Q14112 (NID2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nidogen-2 Short name=NID-2 Alternative name(s): Osteonidogen | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1375 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cell adhesion glycoprotein which is widely distributed in basement membranes. Binds to collagens I and IV, to perlecan and to laminin 1. Does not bind fibulins. It probably has a role in cell-extracellular matrix interactions. |
| Subunit structure | Interacts with LAMA2 By similarity. Interacts with COL13A1. Ref.6 |
| Subcellular location | Secreted › extracellular space › extracellular matrix › basement membrane. |
| Tissue specificity | Heart, placenta and bone. Less in pancreas, kidney and skeletal muscle. |
| Post-translational modification | Highly N- and O-glycosylated. Ref.7 |
| Sequence similarities | Contains 5 EGF-like domains. Contains 5 LDL-receptor class B repeats. Contains 1 NIDO domain. Contains 1 nidogen G2 beta-barrel domain. Contains 2 thyroglobulin type-1 domains. |
| Sequence caution | The sequence BAA13087.1 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172. The sequence BAA24112.1 differs from that shown. Reason: Frameshift at positions 54, 68, 150 and 172. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Basement membrane Extracellular matrix Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | EGF-like domain Repeat Signal |
| Ligand | Calcium |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | basement membrane Traceable author statement. Source: ProtInc |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: InterPro collagen bindingTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q14112-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q14112-2) The sequence of this isoform differs from the canonical sequence as follows: 7-59: Missing. 844-892: LITPPANPCEDGSHTCAPAGQARCVHHGGSTFSCACLPGYAGDGHQCTD → Y | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 30 | 30 | |||||||||
| Chain | 31 – 1375 | 1345 | Nidogen-2 | PRO_0000007671 | |||||||
Regions | |||||||||||
| Domain | 108 – 273 | 166 | NIDO | ||||||||
| Domain | 484 – 524 | 41 | EGF-like 1 | ||||||||
| Domain | 528 – 758 | 231 | Nidogen G2 beta-barrel | ||||||||
| Domain | 759 – 800 | 42 | EGF-like 2 | ||||||||
| Domain | 801 – 843 | 43 | EGF-like 3; calcium-binding Potential | ||||||||
| Domain | 848 – 891 | 44 | EGF-like 4 | ||||||||
| Domain | 892 – 930 | 39 | EGF-like 5; calcium-binding Potential | ||||||||
| Domain | 937 – 1005 | 69 | Thyroglobulin type-1 1 | ||||||||
| Domain | 1016 – 1084 | 69 | Thyroglobulin type-1 2 | ||||||||
| Repeat | 1154 – 1197 | 44 | LDL-receptor class B 1 | ||||||||
| Repeat | 1198 – 1240 | 43 | LDL-receptor class B 2 | ||||||||
| Repeat | 1241 – 1285 | 45 | LDL-receptor class B 3 | ||||||||
| Repeat | 1286 – 1327 | 42 | LDL-receptor class B 4 | ||||||||
| Repeat | 1329 – 1373 | 45 | LDL-receptor class B 5 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 417 | 1 | N-linked (GlcNAc...) Probable | ||||||||
| Glycosylation | 658 | 1 | N-linked (GlcNAc...) Probable | ||||||||
| Glycosylation | 693 | 1 | N-linked (GlcNAc...) Probable | ||||||||
| Glycosylation | 703 | 1 | N-linked (GlcNAc...) Probable | ||||||||
| Glycosylation | 1124 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Disulfide bond | 763 ↔ 776 | By similarity | |||||||||
| Disulfide bond | 770 ↔ 786 | By similarity | |||||||||
| Disulfide bond | 788 ↔ 799 | By similarity | |||||||||
| Disulfide bond | 805 ↔ 818 | By similarity | |||||||||
| Disulfide bond | 812 ↔ 827 | By similarity | |||||||||
| Disulfide bond | 829 ↔ 842 | By similarity | |||||||||
| Disulfide bond | 852 ↔ 867 | By similarity | |||||||||
| Disulfide bond | 859 ↔ 877 | By similarity | |||||||||
| Disulfide bond | 879 ↔ 890 | By similarity | |||||||||
| Disulfide bond | 896 ↔ 907 | By similarity | |||||||||
| Disulfide bond | 901 ↔ 916 | By similarity | |||||||||
| Disulfide bond | 918 ↔ 929 | By similarity | |||||||||
| Disulfide bond | 940 ↔ 963 | By similarity | |||||||||
| Disulfide bond | 974 ↔ 981 | By similarity | |||||||||
| Disulfide bond | 983 ↔ 1005 | By similarity | |||||||||
| Disulfide bond | 1019 ↔ 1043 | By similarity | |||||||||
| Disulfide bond | 1054 ↔ 1061 | By similarity | |||||||||
| Disulfide bond | 1063 ↔ 1084 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 7 – 59 | 53 | Missing in isoform 2. | VSP_038779 | |||||||
| Alternative sequence | 844 – 892 | 49 | LITPP…HQCTD → Y in isoform 2. | VSP_038780 | |||||||
| Natural variant | 22 | 1 | P → Q. Ref.1 Ref.2 Ref.3 Ref.4 Corresponds to variant rs3920038 [ dbSNP | Ensembl ]. | VAR_062850 | |||||||
| Natural variant | 313 | 1 | D → G. Corresponds to variant rs17124969 [ dbSNP | Ensembl ]. | VAR_055767 | |||||||
| Natural variant | 354 | 1 | P → H. Corresponds to variant rs35657569 [ dbSNP | Ensembl ]. | VAR_055768 | |||||||
| Natural variant | 453 | 1 | G → D. Ref.1 Corresponds to variant rs2101919 [ dbSNP | Ensembl ]. | VAR_062851 | |||||||
| Natural variant | 529 | 1 | P → S. Corresponds to variant rs17831525 [ dbSNP | Ensembl ]. | VAR_055769 | |||||||
| Natural variant | 656 | 1 | S → P. Ref.1 Ref.2 Ref.3 Ref.4 Corresponds to variant rs3742536 [ dbSNP | Ensembl ]. | VAR_062852 | |||||||
| Natural variant | 726 | 1 | V → M. Corresponds to variant rs35147930 [ dbSNP | Ensembl ]. | VAR_055770 | |||||||
| Natural variant | 760 | 1 | G → V. Ref.1 Ref.2 Ref.3 Ref.4 Corresponds to variant rs2273430 [ dbSNP | Ensembl ]. | VAR_062853 | |||||||
| Natural variant | 775 | 1 | R → Q. Corresponds to variant rs10134590 [ dbSNP | Ensembl ]. | VAR_055771 | |||||||
| Natural variant | 830 | 1 | R → Q. Corresponds to variant rs7144523 [ dbSNP | Ensembl ]. | VAR_055772 | |||||||
| Natural variant | 866 | 1 | R → Q. Corresponds to variant rs28507587 [ dbSNP | Ensembl ]. | VAR_055773 | |||||||
| Natural variant | 1238 | 1 | P → S in a breast cancer sample; somatic mutation. Ref.8 | VAR_035836 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 44 | 1 | G → W in BAA13087. Ref.2 | ||||||||
| Sequence conflict | 44 | 1 | G → W in BAA24112. Ref.3 | ||||||||
| Sequence conflict | 700 | 1 | I → T in BAG62181. Ref.4 | ||||||||
| Sequence conflict | 1242 | 1 | N → D in BAF84341. Ref.4 | ||||||||
| Sequence conflict | 1245 | 1 | W → R in BAF84341. Ref.4 | ||||||||
| Sequence conflict | 1249 | 1 | N → D in BAF84341. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Nidogen-2: a new basement membrane protein with diverse binding properties." Kohfeldt E., Sasaki T., Goehring W., Timpl R. J. Mol. Biol. 282:99-109(1998) [PubMed: 9733643] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF N-TERMINUS, VARIANTS GLN-22; ASP-453; PRO-656 AND VAL-760. |
| [2] | "The cloning and characterization of a cDNA for the novel bone matrix protein: osteonidogen." Ohno I., Hashimoto J., Takaoka K., Ochi T., Okubo K., Matsubara K. Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS GLN-22; PRO-656 AND VAL-760. Tissue: Cancellous bone. |
| [3] | "Human osteonidogen gene: intron-exon junctions and chromosomal localization." Ohno I., Okubo K., Matsubara K. Submitted (JAN-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), VARIANTS GLN-22; PRO-656 AND VAL-760. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS GLN-22; PRO-656; VAL-760 AND VAL-760. Tissue: Placenta. |
| [5] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed: 12508121] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The type XIII collagen ectodomain is a 150-nm rod and capable of binding to fibronectin, nidogen-2, perlecan, and heparin." Tu H., Sasaki T., Snellman A., Gohring W., Pirila P., Timpl R., Pihlajaniemi T. J. Biol. Chem. 277:23092-23099(2002) [PubMed: 11956183] [Abstract] Cited for: INTERACTION WITH COL13A1. |
| [7] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1124, MASS SPECTROMETRY. Tissue: Liver. |
| [8] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] SER-1238. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ223500 mRNA. Translation: CAA11418.1. D86425 mRNA. Translation: BAA13087.1. Frameshift. AB009799 Genomic DNA. Translation: BAA24112.1. Frameshift. AK300462 mRNA. Translation: BAG62181.1. AK291652 mRNA. Translation: BAF84341.1. |
| IPI | IPI00028908. IPI00955436. |
| PIR | G00043. |
| RefSeq | NP_031387.3. NM_007361.3. |
| UniGene | Hs.369840. |
3D structure databases | |
| ProteinModelPortal | Q14112. |
| SMR | Q14112. Positions 487-752, 759-930, 983-1373. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1183597. |
| STRING | Q14112. |
PTM databases | |
| PhosphoSite | Q14112. |
Polymorphism databases | |
| DMDM | 290457669. |
Proteomic databases | |
| PRIDE | Q14112. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000216286; ENSP00000216286; ENSG00000087303. |
| GeneID | 22795. |
| KEGG | hsa:22795. |
| UCSC | uc001wzo.1. human. |
Organism-specific databases | |
| CTD | 22795. |
| GeneCards | GC14M052471. |
| H-InvDB | HIX0026668. |
| HGNC | HGNC:13389. NID2. |
| MIM | 605399. gene. |
| neXtProt | NX_Q14112. |
| PharmGKB | PA31626. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11227. |
| GeneTree | ENSGT00580000081234. |
| HOGENOM | HBG715409. |
| HOVERGEN | HBG006498. |
| InParanoid | Q14112. |
| OMA | QDFPRET. |
| OrthoDB | EOG4VMFDH. |
| PhylomeDB | Q14112. |
Gene expression databases | |
| ArrayExpress | Q14112. |
| Bgee | Q14112. |
| CleanEx | HS_NID2. |
| Genevestigator | Q14112. |
| GermOnline | ENSG00000087303. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011042. 6-blade_b-propeller_TolB-like. IPR006210. EGF-like. IPR001881. EGF-like_Ca-bd. IPR013032. EGF-like_reg_CS. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR000742. EGF_3. IPR018097. EGF_Ca-bd_CS. IPR024731. EGF_dom_MSP1-like. IPR006605. G2_nidogen/fibulin_G2F. IPR009017. Green_fluorescent_prot-like. IPR000033. LDLR_classB_rpt. IPR003886. Nidogen_extracell_dom. IPR000716. Thyroglobulin_1. [Graphical view] |
| Gene3D | G3DSA:2.120.10.30. 6-blade_b-propeller_TolB-like. 1 hit. G3DSA:4.10.800.10. Thyroglobulin_1. 2 hits. |
| KO | K06826. |
| Pfam | PF12947. EGF_3. 1 hit. PF07645. EGF_CA. 1 hit. PF07474. G2F. 1 hit. PF00058. Ldl_recept_b. 2 hits. PF06119. NIDO. 1 hit. PF00086. Thyroglobulin_1. 2 hits. [Graphical view] |
| SMART | SM00181. EGF. 3 hits. SM00179. EGF_CA. 2 hits. SM00682. G2F. 1 hit. SM00135. LY. 5 hits. SM00539. NIDO. 1 hit. SM00211. TY. 2 hits. [Graphical view] |
| SUPFAM | SSF54511. GFP_like. 1 hit. SSF57610. Thyroglobulin_1. 2 hits. |
| PROSITE | PS00010. ASX_HYDROXYL. 3 hits. PS01186. EGF_2. 4 hits. PS50026. EGF_3. 4 hits. PS01187. EGF_CA. 2 hits. PS51120. LDLRB. 4 hits. PS51220. NIDO. 1 hit. PS50993. NIDOGEN_G2. 1 hit. PS00484. THYROGLOBULIN_1_1. 2 hits. PS51162. THYROGLOBULIN_1_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 43128. |
| SOURCE | Search... |
Entry information
| Entry name | NID2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q14112 Secondary accession number(s): A8K6I7, B4DU19, O43710 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with