SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q14112

- NID2_HUMAN

UniProt

Q14112 - NID2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Nidogen-2
Gene
NID2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Cell adhesion glycoprotein which is widely distributed in basement membranes. Binds to collagens I and IV, to perlecan and to laminin 1. Does not bind fibulins. It probably has a role in cell-extracellular matrix interactions.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. collagen binding Source: ProtInc
  3. protein binding Source: UniProtKB

GO - Biological processi

  1. basement membrane organization Source: BHF-UCL
  2. cell adhesion Source: ProtInc
  3. cell-matrix adhesion Source: Ensembl
  4. extracellular matrix organization Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_169262. Laminin interactions.

Protein family/group databases

MEROPSiI63.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Nidogen-2
Short name:
NID-2
Alternative name(s):
Osteonidogen
Gene namesi
Name:NID2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:13389. NID2.

Subcellular locationi

GO - Cellular componenti

  1. basement membrane Source: BHF-UCL
  2. cell surface Source: Ensembl
  3. extracellular region Source: Reactome
  4. extracellular vesicular exosome Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Basement membrane, Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31626.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 30301 Publication
Add
BLAST
Chaini31 – 13751345Nidogen-2
PRO_0000007671Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi417 – 4171N-linked (GlcNAc...) Inferred
Glycosylationi658 – 6581N-linked (GlcNAc...) Inferred
Glycosylationi693 – 6931N-linked (GlcNAc...) Inferred
Glycosylationi703 – 7031N-linked (GlcNAc...) Inferred
Disulfide bondi763 ↔ 776 By similarity
Disulfide bondi770 ↔ 786 By similarity
Disulfide bondi788 ↔ 799 By similarity
Disulfide bondi805 ↔ 818 By similarity
Disulfide bondi812 ↔ 827 By similarity
Disulfide bondi829 ↔ 842 By similarity
Disulfide bondi852 ↔ 867 By similarity
Disulfide bondi859 ↔ 877 By similarity
Disulfide bondi879 ↔ 890 By similarity
Disulfide bondi896 ↔ 907 By similarity
Disulfide bondi901 ↔ 916 By similarity
Disulfide bondi918 ↔ 929 By similarity
Disulfide bondi940 ↔ 963 By similarity
Disulfide bondi974 ↔ 981 By similarity
Disulfide bondi983 ↔ 1005 By similarity
Disulfide bondi1019 ↔ 1043 By similarity
Disulfide bondi1054 ↔ 1061 By similarity
Disulfide bondi1063 ↔ 1084 By similarity
Glycosylationi1124 – 11241N-linked (GlcNAc...)1 Publication

Post-translational modificationi

Highly N- and O-glycosylated.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ14112.
PaxDbiQ14112.
PRIDEiQ14112.

PTM databases

PhosphoSiteiQ14112.

Expressioni

Tissue specificityi

Heart, placenta and bone. Less in pancreas, kidney and skeletal muscle.

Gene expression databases

ArrayExpressiQ14112.
BgeeiQ14112.
CleanExiHS_NID2.
GenevestigatoriQ14112.

Organism-specific databases

HPAiHPA052460.

Interactioni

Subunit structurei

Interacts with LAMA2 By similarity. Interacts with COL13A1.1 Publication

Protein-protein interaction databases

BioGridi116476. 8 interactions.
IntActiQ14112. 2 interactions.
MINTiMINT-1183597.
STRINGi9606.ENSP00000216286.

Structurei

3D structure databases

ProteinModelPortaliQ14112.
SMRiQ14112. Positions 487-752, 769-996, 1107-1370.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini108 – 273166NIDO
Add
BLAST
Domaini484 – 52441EGF-like 1
Add
BLAST
Domaini528 – 758231Nidogen G2 beta-barrel
Add
BLAST
Domaini759 – 80042EGF-like 2
Add
BLAST
Domaini801 – 84343EGF-like 3; calcium-binding Reviewed prediction
Add
BLAST
Domaini848 – 89144EGF-like 4
Add
BLAST
Domaini892 – 93039EGF-like 5; calcium-binding Reviewed prediction
Add
BLAST
Domaini937 – 100569Thyroglobulin type-1 1
Add
BLAST
Domaini1016 – 108469Thyroglobulin type-1 2
Add
BLAST
Repeati1154 – 119744LDL-receptor class B 1
Add
BLAST
Repeati1198 – 124043LDL-receptor class B 2
Add
BLAST
Repeati1241 – 128545LDL-receptor class B 3
Add
BLAST
Repeati1286 – 132742LDL-receptor class B 4
Add
BLAST
Repeati1329 – 137345LDL-receptor class B 5
Add
BLAST

Sequence similaritiesi

Contains 5 EGF-like domains.
Contains 1 NIDO domain.

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG282695.
HOGENOMiHOG000072712.
HOVERGENiHBG006498.
InParanoidiQ14112.
KOiK06826.
OMAiARVGFCR.
OrthoDBiEOG7M0NQN.
PhylomeDBiQ14112.
TreeFamiTF320666.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
2.40.155.10. 2 hits.
4.10.800.10. 2 hits.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR024731. EGF_dom_MSP1-like.
IPR006605. G2_nidogen/fibulin_G2F.
IPR009017. GFP.
IPR023413. GFP_like.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000033. LDLR_classB_rpt.
IPR003886. Nidogen_extracell_dom.
IPR000716. Thyroglobulin_1.
[Graphical view]
PfamiPF12662. cEGF. 1 hit.
PF12947. EGF_3. 1 hit.
PF07645. EGF_CA. 1 hit.
PF07474. G2F. 1 hit.
PF00058. Ldl_recept_b. 2 hits.
PF06119. NIDO. 1 hit.
PF00086. Thyroglobulin_1. 2 hits.
[Graphical view]
SMARTiSM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
SM00682. G2F. 1 hit.
SM00135. LY. 5 hits.
SM00539. NIDO. 1 hit.
SM00211. TY. 2 hits.
[Graphical view]
SUPFAMiSSF54511. SSF54511. 1 hit.
SSF57184. SSF57184. 2 hits.
SSF57610. SSF57610. 2 hits.
PROSITEiPS00010. ASX_HYDROXYL. 3 hits.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 2 hits.
PS51120. LDLRB. 4 hits.
PS51220. NIDO. 1 hit.
PS50993. NIDOGEN_G2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 2 hits.
PS51162. THYROGLOBULIN_1_2. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q14112-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEGDRVAGRP VLSSLPVLLL LPLLMLRAAA LHPDELFPHG ESWGDQLLQE     50
GDDESSAVVK LANPLHFYEA RFSNLYVGTN GIISTQDFPR ETQYVDYDFP 100
TDFPAIAPFL ADIDTSHGRG RVLYREDTSP AVLGLAARYV RAGFPRSARF 150
TPTHAFLATW EQVGAYEEVK RGALPSGELN TFQAVLASDG SDSYALFLYP 200
ANGLQFLGTR PKESYNVQLQ LPARVGFCRG EADDLKSEGP YFSLTSTEQS 250
VKNLYQLSNL GIPGVWAFHI GSTSPLDNVR PAAVGDLSAA HSSVPLGRSF 300
SHATALESDY NEDNLDYYDV NEEEAEYLPG EPEEALNGHS SIDVSFQSKV 350
DTKPLEESST LDPHTKEGTS LGEVGGPDLK GQVEPWDERE TRSPAPPEVD 400
RDSLAPSWET PPPYPENGSI QPYPDGGPVP SEMDVPPAHP EEEIVLRSYP 450
ASGHTTPLSR GTYEVGLEDN IGSNTEVFTY NAANKETCEH NHRQCSRHAF 500
CTDYATGFCC HCQSKFYGNG KHCLPEGAPH RVNGKVSGHL HVGHTPVHFT 550
DVDLHAYIVG NDGRAYTAIS HIPQPAAQAL LPLTPIGGLF GWLFALEKPG 600
SENGFSLAGA AFTHDMEVTF YPGEETVRIT QTAEGLDPEN YLSIKTNIQG 650
QVPYVSANFT AHISPYKELY HYSDSTVTST SSRDYSLTFG AINQTWSYRI 700
HQNITYQVCR HAPRHPSFPT TQQLNVDRVF ALYNDEERVL RFAVTNQIGP 750
VKEDSDPTPG NPCYDGSHMC DTTARCHPGT GVDYTCECAS GYQGDGRNCV 800
DENECATGFH RCGPNSVCIN LPGSYRCECR SGYEFADDRH TCILITPPAN 850
PCEDGSHTCA PAGQARCVHH GGSTFSCACL PGYAGDGHQC TDVDECSENR 900
CHPAATCYNT PGSFSCRCQP GYYGDGFQCI PDSTSSLTPC EQQQRHAQAQ 950
YAYPGARFHI PQCDEQGNFL PLQCHGSTGF CWCVDPDGHE VPGTQTPPGS 1000
TPPHCGPSPE PTQRPPTICE RWRENLLEHY GGTPRDDQYV PQCDDLGHFI 1050
PLQCHGKSDF CWCVDKDGRE VQGTRSQPGT TPACIPTVAP PMVRPTPRPD 1100
VTPPSVGTFL LYTQGQQIGY LPLNGTRLQK DAAKTLLSLH GSIIVGIDYD 1150
CRERMVYWTD VAGRTISRAG LELGAEPETI VNSGLISPEG LAIDHIRRTM 1200
YWTDSVLDKI ESALLDGSER KVLFYTDLVN PRAIAVDPIR GNLYWTDWNR 1250
EAPKIETSSL DGENRRILIN TDIGLPNGLT FDPFSKLLCW ADAGTKKLEC 1300
TLPDGTGRRV IQNNLKYPFS IVSYADHFYH TDWRRDGVVS VNKHSGQFTD 1350
EYLPEQRSHL YGITAVYPYC PTGRK 1375
Length:1,375
Mass (Da):151,254
Last modified:March 2, 2010 - v3
Checksum:i198D1F4E286A53E2
GO
Isoform 2 (identifier: Q14112-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-59: Missing.
     844-892: LITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTD → Y

Note: No experimental confirmation available.

Show »
Length:1,274
Mass (Da):140,866
Checksum:iC6E3D787DB40235B
GO

Sequence cautioni

The sequence BAA13087.1 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172.
The sequence BAA24112.1 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti22 – 221P → Q.4 Publications
Corresponds to variant rs3920038 [ dbSNP | Ensembl ].
VAR_062850
Natural varianti313 – 3131D → G.
Corresponds to variant rs17124969 [ dbSNP | Ensembl ].
VAR_055767
Natural varianti354 – 3541P → H.
Corresponds to variant rs35657569 [ dbSNP | Ensembl ].
VAR_055768
Natural varianti453 – 4531G → D.1 Publication
Corresponds to variant rs2101919 [ dbSNP | Ensembl ].
VAR_062851
Natural varianti529 – 5291P → S.
Corresponds to variant rs17831525 [ dbSNP | Ensembl ].
VAR_055769
Natural varianti656 – 6561S → P.4 Publications
Corresponds to variant rs3742536 [ dbSNP | Ensembl ].
VAR_062852
Natural varianti726 – 7261V → M.
Corresponds to variant rs35147930 [ dbSNP | Ensembl ].
VAR_055770
Natural varianti760 – 7601G → V.4 Publications
Corresponds to variant rs2273430 [ dbSNP | Ensembl ].
VAR_062853
Natural varianti775 – 7751R → Q.
Corresponds to variant rs10134590 [ dbSNP | Ensembl ].
VAR_055771
Natural varianti830 – 8301R → Q.
Corresponds to variant rs7144523 [ dbSNP | Ensembl ].
VAR_055772
Natural varianti866 – 8661R → Q.
Corresponds to variant rs28507587 [ dbSNP | Ensembl ].
VAR_055773
Natural varianti1238 – 12381P → S in a breast cancer sample; somatic mutation. 1 Publication
VAR_035836

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei7 – 5953Missing in isoform 2.
VSP_038779Add
BLAST
Alternative sequencei844 – 89249LITPP…HQCTD → Y in isoform 2.
VSP_038780Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti44 – 441G → W in BAA13087. 1 Publication
Sequence conflicti44 – 441G → W in BAA24112. 1 Publication
Sequence conflicti700 – 7001I → T in BAG62181. 1 Publication
Sequence conflicti1242 – 12421N → D in BAF84341. 1 Publication
Sequence conflicti1245 – 12451W → R in BAF84341. 1 Publication
Sequence conflicti1249 – 12491N → D in BAF84341. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ223500 mRNA. Translation: CAA11418.1.
D86425 mRNA. Translation: BAA13087.1. Frameshift.
AB009799 Genomic DNA. Translation: BAA24112.1. Frameshift.
AK300462 mRNA. Translation: BAG62181.1.
AK291652 mRNA. Translation: BAF84341.1.
CCDSiCCDS9706.1. [Q14112-1]
PIRiG00043.
RefSeqiNP_031387.3. NM_007361.3. [Q14112-1]
UniGeneiHs.369840.

Genome annotation databases

EnsembliENST00000216286; ENSP00000216286; ENSG00000087303. [Q14112-1]
ENST00000541773; ENSP00000443730; ENSG00000087303. [Q14112-2]
GeneIDi22795.
KEGGihsa:22795.
UCSCiuc001wzo.3. human. [Q14112-1]
uc010tqs.2. human. [Q14112-2]

Polymorphism databases

DMDMi290457669.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ223500 mRNA. Translation: CAA11418.1 .
D86425 mRNA. Translation: BAA13087.1 . Frameshift.
AB009799 Genomic DNA. Translation: BAA24112.1 . Frameshift.
AK300462 mRNA. Translation: BAG62181.1 .
AK291652 mRNA. Translation: BAF84341.1 .
CCDSi CCDS9706.1. [Q14112-1 ]
PIRi G00043.
RefSeqi NP_031387.3. NM_007361.3. [Q14112-1 ]
UniGenei Hs.369840.

3D structure databases

ProteinModelPortali Q14112.
SMRi Q14112. Positions 487-752, 769-996, 1107-1370.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116476. 8 interactions.
IntActi Q14112. 2 interactions.
MINTi MINT-1183597.
STRINGi 9606.ENSP00000216286.

Protein family/group databases

MEROPSi I63.001.

PTM databases

PhosphoSitei Q14112.

Polymorphism databases

DMDMi 290457669.

Proteomic databases

MaxQBi Q14112.
PaxDbi Q14112.
PRIDEi Q14112.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000216286 ; ENSP00000216286 ; ENSG00000087303 . [Q14112-1 ]
ENST00000541773 ; ENSP00000443730 ; ENSG00000087303 . [Q14112-2 ]
GeneIDi 22795.
KEGGi hsa:22795.
UCSCi uc001wzo.3. human. [Q14112-1 ]
uc010tqs.2. human. [Q14112-2 ]

Organism-specific databases

CTDi 22795.
GeneCardsi GC14M052471.
H-InvDB HIX0026668.
HGNCi HGNC:13389. NID2.
HPAi HPA052460.
MIMi 605399. gene.
neXtProti NX_Q14112.
PharmGKBi PA31626.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG282695.
HOGENOMi HOG000072712.
HOVERGENi HBG006498.
InParanoidi Q14112.
KOi K06826.
OMAi ARVGFCR.
OrthoDBi EOG7M0NQN.
PhylomeDBi Q14112.
TreeFami TF320666.

