Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-I

Gene

CCNI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Biological processi

  • regulation of cell cycle Source: InterPro
  • spermatogenesis Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Cyclin

Enzyme and pathway databases

SignaLinkiQ14094.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-I
Gene namesi
Name:CCNI
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:1595. CCNI.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26160.

Polymorphism and mutation databases

BioMutaiCCNI.
DMDMi9296954.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 377377Cyclin-IPRO_0000080476Add
BLAST

Proteomic databases

MaxQBiQ14094.
PaxDbiQ14094.
PRIDEiQ14094.

PTM databases

iPTMnetiQ14094.
PhosphoSiteiQ14094.

Expressioni

Tissue specificityi

Highest levels in adult heart, brain and skeletal muscle. Lower levels in adult placenta, lung, kidney and pancreas. Also high levels in fetal brain and lower levels in fetal lung, liver and kidney. Also abundant in testis and thyroid.1 Publication

Developmental stagei

Expression is independent of the cell cycle in lung fibroblasts.1 Publication

Gene expression databases

BgeeiQ14094.
CleanExiHS_CCNI.
ExpressionAtlasiQ14094. baseline and differential.
GenevisibleiQ14094. HS.

Organism-specific databases

HPAiCAB010206.
HPA039853.
HPA061470.

Interactioni

Protein-protein interaction databases

BioGridi116179. 8 interactions.
IntActiQ14094. 8 interactions.
STRINGi9606.ENSP00000237654.

Structurei

3D structure databases

ProteinModelPortaliQ14094.
SMRiQ14094. Positions 38-256.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cyclin family.Curated

Phylogenomic databases

eggNOGiKOG0653. Eukaryota.
COG5024. LUCA.
GeneTreeiENSGT00530000062971.
HOVERGENiHBG050841.
InParanoidiQ14094.
OMAiKYLNCIA.
OrthoDBiEOG74N5GQ.
PhylomeDBiQ14094.
TreeFamiTF101007.

Family and domain databases

Gene3Di1.10.472.10. 2 hits.
InterProiIPR013763. Cyclin-like.
IPR028856. Cyclin_I.
IPR006671. Cyclin_N.
[Graphical view]
PANTHERiPTHR10177:SF187. PTHR10177:SF187. 1 hit.
PfamiPF00134. Cyclin_N. 1 hit.
[Graphical view]
SMARTiSM00385. CYCLIN. 1 hit.
[Graphical view]
SUPFAMiSSF47954. SSF47954. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q14094-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKFPGPLENQ RLSFLLEKAI TREAQMWKVN VRKMPSNQNV SPSQRDEVIQ
60 70 80 90 100
WLAKLKYQFN LYPETFALAS SLLDRFLATV KAHPKYLSCI AISCFFLAAK
110 120 130 140 150
TVEEDERIPV LKVLARDSFC GCSSSEILRM ERIILDKLNW DLHTATPLDF
160 170 180 190 200
LHIFHAIAVS TRPQLLFSLP KLSPSQHLAV LTKQLLHCMA CNQLLQFRGS
210 220 230 240 250
MLALAMVSLE MEKLIPDWLS LTIELLQKAQ MDSSQLIHCR ELVAHHLSTL
260 270 280 290 300
QSSLPLNSVY VYRPLKHTLV TCDKGVFRLH PSSVPGPDFS KDNSKPEVPV
310 320 330 340 350
RGTAAFYHHL PAASGCKQTS TKRKVEEMEV DDFYDGIKRL YNEDNVSENV
360 370
GSVCGTDLSR QEGHASPCPP LQPVSVM
Length:377
Mass (Da):42,557
Last modified:November 1, 1996 - v1
Checksum:i2DE84EFA74698F6C
GO
Isoform 2 (identifier: Q14094-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MKFPGPLENQRLSFLLEKAITREAQMWKVNVRKMPSNQ → MTPRHHCEAYSSAGEEEEEEEEEK

Note: No experimental confirmation available.
Show »
Length:363
Mass (Da):40,877
Checksum:i60E38FDDF5FD108C
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti9 – 91N → D no nucleotide entry (PubMed:9705831).Curated
Sequence conflicti58 – 581Q → R no nucleotide entry (PubMed:9705831).Curated
Sequence conflicti75 – 751R → G no nucleotide entry (PubMed:9705831).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti207 – 2071V → I.1 Publication
Corresponds to variant rs4252903 [ dbSNP | Ensembl ].
VAR_016312

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3838MKFPG…MPSNQ → MTPRHHCEAYSSAGEEEEEE EEEK in isoform 2. 1 PublicationVSP_056682Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50310 mRNA. Translation: BAA08849.1.
AF135162 mRNA. Translation: AAF43786.1.
BT020019 mRNA. Translation: AAV38822.1.
AY207372 Genomic DNA. Translation: AAO13492.1.
AK301111 mRNA. Translation: BAH13410.1.
AK312632 mRNA. Translation: BAG35517.1.
AC104771 Genomic DNA. No translation available.
AC111196 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX05808.1.
BC000420 mRNA. Translation: AAH00420.1.
BC004975 mRNA. Translation: AAH04975.1.
CCDSiCCDS3580.1. [Q14094-1]
PIRiJE0264.
RefSeqiNP_006826.1. NM_006835.2. [Q14094-1]
UniGeneiHs.518827.

Genome annotation databases

EnsembliENST00000237654; ENSP00000237654; ENSG00000118816. [Q14094-1]
GeneIDi10983.
KEGGihsa:10983.
UCSCiuc003hkm.5. human. [Q14094-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50310 mRNA. Translation: BAA08849.1.
AF135162 mRNA. Translation: AAF43786.1.
BT020019 mRNA. Translation: AAV38822.1.
AY207372 Genomic DNA. Translation: AAO13492.1.
AK301111 mRNA. Translation: BAH13410.1.
AK312632 mRNA. Translation: BAG35517.1.
AC104771 Genomic DNA. No translation available.
AC111196 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX05808.1.
BC000420 mRNA. Translation: AAH00420.1.
BC004975 mRNA. Translation: AAH04975.1.
CCDSiCCDS3580.1. [Q14094-1]
PIRiJE0264.
RefSeqiNP_006826.1. NM_006835.2. [Q14094-1]
UniGeneiHs.518827.

3D structure databases

ProteinModelPortaliQ14094.
SMRiQ14094. Positions 38-256.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116179. 8 interactions.
IntActiQ14094. 8 interactions.
STRINGi9606.ENSP00000237654.

PTM databases

iPTMnetiQ14094.
PhosphoSiteiQ14094.

Polymorphism and mutation databases

BioMutaiCCNI.
DMDMi9296954.

Proteomic databases

MaxQBiQ14094.
PaxDbiQ14094.
PRIDEiQ14094.

Protocols and materials databases

DNASUi10983.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000237654; ENSP00000237654; ENSG00000118816. [Q14094-1]
GeneIDi10983.
KEGGihsa:10983.
UCSCiuc003hkm.5. human. [Q14094-1]

Organism-specific databases

CTDi10983.
GeneCardsiCCNI.
HGNCiHGNC:1595. CCNI.
HPAiCAB010206.
HPA039853.
HPA061470.
neXtProtiNX_Q14094.
PharmGKBiPA26160.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0653. Eukaryota.
COG5024. LUCA.
GeneTreeiENSGT00530000062971.
HOVERGENiHBG050841.
InParanoidiQ14094.
OMAiKYLNCIA.
OrthoDBiEOG74N5GQ.
PhylomeDBiQ14094.
TreeFamiTF101007.

Enzyme and pathway databases

SignaLinkiQ14094.

Miscellaneous databases

ChiTaRSiCCNI. human.
GeneWikiiCCNI_(gene).
GenomeRNAii10983.
PROiQ14094.

Gene expression databases

BgeeiQ14094.
CleanExiHS_CCNI.
ExpressionAtlasiQ14094. baseline and differential.
GenevisibleiQ14094. HS.

Family and domain databases

Gene3Di1.10.472.10. 2 hits.
InterProiIPR013763. Cyclin-like.
IPR028856. Cyclin_I.
IPR006671. Cyclin_N.
[Graphical view]
PANTHERiPTHR10177:SF187. PTHR10177:SF187. 1 hit.
PfamiPF00134. Cyclin_N. 1 hit.
[Graphical view]
SMARTiSM00385. CYCLIN. 1 hit.
[Graphical view]
SUPFAMiSSF47954. SSF47954. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cyclin I: a new cyclin encoded by a gene isolated from human brain."
    Nakamura T., Sanokawa R., Sasaki Y.F., Ayusawa D., Oishi M., Mori N.
    Exp. Cell Res. 221:534-542(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Forebrain cortex.
  2. "Isolating a new cDNA coding for human cyclin protein."
    Chen J.H., Luo W.Q., Zhou Y., Zhou H.J., Huang X.W., Yuan J.G., Qiang B.Q.
    Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. NIEHS SNPs program
    Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ILE-207.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Spleen.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney and Muscle.
  9. "Expression of a novel isoform of cyclin I in human testis."
    Zhu X., Naz R.K.
    Biochem. Biophys. Res. Commun. 249:56-60(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-178 (ISOFORM 1).
    Tissue: Testis.

Entry informationi

Entry nameiCCNI_HUMAN
AccessioniPrimary (citable) accession number: Q14094
Secondary accession number(s): B2R6M0, B7Z6X4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: November 1, 1996
Last modified: June 8, 2016
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.