Source: UniProtKB
  • double-strand break repair via homologous recombination Source: UniProtKB
  • positive regulation of double-strand break repair Source: UniProtKB
  • positive regulation of protein complex assembly Source: UniProtKB
  • regulation of double-strand break repair via homologous recombination Source: UniProtKB
  • regulation of establishment of protein localization to chromosome Source: UniProtKB

Keywordsi

Biological processDNA damage, DNA recombination, DNA repair

Enzyme and pathway databases

ReactomeiR-HSA-5693568. Resolution of D-loop Structures through Holliday Junction Intermediates.

Names & Taxonomyi

Protein namesi
Recommended name:
DNA repair-scaffolding protein
Alternative name(s):
Scaffolding protein involved in DNA repair
Gene namesi
Name:SPIDR
Synonyms:KIAA0146
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000164808.16.
HGNCiHGNC:28971. SPIDR.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi23514.
OpenTargetsiENSG00000164808.
PharmGKBiPA142671636.

Polymorphism and mutation databases

DMDMi115502235.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002517201 – 915DNA repair-scaffolding proteinAdd BLAST915

Proteomic databases

EPDiQ14159.
MaxQBiQ14159.
PaxDbiQ14159.
PeptideAtlasiQ14159.
PRIDEiQ14159.

PTM databases

iPTMnetiQ14159.
PhosphoSitePlusiQ14159.

Expressioni

Inductioni

Up-regulated in vascular endothelial cells treated with IL4. Up-regulated upon human SARS coronavirus infection.2 Publications

Gene expression databases

BgeeiENSG00000164808.
CleanExiHS_KIAA0146.
ExpressionAtlasiQ14159. baseline and differential.
GenevisibleiQ14159. HS.

Organism-specific databases

HPAiHPA027201.
HPA041582.

Interactioni

Subunit structurei

Found in a complex, at least composed of BLM, RAD51 and SPIDR; the complex formation is mediated by SPIDR. Interacts (via C-terminal region) with BLM; the interaction is direct. Interacts with RAD51; the interaction is direct. Interacts (via the C-terminal region) with FIGNL1 (via N-terminal one-half region); the interaction is direct.2 Publications

Protein-protein interaction databases

BioGridi117061. 2 interactors.
IntActiQ14159. 1 interactor.
STRINGi9606.ENSP00000297423.

Structurei

3D structure databases

ProteinModelPortaliQ14159.
SMRiQ14159.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni151 – 450Necessary for interaction with RAD511 PublicationAdd BLAST300

Phylogenomic databases

eggNOGiENOG410IGEG. Eukaryota.
ENOG410Y7PZ. LUCA.
GeneTreeiENSGT00390000014654.
HOGENOMiHOG000070204.
HOVERGENiHBG080769.
InParanoidiQ14159.
OMAiCAMQVAM.
OrthoDBiEOG091G0LNL.
PhylomeDBiQ14159.
TreeFamiTF333292.

