Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nidogen-2

Gene

NID2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cell adhesion glycoprotein which is widely distributed in basement membranes. Binds to collagens I and IV, to perlecan and to laminin 1. Does not bind fibulins. It probably has a role in cell-extracellular matrix interactions.

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • collagen binding Source: ProtInc

GO - Biological processi

  • basement membrane organization Source: BHF-UCL
  • cell adhesion Source: ProtInc
  • cell-matrix adhesion Source: Ensembl
  • extracellular matrix organization Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_169262. Laminin interactions.

Protein family/group databases

MEROPSiI63.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Nidogen-2
Short name:
NID-2
Alternative name(s):
Osteonidogen
Gene namesi
Name:NID2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:13389. NID2.

Subcellular locationi

GO - Cellular componenti

  • basement membrane Source: BHF-UCL
  • extracellular exosome Source: UniProtKB
  • extracellular matrix Source: UniProtKB
  • extracellular region Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Basement membrane, Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31626.

Polymorphism and mutation databases

BioMutaiNID2.
DMDMi290457669.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 30301 PublicationAdd
BLAST
Chaini31 – 13751345Nidogen-2PRO_0000007671Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi417 – 4171N-linked (GlcNAc...)Curated
Glycosylationi658 – 6581N-linked (GlcNAc...)Curated
Glycosylationi693 – 6931N-linked (GlcNAc...)Curated
Glycosylationi703 – 7031N-linked (GlcNAc...)Curated
Disulfide bondi763 ↔ 776By similarity
Disulfide bondi770 ↔ 786By similarity
Disulfide bondi788 ↔ 799By similarity
Disulfide bondi805 ↔ 818By similarity
Disulfide bondi812 ↔ 827By similarity
Disulfide bondi829 ↔ 842By similarity
Disulfide bondi852 ↔ 867By similarity
Disulfide bondi859 ↔ 877By similarity
Disulfide bondi879 ↔ 890By similarity
Disulfide bondi896 ↔ 907By similarity
Disulfide bondi901 ↔ 916By similarity
Disulfide bondi918 ↔ 929By similarity
Disulfide bondi940 ↔ 963By similarity
Disulfide bondi974 ↔ 981By similarity
Disulfide bondi983 ↔ 1005By similarity
Disulfide bondi1019 ↔ 1043By similarity
Disulfide bondi1054 ↔ 1061By similarity
Disulfide bondi1063 ↔ 1084By similarity
Glycosylationi1124 – 11241N-linked (GlcNAc...)1 Publication

Post-translational modificationi

Highly N- and O-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ14112.
PaxDbiQ14112.
PRIDEiQ14112.

PTM databases

PhosphoSiteiQ14112.

Expressioni

Tissue specificityi

Heart, placenta and bone. Less in pancreas, kidney and skeletal muscle.

Gene expression databases

BgeeiQ14112.
CleanExiHS_NID2.
ExpressionAtlasiQ14112. baseline and differential.
GenevisibleiQ14112. HS.

Organism-specific databases

HPAiHPA052460.

Interactioni

Subunit structurei

Interacts with LAMA2 (By similarity). Interacts with COL13A1.By similarity1 Publication

Protein-protein interaction databases

BioGridi116476. 18 interactions.
IntActiQ14112. 2 interactions.
MINTiMINT-1183597.
STRINGi9606.ENSP00000216286.

Structurei

3D structure databases

ProteinModelPortaliQ14112.
SMRiQ14112. Positions 487-752, 801-996, 1107-1370.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini108 – 273166NIDOPROSITE-ProRule annotationAdd
BLAST
Domaini484 – 52441EGF-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini528 – 758231Nidogen G2 beta-barrelPROSITE-ProRule annotationAdd
BLAST
Domaini759 – 80042EGF-like 2PROSITE-ProRule annotationAdd
BLAST
Domaini801 – 84343EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini848 – 89144EGF-like 4PROSITE-ProRule annotationAdd
BLAST
Domaini892 – 93039EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini937 – 100569Thyroglobulin type-1 1PROSITE-ProRule annotationAdd
BLAST
Domaini1016 – 108469Thyroglobulin type-1 2PROSITE-ProRule annotationAdd
BLAST
Repeati1154 – 119744LDL-receptor class B 1Add
BLAST
Repeati1198 – 124043LDL-receptor class B 2Add
BLAST
Repeati1241 – 128545LDL-receptor class B 3Add
BLAST
Repeati1286 – 132742LDL-receptor class B 4Add
BLAST
Repeati1329 – 137345LDL-receptor class B 5Add
BLAST

Sequence similaritiesi

Contains 5 EGF-like domains.PROSITE-ProRule annotation
Contains 5 LDL-receptor class B repeats.PROSITE-ProRule annotation
Contains 1 NIDO domain.PROSITE-ProRule annotation
Contains 1 nidogen G2 beta-barrel domain.PROSITE-ProRule annotation
Contains 2 thyroglobulin type-1 domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG282695.
GeneTreeiENSGT00760000118968.
HOGENOMiHOG000072712.
HOVERGENiHBG006498.
InParanoidiQ14112.
KOiK06826.
OMAiHIPQCDE.
OrthoDBiEOG7M0NQN.
PhylomeDBiQ14112.
TreeFamiTF320666.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
2.40.155.10. 2 hits.
4.10.800.10. 2 hits.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR024731. EGF_dom_MSP1-like.
IPR006605. G2_nidogen/fibulin_G2F.
IPR009017. GFP.
IPR023413. GFP-like.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000033. LDLR_classB_rpt.
IPR003886. Nidogen_extracell_dom.
IPR000716. Thyroglobulin_1.
[Graphical view]
PfamiPF12662. cEGF. 1 hit.
PF12947. EGF_3. 1 hit.
PF07645. EGF_CA. 1 hit.
PF07474. G2F. 1 hit.
PF00058. Ldl_recept_b. 2 hits.
PF06119. NIDO. 1 hit.
PF00086. Thyroglobulin_1. 2 hits.
[Graphical view]
SMARTiSM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
SM00682. G2F. 1 hit.
SM00135. LY. 5 hits.
SM00539. NIDO. 1 hit.
SM00211. TY. 2 hits.
[Graphical view]
SUPFAMiSSF54511. SSF54511. 1 hit.
SSF57184. SSF57184. 2 hits.
SSF57610. SSF57610. 2 hits.
PROSITEiPS00010. ASX_HYDROXYL. 3 hits.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 2 hits.
PS51120. LDLRB. 4 hits.
PS51220. NIDO. 1 hit.
PS50993. NIDOGEN_G2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 2 hits.
PS51162. THYROGLOBULIN_1_2. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14112-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEGDRVAGRP VLSSLPVLLL LPLLMLRAAA LHPDELFPHG ESWGDQLLQE
60 70 80 90 100
GDDESSAVVK LANPLHFYEA RFSNLYVGTN GIISTQDFPR ETQYVDYDFP
110 120 130 140 150
TDFPAIAPFL ADIDTSHGRG RVLYREDTSP AVLGLAARYV RAGFPRSARF
160 170 180 190 200
TPTHAFLATW EQVGAYEEVK RGALPSGELN TFQAVLASDG SDSYALFLYP
210 220 230 240 250
ANGLQFLGTR PKESYNVQLQ LPARVGFCRG EADDLKSEGP YFSLTSTEQS
260 270 280 290 300
VKNLYQLSNL GIPGVWAFHI GSTSPLDNVR PAAVGDLSAA HSSVPLGRSF
310 320 330 340 350
SHATALESDY NEDNLDYYDV NEEEAEYLPG EPEEALNGHS SIDVSFQSKV
360 370 380 390 400
DTKPLEESST LDPHTKEGTS LGEVGGPDLK GQVEPWDERE TRSPAPPEVD
410 420 430 440 450
RDSLAPSWET PPPYPENGSI QPYPDGGPVP SEMDVPPAHP EEEIVLRSYP
460 470 480 490 500
ASGHTTPLSR GTYEVGLEDN IGSNTEVFTY NAANKETCEH NHRQCSRHAF
510 520 530 540 550
CTDYATGFCC HCQSKFYGNG KHCLPEGAPH RVNGKVSGHL HVGHTPVHFT
560 570 580 590 600
DVDLHAYIVG NDGRAYTAIS HIPQPAAQAL LPLTPIGGLF GWLFALEKPG
610 620 630 640 650
SENGFSLAGA AFTHDMEVTF YPGEETVRIT QTAEGLDPEN YLSIKTNIQG
660 670 680 690 700
QVPYVSANFT AHISPYKELY HYSDSTVTST SSRDYSLTFG AINQTWSYRI
710 720 730 740 750
HQNITYQVCR HAPRHPSFPT TQQLNVDRVF ALYNDEERVL RFAVTNQIGP
760 770 780 790 800
VKEDSDPTPG NPCYDGSHMC DTTARCHPGT GVDYTCECAS GYQGDGRNCV
810 820 830 840 850
DENECATGFH RCGPNSVCIN LPGSYRCECR SGYEFADDRH TCILITPPAN
860 870 880 890 900
PCEDGSHTCA PAGQARCVHH GGSTFSCACL PGYAGDGHQC TDVDECSENR
910 920 930 940 950
CHPAATCYNT PGSFSCRCQP GYYGDGFQCI PDSTSSLTPC EQQQRHAQAQ
960 970 980 990 1000
YAYPGARFHI PQCDEQGNFL PLQCHGSTGF CWCVDPDGHE VPGTQTPPGS
1010 1020 1030 1040 1050
TPPHCGPSPE PTQRPPTICE RWRENLLEHY GGTPRDDQYV PQCDDLGHFI
1060 1070 1080 1090 1100
PLQCHGKSDF CWCVDKDGRE VQGTRSQPGT TPACIPTVAP PMVRPTPRPD
1110 1120 1130 1140 1150
VTPPSVGTFL LYTQGQQIGY LPLNGTRLQK DAAKTLLSLH GSIIVGIDYD
1160 1170 1180 1190 1200
CRERMVYWTD VAGRTISRAG LELGAEPETI VNSGLISPEG LAIDHIRRTM
1210 1220 1230 1240 1250
YWTDSVLDKI ESALLDGSER KVLFYTDLVN PRAIAVDPIR GNLYWTDWNR
1260 1270 1280 1290 1300
EAPKIETSSL DGENRRILIN TDIGLPNGLT FDPFSKLLCW ADAGTKKLEC
1310 1320 1330 1340 1350
TLPDGTGRRV IQNNLKYPFS IVSYADHFYH TDWRRDGVVS VNKHSGQFTD
1360 1370
EYLPEQRSHL YGITAVYPYC PTGRK
Length:1,375
Mass (Da):151,254
Last modified:March 2, 2010 - v3
Checksum:i198D1F4E286A53E2
GO
Isoform 2 (identifier: Q14112-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-59: Missing.
     844-892: LITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTD → Y

Note: No experimental confirmation available.
Show »
Length:1,274
Mass (Da):140,866
Checksum:iC6E3D787DB40235B
GO

Sequence cautioni

The sequence BAA13087.1 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172. Curated
The sequence BAA24112.1 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti44 – 441G → W in BAA13087 (Ref. 2) Curated
Sequence conflicti44 – 441G → W in BAA24112 (Ref. 3) Curated
Sequence conflicti700 – 7001I → T in BAG62181 (PubMed:14702039).Curated
Sequence conflicti1242 – 12421N → D in BAF84341 (PubMed:14702039).Curated
Sequence conflicti1245 – 12451W → R in BAF84341 (PubMed:14702039).Curated
Sequence conflicti1249 – 12491N → D in BAF84341 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti22 – 221P → Q.4 Publications
Corresponds to variant rs3920038 [ dbSNP | Ensembl ].
VAR_062850
Natural varianti313 – 3131D → G.
Corresponds to variant rs17124969 [ dbSNP | Ensembl ].
VAR_055767
Natural varianti354 – 3541P → H.
Corresponds to variant rs35657569 [ dbSNP | Ensembl ].
VAR_055768
Natural varianti453 – 4531G → D.1 Publication
Corresponds to variant rs2101919 [ dbSNP | Ensembl ].
VAR_062851
Natural varianti529 – 5291P → S.
Corresponds to variant rs17831525 [ dbSNP | Ensembl ].
VAR_055769
Natural varianti656 – 6561S → P.4 Publications
Corresponds to variant rs3742536 [ dbSNP | Ensembl ].
VAR_062852
Natural varianti726 – 7261V → M.
Corresponds to variant rs35147930 [ dbSNP | Ensembl ].
VAR_055770
Natural varianti760 – 7601G → V.5 Publications
Corresponds to variant rs2273430 [ dbSNP | Ensembl ].
VAR_062853
Natural varianti775 – 7751R → Q.
Corresponds to variant rs10134590 [ dbSNP | Ensembl ].
VAR_055771
Natural varianti830 – 8301R → Q.
Corresponds to variant rs7144523 [ dbSNP | Ensembl ].
VAR_055772
Natural varianti866 – 8661R → Q.
Corresponds to variant rs28507587 [ dbSNP | Ensembl ].
VAR_055773
Natural varianti1238 – 12381P → S in a breast cancer sample; somatic mutation. 1 Publication
VAR_035836

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei7 – 5953Missing in isoform 2. 1 PublicationVSP_038779Add
BLAST
Alternative sequencei844 – 89249LITPP…HQCTD → Y in isoform 2. 1 PublicationVSP_038780Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223500 mRNA. Translation: CAA11418.1.
D86425 mRNA. Translation: BAA13087.1. Frameshift.
AB009799 Genomic DNA. Translation: BAA24112.1. Frameshift.
AK300462 mRNA. Translation: BAG62181.1.
AK291652 mRNA. Translation: BAF84341.1.
CCDSiCCDS9706.1. [Q14112-1]
PIRiG00043.
RefSeqiNP_031387.3. NM_007361.3. [Q14112-1]
UniGeneiHs.369840.

Genome annotation databases

EnsembliENST00000216286; ENSP00000216286; ENSG00000087303.
GeneIDi22795.
KEGGihsa:22795.
UCSCiuc001wzo.3. human. [Q14112-1]
uc010tqs.2. human. [Q14112-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ223500 mRNA. Translation: CAA11418.1.
D86425 mRNA. Translation: BAA13087.1. Frameshift.
AB009799 Genomic DNA. Translation: BAA24112.1. Frameshift.
AK300462 mRNA. Translation: BAG62181.1.
AK291652 mRNA. Translation: BAF84341.1.
CCDSiCCDS9706.1. [Q14112-1]
PIRiG00043.
RefSeqiNP_031387.3. NM_007361.3. [Q14112-1]
UniGeneiHs.369840.

3D structure databases

ProteinModelPortaliQ14112.
SMRiQ14112. Positions 487-752, 801-996, 1107-1370.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116476. 18 interactions.
IntActiQ14112. 2 interactions.
MINTiMINT-1183597.
STRINGi9606.ENSP00000216286.

Protein family/group databases

MEROPSiI63.001.

PTM databases

PhosphoSiteiQ14112.

Polymorphism and mutation databases

BioMutaiNID2.
DMDMi290457669.

