Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nidogen-2

Gene

NID2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cell adhesion glycoprotein which is widely distributed in basement membranes. Binds to collagens I and IV, to perlecan and to laminin 1. Does not bind fibulins. It probably has a role in cell-extracellular matrix interactions.

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • collagen binding Source: ProtInc

GO - Biological processi

  • basement membrane organization Source: BHF-UCL
  • cell adhesion Source: ProtInc
  • cell-matrix adhesion Source: Ensembl
  • extracellular matrix organization Source: Reactome

Keywordsi

Biological processCell adhesion
LigandCalcium

Enzyme and pathway databases

ReactomeiR-HSA-3000157 Laminin interactions

Names & Taxonomyi

Protein namesi
Recommended name:
Nidogen-2
Short name:
NID-2
Alternative name(s):
Osteonidogen
Gene namesi
Name:NID2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000087303.16
HGNCiHGNC:13389 NID2
MIMi605399 gene
neXtProtiNX_Q14112

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Basement membrane, Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi22795
OpenTargetsiENSG00000087303
PharmGKBiPA31626

Polymorphism and mutation databases

BioMutaiNID2
DMDMi290457669

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 301 PublicationAdd BLAST30
ChainiPRO_000000767131 – 1375Nidogen-2Add BLAST1345

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi417N-linked (GlcNAc...) asparagineCurated1
Glycosylationi658N-linked (GlcNAc...) asparagineCurated1
Glycosylationi693N-linked (GlcNAc...) asparagineCurated1
Glycosylationi703N-linked (GlcNAc...) asparagineCurated1
Disulfide bondi763 ↔ 776By similarity
Disulfide bondi770 ↔ 786By similarity
Disulfide bondi788 ↔ 799By similarity
Disulfide bondi805 ↔ 818By similarity
Disulfide bondi812 ↔ 827By similarity
Disulfide bondi829 ↔ 842By similarity
Disulfide bondi852 ↔ 867By similarity
Disulfide bondi859 ↔ 877By similarity
Disulfide bondi879 ↔ 890By similarity
Disulfide bondi896 ↔ 907By similarity
Disulfide bondi901 ↔ 916By similarity
Disulfide bondi918 ↔ 929By similarity
Disulfide bondi940 ↔ 963By similarity
Disulfide bondi974 ↔ 981By similarity
Disulfide bondi983 ↔ 1005By similarity
Disulfide bondi1019 ↔ 1043By similarity
Disulfide bondi1054 ↔ 1061By similarity
Disulfide bondi1063 ↔ 1084By similarity
Glycosylationi1124N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei1308Omega-N-methylarginineBy similarity1

Post-translational modificationi

Highly N- and O-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Methylation

Proteomic databases

MaxQBiQ14112
PaxDbiQ14112
PeptideAtlasiQ14112
PRIDEiQ14112

PTM databases

iPTMnetiQ14112
PhosphoSitePlusiQ14112

Expressioni

Tissue specificityi

Heart, placenta and bone. Less in pancreas, kidney and skeletal muscle.

Gene expression databases

BgeeiENSG00000087303
CleanExiHS_NID2
ExpressionAtlasiQ14112 baseline and differential
GenevisibleiQ14112 HS

Organism-specific databases

HPAiHPA052460
HPA058772

Interactioni

Subunit structurei

Interacts with LAMA2 (By similarity). Interacts with COL13A1.By similarity1 Publication

Protein-protein interaction databases

BioGridi116476, 38 interactors
IntActiQ14112, 2 interactors
MINTiQ14112
STRINGi9606.ENSP00000216286

Structurei

3D structure databases

ProteinModelPortaliQ14112
SMRiQ14112
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini108 – 273NIDOPROSITE-ProRule annotationAdd BLAST166
Domaini484 – 524EGF-like 1PROSITE-ProRule annotationAdd BLAST41
Domaini528 – 758Nidogen G2 beta-barrelPROSITE-ProRule annotationAdd BLAST231
Domaini759 – 800EGF-like 2PROSITE-ProRule annotationAdd BLAST42
Domaini801 – 843EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST43
Domaini848 – 891EGF-like 4PROSITE-ProRule annotationAdd BLAST44
Domaini892 – 930EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST39
Domaini937 – 1005Thyroglobulin type-1 1PROSITE-ProRule annotationAdd BLAST69
Domaini1016 – 1084Thyroglobulin type-1 2PROSITE-ProRule annotationAdd BLAST69
Repeati1154 – 1197LDL-receptor class B 1Add BLAST44
Repeati1198 – 1240LDL-receptor class B 2Add BLAST43
Repeati1241 – 1285LDL-receptor class B 3Add BLAST45
Repeati1286 – 1327LDL-receptor class B 4Add BLAST42
Repeati1329 – 1373LDL-receptor class B 5Add BLAST45