Family and domain databases

InterProiView protein in InterPro
IPR028026. DUF4502.
IPR028032. DUF4503.
PfamiView protein in Pfam
PF14950. DUF4502. 1 hit.
PF14951. DUF4503. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14159-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPRGSRARGS KRKRSWNTEC PSFPGERPLQ VRRAGLRTAG AAASLSEAWL
60 70 80 90 100
RCGEGFQNTS GNPSLTAEEK TITEKHLELC PRPKQETTTS KSTSGLTDIT
110 120 130 140 150
WSSSGSDLSD EDKTLSQLQR DELQFIDWEI DSDRAEASDC DEFEDDEGAV
160 170 180 190 200
EISDCASCAS NQSLTSDEKL SELPKPSSIE ILEYSSDSEK EDDLENVLLI
210 220 230 240 250
DSESPHKYHV QFASDARQIM ERLIDPRTKS TETILHTPQK PTAKFPRTPE
260 270 280 290 300
NSAKKKLLRG GLAERLNGLQ NRERSAISLW RHQCISYQKT LSGRKSGVLT
310 320 330 340 350
VKILELHEEC AMQVAMCEQL LGSPATSSSQ SVAPRPGAGL KVLFTKETAG
360 370 380 390 400
YLRGRPQDTV RIFPPWQKLI IPSGSCPVIL NTYFCEKVVA KEDSEKTCEV
410 420 430 440 450
YCPDIPLPRR SISLAQMFVI KGLTNNSPEI QVVCSGVATT GTAWTHGHKE
460 470 480 490 500
AKQRIPTSTP LRDSLLDVVE SQGAASWPGA GVRVVVQRVY SLPSRDSTRG
510 520 530 540 550
QQGASSGHTD PAGTRACLLV QDACGMFGEV HLEFTMSKAR QLEGKSCSLV
560 570 580 590 600
GMKVLQKVTR GRTAGIFSLI DTLWPPAIPL KTPGRDQPCE EIKTHLPPPA
610 620 630 640 650
LCYILTAHPN LGQIDIIDED PIYKLYQPPV TRCLRDILQM NDLGTRCSFY
660 670 680 690 700
ATVIYQKPQL KSLLLLEQRE IWLLVTDVTL QTKEERDPRL PKTLLVYVAP
710 720 730 740 750
LCVLGSEVLE ALAGAAPHSL FFKDALRDQG RIVCAERTVL LLQKPLLSVV
760 770 780 790 800
SGASSCELPG PVMLDSLDSA TPVNSICSVQ GTVVGVDEST AFSWPVCDMC
810 820 830 840 850
GNGRLEQRPE DRGAFSCGDC SRVVTSPVLK RHLQVFLDCR SRPQCRVKVK
860 870 880 890 900
LLQRSISSLL RFAAGEDGSY EVKSVLGKEV GLLNCFVQSV TAHPTSCIGL
910
EEIELLSAGG ASAEH
Length:915
Mass (Da):100,316
Last modified:October 3, 2006 - v2
Checksum:iDA35068B5849135D
GO
Isoform 2 (identifier: Q14159-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: MPRGSRARGS...HLELCPRPKQ → MAQVWRRVSEHFWES

Note: No experimental confirmation available.
Show »
Length:845
Mass (Da):92,871
Checksum:i828B4F1FE824611E
GO
Isoform 3 (identifier: Q14159-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MPRGSRARGSKRKRSWNTECPSFPGERPLQVRRAGLRTAGAAASLSEAWLRCGEGFQNTSGNP → MAQ
     851-915: LLQRSISSLL...LSAGGASAEH → VGARPEHART...MWLQGWWWWW

Note: No experimental confirmation available.
Show »
Length:876
Mass (Da):96,870
Checksum:iD14E3FB7C3628469
GO

Sequence cautioni

The sequence BAA09767 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0566521 – 85MPRGS…PRPKQ → MAQVWRRVSEHFWES in isoform 2. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_0566531 – 63MPRGS…TSGNP → MAQ in isoform 3. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_056654851 – 915LLQRS…ASAEH → VGARPEHARTPSSLQHSEEL RSEECPRKGSGVVKLFCPVR NRPPDQLHWIGGNRASECRR GLCRTLAVAAGSVNFAMWLQ GWWWWW in isoform 3. 1 PublicationAdd BLAST65

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D63480 mRNA. Translation: BAA09767.1. Different initiation.
AK294275 mRNA. Translation: BAG57563.1.
AK303579 mRNA. Translation: BAG64598.1.
AC023991 Genomic DNA. No translation available.
AC024451 Genomic DNA. No translation available.
AC024649 Genomic DNA. No translation available.
AC104995 Genomic DNA. No translation available.
AC142471 Genomic DNA. No translation available.
AC233269 Genomic DNA. No translation available.
BC015561 mRNA. Translation: AAH15561.2.
CCDSiCCDS43737.1. [Q14159-1]
CCDS64890.1. [Q14159-3]
CCDS64891.1. [Q14159-2]
RefSeqiNP_001073863.1. NM_001080394.3. [Q14159-1]
NP_001269845.1. NM_001282916.1. [Q14159-2]
NP_001269848.1. NM_001282919.1. [Q14159-3]
XP_016868760.1. XM_017013271.1. [Q14159-3]
UniGeneiHs.381058.

Genome annotation databases

EnsembliENST00000297423; ENSP00000297423; ENSG00000164808. [Q14159-1]
ENST00000518074; ENSP00000429487; ENSG00000164808. [Q14159-3]
ENST00000541342; ENSP00000444061; ENSG00000164808. [Q14159-2]
GeneIDi23514.
KEGGihsa:23514.
UCSCiuc003xqd.5. human. [Q14159-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSPIDR_HUMAN
AccessioniPrimary (citable) accession number: Q14159
Secondary accession number(s): B4DFV2, B4E0Y6, Q96BI5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: October 3, 2006
Last modified: September 27, 2017
This is version 111 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot