Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q14112

- NID2_HUMAN

UniProt

Q14112 - NID2_HUMAN

Protein

Nidogen-2

Gene

NID2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 143 (01 Oct 2014)
      Sequence version 3 (02 Mar 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cell adhesion glycoprotein which is widely distributed in basement membranes. Binds to collagens I and IV, to perlecan and to laminin 1. Does not bind fibulins. It probably has a role in cell-extracellular matrix interactions.

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. collagen binding Source: ProtInc
    3. protein binding Source: UniProtKB

    GO - Biological processi

    1. basement membrane organization Source: BHF-UCL
    2. cell adhesion Source: ProtInc
    3. cell-matrix adhesion Source: Ensembl
    4. extracellular matrix organization Source: Reactome

    Keywords - Biological processi

    Cell adhesion

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    ReactomeiREACT_169262. Laminin interactions.

    Protein family/group databases

    MEROPSiI63.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nidogen-2
    Short name:
    NID-2
    Alternative name(s):
    Osteonidogen
    Gene namesi
    Name:NID2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:13389. NID2.

    Subcellular locationi

    GO - Cellular componenti

    1. basement membrane Source: BHF-UCL
    2. cell surface Source: Ensembl
    3. extracellular region Source: Reactome
    4. extracellular vesicular exosome Source: UniProt

    Keywords - Cellular componenti

    Basement membrane, Extracellular matrix, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31626.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 30301 PublicationAdd
    BLAST
    Chaini31 – 13751345Nidogen-2PRO_0000007671Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi417 – 4171N-linked (GlcNAc...)Curated
    Glycosylationi658 – 6581N-linked (GlcNAc...)Curated
    Glycosylationi693 – 6931N-linked (GlcNAc...)Curated
    Glycosylationi703 – 7031N-linked (GlcNAc...)Curated
    Disulfide bondi763 ↔ 776By similarity
    Disulfide bondi770 ↔ 786By similarity
    Disulfide bondi788 ↔ 799By similarity
    Disulfide bondi805 ↔ 818By similarity
    Disulfide bondi812 ↔ 827By similarity
    Disulfide bondi829 ↔ 842By similarity
    Disulfide bondi852 ↔ 867By similarity
    Disulfide bondi859 ↔ 877By similarity
    Disulfide bondi879 ↔ 890By similarity
    Disulfide bondi896 ↔ 907By similarity
    Disulfide bondi901 ↔ 916By similarity
    Disulfide bondi918 ↔ 929By similarity
    Disulfide bondi940 ↔ 963By similarity
    Disulfide bondi974 ↔ 981By similarity
    Disulfide bondi983 ↔ 1005By similarity
    Disulfide bondi1019 ↔ 1043By similarity
    Disulfide bondi1054 ↔ 1061By similarity
    Disulfide bondi1063 ↔ 1084By similarity
    Glycosylationi1124 – 11241N-linked (GlcNAc...)1 Publication

    Post-translational modificationi

    Highly N- and O-glycosylated.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ14112.
    PaxDbiQ14112.
    PRIDEiQ14112.

    PTM databases

    PhosphoSiteiQ14112.

    Expressioni

    Tissue specificityi

    Heart, placenta and bone. Less in pancreas, kidney and skeletal muscle.

    Gene expression databases

    ArrayExpressiQ14112.
    BgeeiQ14112.
    CleanExiHS_NID2.
    GenevestigatoriQ14112.

    Organism-specific databases

    HPAiHPA052460.

    Interactioni

    Subunit structurei

    Interacts with LAMA2 By similarity. Interacts with COL13A1.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi116476. 8 interactions.
    IntActiQ14112. 2 interactions.
    MINTiMINT-1183597.
    STRINGi9606.ENSP00000216286.

    Structurei

    3D structure databases

    ProteinModelPortaliQ14112.
    SMRiQ14112. Positions 487-752, 769-996, 1107-1370.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini108 – 273166NIDOPROSITE-ProRule annotationAdd
    BLAST
    Domaini484 – 52441EGF-like 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini528 – 758231Nidogen G2 beta-barrelPROSITE-ProRule annotationAdd
    BLAST
    Domaini759 – 80042EGF-like 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini801 – 84343EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini848 – 89144EGF-like 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini892 – 93039EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
    BLAST
    Domaini937 – 100569Thyroglobulin type-1 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1016 – 108469Thyroglobulin type-1 2PROSITE-ProRule annotationAdd
    BLAST
    Repeati1154 – 119744LDL-receptor class B 1Add
    BLAST
    Repeati1198 – 124043LDL-receptor class B 2Add
    BLAST
    Repeati1241 – 128545LDL-receptor class B 3Add
    BLAST
    Repeati1286 – 132742LDL-receptor class B 4Add
    BLAST
    Repeati1329 – 137345LDL-receptor class B 5Add
    BLAST

    Sequence similaritiesi

    Contains 5 EGF-like domains.PROSITE-ProRule annotation
    Contains 5 LDL-receptor class B repeats.PROSITE-ProRule annotation
    Contains 1 NIDO domain.PROSITE-ProRule annotation
    Contains 1 nidogen G2 beta-barrel domain.PROSITE-ProRule annotation
    Contains 2 thyroglobulin type-1 domains.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG282695.
    HOGENOMiHOG000072712.
    HOVERGENiHBG006498.
    InParanoidiQ14112.
    KOiK06826.
    OMAiARVGFCR.
    OrthoDBiEOG7M0NQN.
    PhylomeDBiQ14112.
    TreeFamiTF320666.

    Family and domain databases

    Gene3Di2.120.10.30. 1 hit.
    2.40.155.10. 2 hits.
    4.10.800.10. 2 hits.
    InterProiIPR011042. 6-blade_b-propeller_TolB-like.
    IPR026823. cEGF.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR024731. EGF_dom_MSP1-like.
    IPR006605. G2_nidogen/fibulin_G2F.
    IPR009017. GFP.
    IPR023413. GFP_like.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR000033. LDLR_classB_rpt.
    IPR003886. Nidogen_extracell_dom.
    IPR000716. Thyroglobulin_1.
    [Graphical view]
    PfamiPF12662. cEGF. 1 hit.
    PF12947. EGF_3. 1 hit.
    PF07645. EGF_CA. 1 hit.
    PF07474. G2F. 1 hit.
    PF00058. Ldl_recept_b. 2 hits.
    PF06119. NIDO. 1 hit.
    PF00086. Thyroglobulin_1. 2 hits.
    [Graphical view]
    SMARTiSM00181. EGF. 3 hits.
    SM00179. EGF_CA. 2 hits.
    SM00682. G2F. 1 hit.
    SM00135. LY. 5 hits.
    SM00539. NIDO. 1 hit.
    SM00211. TY. 2 hits.
    [Graphical view]
    SUPFAMiSSF54511. SSF54511. 1 hit.
    SSF57184. SSF57184. 2 hits.
    SSF57610. SSF57610. 2 hits.
    PROSITEiPS00010. ASX_HYDROXYL. 3 hits.
    PS01186. EGF_2. 4 hits.
    PS50026. EGF_3. 4 hits.
    PS01187. EGF_CA. 2 hits.
    PS51120. LDLRB. 4 hits.
    PS51220. NIDO. 1 hit.
    PS50993. NIDOGEN_G2. 1 hit.
    PS00484. THYROGLOBULIN_1_1. 2 hits.
    PS51162. THYROGLOBULIN_1_2. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q14112-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEGDRVAGRP VLSSLPVLLL LPLLMLRAAA LHPDELFPHG ESWGDQLLQE     50
    GDDESSAVVK LANPLHFYEA RFSNLYVGTN GIISTQDFPR ETQYVDYDFP 100
    TDFPAIAPFL ADIDTSHGRG RVLYREDTSP AVLGLAARYV RAGFPRSARF 150
    TPTHAFLATW EQVGAYEEVK RGALPSGELN TFQAVLASDG SDSYALFLYP 200
    ANGLQFLGTR PKESYNVQLQ LPARVGFCRG EADDLKSEGP YFSLTSTEQS 250
    VKNLYQLSNL GIPGVWAFHI GSTSPLDNVR PAAVGDLSAA HSSVPLGRSF 300
    SHATALESDY NEDNLDYYDV NEEEAEYLPG EPEEALNGHS SIDVSFQSKV 350
    DTKPLEESST LDPHTKEGTS LGEVGGPDLK GQVEPWDERE TRSPAPPEVD 400
    RDSLAPSWET PPPYPENGSI QPYPDGGPVP SEMDVPPAHP EEEIVLRSYP 450
    ASGHTTPLSR GTYEVGLEDN IGSNTEVFTY NAANKETCEH NHRQCSRHAF 500
    CTDYATGFCC HCQSKFYGNG KHCLPEGAPH RVNGKVSGHL HVGHTPVHFT 550
    DVDLHAYIVG NDGRAYTAIS HIPQPAAQAL LPLTPIGGLF GWLFALEKPG 600
    SENGFSLAGA AFTHDMEVTF YPGEETVRIT QTAEGLDPEN YLSIKTNIQG 650
    QVPYVSANFT AHISPYKELY HYSDSTVTST SSRDYSLTFG AINQTWSYRI 700
    HQNITYQVCR HAPRHPSFPT TQQLNVDRVF ALYNDEERVL RFAVTNQIGP 750
    VKEDSDPTPG NPCYDGSHMC DTTARCHPGT GVDYTCECAS GYQGDGRNCV 800
    DENECATGFH RCGPNSVCIN LPGSYRCECR SGYEFADDRH TCILITPPAN 850
    PCEDGSHTCA PAGQARCVHH GGSTFSCACL PGYAGDGHQC TDVDECSENR 900
    CHPAATCYNT PGSFSCRCQP GYYGDGFQCI PDSTSSLTPC EQQQRHAQAQ 950
    YAYPGARFHI PQCDEQGNFL PLQCHGSTGF CWCVDPDGHE VPGTQTPPGS 1000
    TPPHCGPSPE PTQRPPTICE RWRENLLEHY GGTPRDDQYV PQCDDLGHFI 1050
    PLQCHGKSDF CWCVDKDGRE VQGTRSQPGT TPACIPTVAP PMVRPTPRPD 1100
    VTPPSVGTFL LYTQGQQIGY LPLNGTRLQK DAAKTLLSLH GSIIVGIDYD 1150
    CRERMVYWTD VAGRTISRAG LELGAEPETI VNSGLISPEG LAIDHIRRTM 1200
    YWTDSVLDKI ESALLDGSER KVLFYTDLVN PRAIAVDPIR GNLYWTDWNR 1250
    EAPKIETSSL DGENRRILIN TDIGLPNGLT FDPFSKLLCW ADAGTKKLEC 1300
    TLPDGTGRRV IQNNLKYPFS IVSYADHFYH TDWRRDGVVS VNKHSGQFTD 1350
    EYLPEQRSHL YGITAVYPYC PTGRK 1375
    Length:1,375
    Mass (Da):151,254
    Last modified:March 2, 2010 - v3
    Checksum:i198D1F4E286A53E2
    GO
    Isoform 2 (identifier: Q14112-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         7-59: Missing.
         844-892: LITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTD → Y

    Note: No experimental confirmation available.

    Show »
    Length:1,274
    Mass (Da):140,866
    Checksum:iC6E3D787DB40235B
    GO

    Sequence cautioni

    The sequence BAA13087.1 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172.
    The sequence BAA24112.1 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti44 – 441G → W in BAA13087. 1 PublicationCurated
    Sequence conflicti44 – 441G → W in BAA24112. 1 PublicationCurated
    Sequence conflicti700 – 7001I → T in BAG62181. (PubMed:14702039)Curated
    Sequence conflicti1242 – 12421N → D in BAF84341. (PubMed:14702039)Curated
    Sequence conflicti1245 – 12451W → R in BAF84341. (PubMed:14702039)Curated
    Sequence conflicti1249 – 12491N → D in BAF84341. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti22 – 221P → Q.4 Publications
    Corresponds to variant rs3920038 [ dbSNP | Ensembl ].
    VAR_062850
    Natural varianti313 – 3131D → G.
    Corresponds to variant rs17124969 [ dbSNP | Ensembl ].
    VAR_055767
    Natural varianti354 – 3541P → H.
    Corresponds to variant rs35657569 [ dbSNP | Ensembl ].
    VAR_055768
    Natural varianti453 – 4531G → D.1 Publication
    Corresponds to variant rs2101919 [ dbSNP | Ensembl ].
    VAR_062851
    Natural varianti529 – 5291P → S.
    Corresponds to variant rs17831525 [ dbSNP | Ensembl ].
    VAR_055769
    Natural varianti656 – 6561S → P.4 Publications
    Corresponds to variant rs3742536 [ dbSNP | Ensembl ].
    VAR_062852
    Natural varianti726 – 7261V → M.
    Corresponds to variant rs35147930 [ dbSNP | Ensembl ].
    VAR_055770
    Natural varianti760 – 7601G → V.4 Publications
    Corresponds to variant rs2273430 [ dbSNP | Ensembl ].
    VAR_062853
    Natural varianti775 – 7751R → Q.
    Corresponds to variant rs10134590 [ dbSNP | Ensembl ].
    VAR_055771
    Natural varianti830 – 8301R → Q.
    Corresponds to variant rs7144523 [ dbSNP | Ensembl ].
    VAR_055772
    Natural varianti866 – 8661R → Q.
    Corresponds to variant rs28507587 [ dbSNP | Ensembl ].
    VAR_055773
    Natural varianti1238 – 12381P → S in a breast cancer sample; somatic mutation. 1 Publication
    VAR_035836

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei7 – 5953Missing in isoform 2. 1 PublicationVSP_038779Add
    BLAST
    Alternative sequencei844 – 89249LITPP…HQCTD → Y in isoform 2. 1 PublicationVSP_038780Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ223500 mRNA. Translation: CAA11418.1.
    D86425 mRNA. Translation: BAA13087.1. Frameshift.
    AB009799 Genomic DNA. Translation: BAA24112.1. Frameshift.
    AK300462 mRNA. Translation: BAG62181.1.
    AK291652 mRNA. Translation: BAF84341.1.
    CCDSiCCDS9706.1. [Q14112-1]
    PIRiG00043.
    RefSeqiNP_031387.3. NM_007361.3. [Q14112-1]
    UniGeneiHs.369840.

    Genome annotation databases

    EnsembliENST00000216286; ENSP00000216286; ENSG00000087303. [Q14112-1]
    ENST00000541773; ENSP00000443730; ENSG00000087303. [Q14112-2]
    GeneIDi22795.
    KEGGihsa:22795.
    UCSCiuc001wzo.3. human. [Q14112-1]
    uc010tqs.2. human. [Q14112-2]

    Polymorphism databases

    DMDMi290457669.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ223500 mRNA. Translation: CAA11418.1 .
    D86425 mRNA. Translation: BAA13087.1 . Frameshift.
    AB009799 Genomic DNA. Translation: BAA24112.1 . Frameshift.
    AK300462 mRNA. Translation: BAG62181.1 .
    AK291652 mRNA. Translation: BAF84341.1 .
    CCDSi CCDS9706.1. [Q14112-1 ]
    PIRi G00043.
    RefSeqi NP_031387.3. NM_007361.3. [Q14112-1 ]
    UniGenei Hs.369840.

    3D structure databases

    ProteinModelPortali Q14112.
    SMRi Q14112. Positions 487-752, 769-996, 1107-1370.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116476. 8 interactions.
    IntActi Q14112. 2 interactions.
    MINTi MINT-1183597.
    STRINGi 9606.ENSP00000216286.

    Protein family/group databases

    MEROPSi I63.001.

    PTM databases

    PhosphoSitei Q14112.

    Polymorphism databases

    DMDMi 290457669.

    Proteomic databases

    MaxQBi Q14112.
    PaxDbi Q14112.
    PRIDEi Q14112.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000216286 ; ENSP00000216286 ; ENSG00000087303 . [Q14112-1 ]
    ENST00000541773 ; ENSP00000443730 ; ENSG00000087303 . [Q14112-2 ]
    GeneIDi 22795.
    KEGGi hsa:22795.
    UCSCi uc001wzo.3. human. [Q14112-1 ]
    uc010tqs.2. human. [Q14112-2 ]

    Organism-specific databases

    CTDi 22795.
    GeneCardsi GC14M052471.
    H-InvDB HIX0026668.
    HGNCi HGNC:13389. NID2.
    HPAi HPA052460.
    MIMi 605399. gene.
    neXtProti NX_Q14112.
    PharmGKBi PA31626.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG282695.
    HOGENOMi HOG000072712.
    HOVERGENi HBG006498.
    InParanoidi Q14112.
    KOi K06826.
    OMAi ARVGFCR.
    OrthoDBi EOG7M0NQN.
    PhylomeDBi Q14112.
    TreeFami TF320666.

    Enzyme and pathway databases

    Reactomei REACT_169262. Laminin interactions.

    Miscellaneous databases

    ChiTaRSi NID2. human.
    GeneWikii NID2.
    GenomeRNAii 22795.
    NextBioi 43128.
    PROi Q14112.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q14112.
    Bgeei Q14112.
    CleanExi HS_NID2.
    Genevestigatori Q14112.

    Family and domain databases

    Gene3Di 2.120.10.30. 1 hit.
    2.40.155.10. 2 hits.
    4.10.800.10. 2 hits.
    InterProi IPR011042. 6-blade_b-propeller_TolB-like.
    IPR026823. cEGF.
    IPR000742. EG-like_dom.
    IPR001881. EGF-like_Ca-bd_dom.
    IPR013032. EGF-like_CS.
    IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
    IPR018097. EGF_Ca-bd_CS.
    IPR024731. EGF_dom_MSP1-like.
    IPR006605. G2_nidogen/fibulin_G2F.
    IPR009017. GFP.
    IPR023413. GFP_like.
    IPR009030. Growth_fac_rcpt_N_dom.
    IPR000033. LDLR_classB_rpt.
    IPR003886. Nidogen_extracell_dom.
    IPR000716. Thyroglobulin_1.
    [Graphical view ]
    Pfami PF12662. cEGF. 1 hit.
    PF12947. EGF_3. 1 hit.
    PF07645. EGF_CA. 1 hit.
    PF07474. G2F. 1 hit.
    PF00058. Ldl_recept_b. 2 hits.
    PF06119. NIDO. 1 hit.
    PF00086. Thyroglobulin_1. 2 hits.
    [Graphical view ]
    SMARTi SM00181. EGF. 3 hits.
    SM00179. EGF_CA. 2 hits.
    SM00682. G2F. 1 hit.
    SM00135. LY. 5 hits.
    SM00539. NIDO. 1 hit.
    SM00211. TY. 2 hits.
    [Graphical view ]
    SUPFAMi SSF54511. SSF54511. 1 hit.
    SSF57184. SSF57184. 2 hits.
    SSF57610. SSF57610. 2 hits.
    PROSITEi PS00010. ASX_HYDROXYL. 3 hits.
    PS01186. EGF_2. 4 hits.
    PS50026. EGF_3. 4 hits.
    PS01187. EGF_CA. 2 hits.
    PS51120. LDLRB. 4 hits.
    PS51220. NIDO. 1 hit.
    PS50993. NIDOGEN_G2. 1 hit.
    PS00484. THYROGLOBULIN_1_1. 2 hits.
    PS51162. THYROGLOBULIN_1_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Nidogen-2: a new basement membrane protein with diverse binding properties."
      Kohfeldt E., Sasaki T., Goehring W., Timpl R.
      J. Mol. Biol. 282:99-109(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF N-TERMINUS, VARIANTS GLN-22; ASP-453; PRO-656 AND VAL-760.
    2. "The cloning and characterization of a cDNA for the novel bone matrix protein: osteonidogen."
      Ohno I., Hashimoto J., Takaoka K., Ochi T., Okubo K., Matsubara K.
      Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS GLN-22; PRO-656 AND VAL-760.
      Tissue: Cancellous bone.
    3. "Human osteonidogen gene: intron-exon junctions and chromosomal localization."
      Ohno I., Okubo K., Matsubara K.
      Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANTS GLN-22; PRO-656 AND VAL-760.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS GLN-22; PRO-656; VAL-760 AND VAL-760.
      Tissue: Placenta.
    5. "The DNA sequence and analysis of human chromosome 14."
      Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
      , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
      Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin."
      Tu H., Sasaki T., Snellman A., Gohring W., Pirila P., Timpl R., Pihlajaniemi T.
      J. Biol. Chem. 277:23092-23099(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH COL13A1.
    7. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
      Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
      J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1124.
      Tissue: Liver.
    8. Cited for: VARIANT [LARGE SCALE ANALYSIS] SER-1238.

    Entry informationi

    Entry nameiNID2_HUMAN
    AccessioniPrimary (citable) accession number: Q14112
    Secondary accession number(s): A8K6I7, B4DU19, O43710
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 15, 1998
    Last sequence update: March 2, 2010
    Last modified: October 1, 2014
    This is version 143 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3