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IMYX Eukaryota
ENOG4111DVZ LUCA
GeneTreeiENSGT00910000144086
HOGENOMiHOG000072712
HOVERGENiHBG006498
InParanoidiQ14112
KOiK06826
OMAiHAFCTDY
OrthoDBiEOG091G030P
PhylomeDBiQ14112
TreeFamiTF320666

Family and domain databases

CDDicd00255 nidG2, 1 hit
cd00191 TY, 2 hits
Gene3Di2.120.10.30, 1 hit
4.10.800.10, 2 hits
InterProiView protein in InterPro
IPR011042 6-blade_b-propeller_TolB-like
IPR026823 cEGF
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR024731 EGF_dom
IPR006605 G2_nidogen/fibulin_G2F
IPR009017 GFP
IPR009030 Growth_fac_rcpt_cys_sf
IPR000033 LDLR_classB_rpt
IPR003886 NIDO_dom
IPR000716 Thyroglobulin_1
IPR036857 Thyroglobulin_1_sf
PfamiView protein in Pfam
PF12662 cEGF, 1 hit
PF12947 EGF_3, 1 hit
PF07645 EGF_CA, 1 hit
PF07474 G2F, 1 hit
PF00058 Ldl_recept_b, 2 hits
PF06119 NIDO, 1 hit
PF00086 Thyroglobulin_1, 2 hits
SMARTiView protein in SMART
SM00181 EGF, 5 hits
SM00179 EGF_CA, 4 hits
SM00682 G2F, 1 hit
SM00135 LY, 5 hits
SM00539 NIDO, 1 hit
SM00211 TY, 2 hits
SUPFAMiSSF54511 SSF54511, 1 hit
SSF57184 SSF57184, 2 hits
SSF57610 SSF57610, 2 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 3 hits
PS01186 EGF_2, 4 hits
PS50026 EGF_3, 4 hits
PS01187 EGF_CA, 2 hits
PS51120 LDLRB, 4 hits
PS51220 NIDO, 1 hit
PS50993 NIDOGEN_G2, 1 hit
PS00484 THYROGLOBULIN_1_1, 2 hits
PS51162 THYROGLOBULIN_1_2, 2 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14112-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGDRVAGRP VLSSLPVLLL LPLLMLRAAA LHPDELFPHG ESWGDQLLQE
60 70 80 90 100
GDDESSAVVK LANPLHFYEA RFSNLYVGTN GIISTQDFPR ETQYVDYDFP
110 120 130 140 150
TDFPAIAPFL ADIDTSHGRG RVLYREDTSP AVLGLAARYV RAGFPRSARF
160 170 180 190 200
TPTHAFLATW EQVGAYEEVK RGALPSGELN TFQAVLASDG SDSYALFLYP
210 220 230 240 250
ANGLQFLGTR PKESYNVQLQ LPARVGFCRG EADDLKSEGP YFSLTSTEQS
260 270 280 290 300
VKNLYQLSNL GIPGVWAFHI GSTSPLDNVR PAAVGDLSAA HSSVPLGRSF
310 320 330 340 350
SHATALESDY NEDNLDYYDV NEEEAEYLPG EPEEALNGHS SIDVSFQSKV
360 370 380 390 400
DTKPLEESST LDPHTKEGTS LGEVGGPDLK GQVEPWDERE TRSPAPPEVD
410 420 430 440 450
RDSLAPSWET PPPYPENGSI QPYPDGGPVP SEMDVPPAHP EEEIVLRSYP
460 470 480 490 500
ASGHTTPLSR GTYEVGLEDN IGSNTEVFTY NAANKETCEH NHRQCSRHAF
510 520 530 540 550
CTDYATGFCC HCQSKFYGNG KHCLPEGAPH RVNGKVSGHL HVGHTPVHFT
560 570 580 590 600
DVDLHAYIVG NDGRAYTAIS HIPQPAAQAL LPLTPIGGLF GWLFALEKPG
610 620 630 640 650
SENGFSLAGA AFTHDMEVTF YPGEETVRIT QTAEGLDPEN YLSIKTNIQG
660 670 680 690 700
QVPYVSANFT AHISPYKELY HYSDSTVTST SSRDYSLTFG AINQTWSYRI
710 720 730 740 750
HQNITYQVCR HAPRHPSFPT TQQLNVDRVF ALYNDEERVL RFAVTNQIGP
760 770 780 790 800
VKEDSDPTPG NPCYDGSHMC DTTARCHPGT GVDYTCECAS GYQGDGRNCV
810 820 830 840 850
DENECATGFH RCGPNSVCIN LPGSYRCECR SGYEFADDRH TCILITPPAN
860 870 880 890 900
PCEDGSHTCA PAGQARCVHH GGSTFSCACL PGYAGDGHQC TDVDECSENR
910 920 930 940 950
CHPAATCYNT PGSFSCRCQP GYYGDGFQCI PDSTSSLTPC EQQQRHAQAQ
960 970 980 990 1000
YAYPGARFHI PQCDEQGNFL PLQCHGSTGF CWCVDPDGHE VPGTQTPPGS
1010 1020 1030 1040 1050
TPPHCGPSPE PTQRPPTICE RWRENLLEHY GGTPRDDQYV PQCDDLGHFI
1060 1070 1080 1090 1100
PLQCHGKSDF CWCVDKDGRE VQGTRSQPGT TPACIPTVAP PMVRPTPRPD
1110 1120 1130 1140 1150
VTPPSVGTFL LYTQGQQIGY LPLNGTRLQK DAAKTLLSLH GSIIVGIDYD
1160 1170 1180 1190 1200
CRERMVYWTD VAGRTISRAG LELGAEPETI VNSGLISPEG LAIDHIRRTM
1210 1220 1230 1240 1250
YWTDSVLDKI ESALLDGSER KVLFYTDLVN PRAIAVDPIR GNLYWTDWNR
1260 1270 1280 1290 1300
EAPKIETSSL DGENRRILIN TDIGLPNGLT FDPFSKLLCW ADAGTKKLEC
1310 1320 1330 1340 1350
TLPDGTGRRV IQNNLKYPFS IVSYADHFYH TDWRRDGVVS VNKHSGQFTD
1360 1370
EYLPEQRSHL YGITAVYPYC PTGRK
Length:1,375
Mass (Da):151,254
Last modified:March 2, 2010 - v3
Checksum:i198D1F4E286A53E2
GO
Isoform 2 (identifier: Q14112-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-59: Missing.
     844-892: LITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTD → Y

Note: No experimental confirmation available.
Show »
Length:1,274
Mass (Da):140,866
Checksum:iC6E3D787DB40235B
GO

Sequence cautioni

The sequence BAA13087 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172.Curated
The sequence BAA24112 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti44G → W in BAA13087 (Ref. 2) Curated1
Sequence conflicti44G → W in BAA24112 (Ref. 3) Curated1
Sequence conflicti700I → T in BAG62181 (PubMed:14702039).Curated1
Sequence conflicti1242N → D in BAF84341 (PubMed:14702039).Curated1
Sequence conflicti1245W → R in BAF84341 (PubMed:14702039).Curated1
Sequence conflicti1249N → D in BAF84341 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06285022P → Q4 PublicationsCorresponds to variant dbSNP:rs3920038Ensembl.1
Natural variantiVAR_055767313D → G. Corresponds to variant dbSNP:rs17124969Ensembl.1
Natural variantiVAR_055768354P → H. Corresponds to variant dbSNP:rs35657569Ensembl.1
Natural variantiVAR_062851453G → D1 PublicationCorresponds to variant dbSNP:rs2101919Ensembl.1
Natural variantiVAR_055769529P → S. Corresponds to variant dbSNP:rs17831525Ensembl.1
Natural variantiVAR_062852656S → P4 PublicationsCorresponds to variant dbSNP:rs3742536Ensembl.1
Natural variantiVAR_055770726V → M. Corresponds to variant dbSNP:rs35147930Ensembl.1
Natural variantiVAR_062853760G → VCombined sources4 PublicationsCorresponds to variant dbSNP:rs2273430Ensembl.1
Natural variantiVAR_055771775R → Q. Corresponds to variant dbSNP:rs10134590Ensembl.1
Natural variantiVAR_055772830R → Q. Corresponds to variant dbSNP:rs7144523Ensembl.1
Natural variantiVAR_055773866R → Q. Corresponds to variant dbSNP:rs28507587Ensembl.1
Natural variantiVAR_0358361238P → S in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0387797 – 59Missing in isoform 2. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_038780844 – 892LITPP…HQCTD → Y in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223500 mRNA Translation: CAA11418.1
D86425 mRNA Translation: BAA13087.1 Frameshift.
AB009799 Genomic DNA Translation: BAA24112.1 Frameshift.
AK300462 mRNA Translation: BAG62181.1
AK291652 mRNA Translation: BAF84341.1
CCDSiCCDS9706.1 [Q14112-1]
PIRiG00043
RefSeqiNP_031387.3, NM_007361.3 [Q14112-1]
UniGeneiHs.369840

Genome annotation databases

EnsembliENST00000216286; ENSP00000216286; ENSG00000087303 [Q14112-1]
GeneIDi22795
KEGGihsa:22795
UCSCiuc001wzo.4 human [Q14112-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNID2_HUMAN
AccessioniPrimary (citable) accession number: Q14112
Secondary accession number(s): A8K6I7, B4DU19, O43710
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: March 2, 2010
Last modified: May 23, 2018
This is version 179 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health