Proteomic databases

MaxQBiQ14112.
PaxDbiQ14112.
PRIDEiQ14112.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000216286; ENSP00000216286; ENSG00000087303.
GeneIDi22795.
KEGGihsa:22795.
UCSCiuc001wzo.3. human. [Q14112-1]
uc010tqs.2. human. [Q14112-2]

Organism-specific databases

CTDi22795.
GeneCardsiGC14M052471.
H-InvDBHIX0026668.
HGNCiHGNC:13389. NID2.
HPAiHPA052460.
MIMi605399. gene.
neXtProtiNX_Q14112.
PharmGKBiPA31626.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG282695.
GeneTreeiENSGT00760000118968.
HOGENOMiHOG000072712.
HOVERGENiHBG006498.
InParanoidiQ14112.
KOiK06826.
OMAiHIPQCDE.
OrthoDBiEOG7M0NQN.
PhylomeDBiQ14112.
TreeFamiTF320666.

Enzyme and pathway databases

ReactomeiREACT_169262. Laminin interactions.

Miscellaneous databases

ChiTaRSiNID2. human.
GeneWikiiNID2.
GenomeRNAii22795.
NextBioi43128.
PROiQ14112.
SOURCEiSearch...

Gene expression databases

BgeeiQ14112.
CleanExiHS_NID2.
ExpressionAtlasiQ14112. baseline and differential.
GenevisibleiQ14112. HS.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
2.40.155.10. 2 hits.
4.10.800.10. 2 hits.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR024731. EGF_dom_MSP1-like.
IPR006605. G2_nidogen/fibulin_G2F.
IPR009017. GFP.
IPR023413. GFP-like.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000033. LDLR_classB_rpt.
IPR003886. Nidogen_extracell_dom.
IPR000716. Thyroglobulin_1.
[Graphical view]
PfamiPF12662. cEGF. 1 hit.
PF12947. EGF_3. 1 hit.
PF07645. EGF_CA. 1 hit.
PF07474. G2F. 1 hit.
PF00058. Ldl_recept_b. 2 hits.
PF06119. NIDO. 1 hit.
PF00086. Thyroglobulin_1. 2 hits.
[Graphical view]
SMARTiSM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
SM00682. G2F. 1 hit.
SM00135. LY. 5 hits.
SM00539. NIDO. 1 hit.
SM00211. TY. 2 hits.
[Graphical view]
SUPFAMiSSF54511. SSF54511. 1 hit.
SSF57184. SSF57184. 2 hits.
SSF57610. SSF57610. 2 hits.
PROSITEiPS00010. ASX_HYDROXYL. 3 hits.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 2 hits.
PS51120. LDLRB. 4 hits.
PS51220. NIDO. 1 hit.
PS50993. NIDOGEN_G2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 2 hits.
PS51162. THYROGLOBULIN_1_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Nidogen-2: a new basement membrane protein with diverse binding properties."
    Kohfeldt E., Sasaki T., Goehring W., Timpl R.
    J. Mol. Biol. 282:99-109(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF N-TERMINUS, VARIANTS GLN-22; ASP-453; PRO-656 AND VAL-760.
  2. "The cloning and characterization of a cDNA for the novel bone matrix protein: osteonidogen."
    Ohno I., Hashimoto J., Takaoka K., Ochi T., Okubo K., Matsubara K.
    Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS GLN-22; PRO-656 AND VAL-760.
    Tissue: Cancellous bone.
  3. "Human osteonidogen gene: intron-exon junctions and chromosomal localization."
    Ohno I., Okubo K., Matsubara K.
    Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANTS GLN-22; PRO-656 AND VAL-760.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS GLN-22; PRO-656; VAL-760 AND VAL-760.
    Tissue: Placenta.
  5. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin."
    Tu H., Sasaki T., Snellman A., Gohring W., Pirila P., Timpl R., Pihlajaniemi T.
    J. Biol. Chem. 277:23092-23099(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH COL13A1.
  7. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1124.
    Tissue: Liver.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. Cited for: VARIANT [LARGE SCALE ANALYSIS] SER-1238.
  10. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT [LARGE SCALE ANALYSIS] VAL-760, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiNID2_HUMAN
AccessioniPrimary (citable) accession number: Q14112
Secondary accession number(s): A8K6I7, B4DU19, O43710
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: March 2, 2010
Last modified: July 22, 2015
This is version 153 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.