Enzyme and pathway databases

Reactomei REACT_169262. Laminin interactions.

Miscellaneous databases

ChiTaRSi NID2. human.
GeneWikii NID2.
GenomeRNAii 22795.
NextBioi 43128.
PROi Q14112.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q14112.
Bgeei Q14112.
CleanExi HS_NID2.
Genevestigatori Q14112.

Family and domain databases

Gene3Di 2.120.10.30. 1 hit.
2.40.155.10. 2 hits.
4.10.800.10. 2 hits.
InterProi IPR011042. 6-blade_b-propeller_TolB-like.
IPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR024731. EGF_dom_MSP1-like.
IPR006605. G2_nidogen/fibulin_G2F.
IPR009017. GFP.
IPR023413. GFP_like.
IPR009030. Growth_fac_rcpt_N_dom.
IPR000033. LDLR_classB_rpt.
IPR003886. Nidogen_extracell_dom.
IPR000716. Thyroglobulin_1.
[Graphical view ]
Pfami PF12662. cEGF. 1 hit.
PF12947. EGF_3. 1 hit.
PF07645. EGF_CA. 1 hit.
PF07474. G2F. 1 hit.
PF00058. Ldl_recept_b. 2 hits.
PF06119. NIDO. 1 hit.
PF00086. Thyroglobulin_1. 2 hits.
[Graphical view ]
SMARTi SM00181. EGF. 3 hits.
SM00179. EGF_CA. 2 hits.
SM00682. G2F. 1 hit.
SM00135. LY. 5 hits.
SM00539. NIDO. 1 hit.
SM00211. TY. 2 hits.
[Graphical view ]
SUPFAMi SSF54511. SSF54511. 1 hit.
SSF57184. SSF57184. 2 hits.
SSF57610. SSF57610. 2 hits.
PROSITEi PS00010. ASX_HYDROXYL. 3 hits.
PS01186. EGF_2. 4 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 2 hits.
PS51120. LDLRB. 4 hits.
PS51220. NIDO. 1 hit.
PS50993. NIDOGEN_G2. 1 hit.
PS00484. THYROGLOBULIN_1_1. 2 hits.
PS51162. THYROGLOBULIN_1_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Nidogen-2: a new basement membrane protein with diverse binding properties."
    Kohfeldt E., Sasaki T., Goehring W., Timpl R.
    J. Mol. Biol. 282:99-109(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF N-TERMINUS, VARIANTS GLN-22; ASP-453; PRO-656 AND VAL-760.
  2. "The cloning and characterization of a cDNA for the novel bone matrix protein: osteonidogen."
    Ohno I., Hashimoto J., Takaoka K., Ochi T., Okubo K., Matsubara K.
    Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS GLN-22; PRO-656 AND VAL-760.
    Tissue: Cancellous bone.
  3. "Human osteonidogen gene: intron-exon junctions and chromosomal localization."
    Ohno I., Okubo K., Matsubara K.
    Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANTS GLN-22; PRO-656 AND VAL-760.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS GLN-22; PRO-656; VAL-760 AND VAL-760.
    Tissue: Placenta.
  5. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin."
    Tu H., Sasaki T., Snellman A., Gohring W., Pirila P., Timpl R., Pihlajaniemi T.
    J. Biol. Chem. 277:23092-23099(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH COL13A1.
  7. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1124.
    Tissue: Liver.
  8. Cited for: VARIANT [LARGE SCALE ANALYSIS] SER-1238.

Entry informationi

Entry nameiNID2_HUMAN
AccessioniPrimary (citable) accession number: Q14112
Secondary accession number(s): A8K6I7, B4DU19, O43710
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: March 2, 2010
Last modified: September 3, 2014
This is version 142 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi