Q13946 (PDE7A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A EC=3.1.4.17 Alternative name(s): HCP1 TM22 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 482 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction. Ref.9 |
| Catalytic activity | Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate. |
| Cofactor | Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions. Ref.9 |
| Enzyme regulation | Insensitive to all selective PDE inhibitors. |
| Pathway | Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1. |
| Subunit structure | Interacts with CBFA2T3. Ref.7 |
| Subcellular location | Isoform PDE7A1: Cytoplasm › cytosol. Note: PDE7A1 (57 kDa) is located mostly to soluble cellular fractions. Isoform PDE7A2: Cytoplasm. Note: PDE7A2 (50 kDa) is located to particulate cellular fractions. |
| Tissue specificity | PDE7A1 is found at high levels in skeletal muscle and at low levels in a variety of tissues including brain and heart. It is expressed as well in two T-cell lines. PDE7A2 is found abundantly in skeletal muscle and at low levels in heart. |
| Developmental stage | Developmentally regulated. PDE7A1 and PDE7A2 are found in several fetal tissues, expression is reduced throughout development. It persists strongly only in adult skeletal muscle. |
| Domain | Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. PDE7 subfamily. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Metal-binding cAMP |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cell fraction Non-traceable author statement. Source: UniProtKB cytosolTraceable author statement. Source: Reactome |
| Molecular function | 3',5'-cyclic-AMP phosphodiesterase activity Traceable author statement Ref.1. Source: UniProtKB metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PDE7A1 (identifier: Q13946-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PDE7A2 (identifier: Q13946-2) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQ → MGITLIWCLALVLIKWITSK | ||||||
| Isoform PDE7A3 (identifier: Q13946-3) The sequence of this isoform differs from the canonical sequence as follows: 416-424: FMTYLVEPL → NYTYLDIAG 425-482: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 482 | 482 | High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A | PRO_0000198833 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 187 – 451 | 265 | Catalytic By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 28 – 33 | 6 | Poly-Ser | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 212 | 1 | Proton donor By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 216 | 1 | Divalent metal cation 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 252 | 1 | Divalent metal cation 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 253 | 1 | Divalent metal cation 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 253 | 1 | Divalent metal cation 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 362 | 1 | Divalent metal cation 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 84 | 1 | Phosphoserine Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 46 | 46 | MEVCY…RQLSQ → MGITLIWCLALVLIKWITSK in isoform PDE7A2. | VSP_004593 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 416 – 424 | 9 | FMTYLVEPL → NYTYLDIAG in isoform PDE7A3. | VSP_038645 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 425 – 482 | 58 | Missing in isoform PDE7A3. | VSP_038646 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 76 | 1 | G → E. Corresponds to variant rs11557049 [ dbSNP | Ensembl ]. | VAR_056661 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 204 | 1 | D → G in BAF83490. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 140 – 148 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 149 – 152 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 158 – 164 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 169 – 180 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 183 – 186 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 191 – 203 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 209 – 213 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 214 – 228 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 231 – 234 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 239 – 251 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 252 – 255 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 261 – 266 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 270 – 274 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 275 – 277 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 280 – 296 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 297 – 301 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 304 – 319 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 323 – 325 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 326 – 339 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 347 – 362 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 365 – 367 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 370 – 393 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 404 – 406 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 409 – 419 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 421 – 431 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 435 – 453 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of a previously undetected human cAMP phosphodiesterase by complementation of cAMP phosphodiesterase-deficient Saccharomyces cerevisiae." Michaeli T., Bloom T.J., Martins T., Loughney K., Ferguson K., Riggs M., Rodgers L., Beavo J.A., Wigler M. J. Biol. Chem. 268:12925-12932(1993) [PubMed: 8389765] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE7A1). |
| [2] | "Alternative splicing of the high affinity cAMP-specific phosphodiesterase (PDE7A) mRNA in human skeletal muscle and heart." Han P., Zhu X., Michaeli T. J. Biol. Chem. 272:16152-16157(1997) [PubMed: 9195912] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE7A2). Tissue: Skeletal muscle. |
| [3] | "T cell activation up-regulates cyclic nucleotide phosphodiesterases 8A1 and 7A3." Glavas N.A., Ostenson C., Schaefer J.B., Vasta V., Beavo J.A. Proc. Natl. Acad. Sci. U.S.A. 98:6319-6324(2001) [PubMed: 11371644] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE7A3). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE7A1). Tissue: Kidney and Thymus. |
| [5] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE7A2). |
| [7] | "A-kinase anchoring proteins interact with phosphodiesterases in T lymphocyte cell lines." Asirvatham A.L., Galligan S.G., Schillace R.V., Davey M.P., Vasta V., Beavo J.A., Carr D.W. J. Immunol. 173:4806-4814(2004) [PubMed: 15470020] [Abstract] Cited for: INTERACTION WITH CBFA2T3. |
| [8] | "Multiple elements jointly determine inhibitor selectivity of cyclic nucleotide phosphodiesterases 4 and 7." Wang H., Liu Y., Chen Y., Robinson H., Ke H. J. Biol. Chem. 280:30949-30955(2005) [PubMed: 15994308] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.67 ANGSTROMS) OF 130-482 IN COMPLEX WITH METAL IONS AND THE INHIBITOR IBMX. |
| [9] | "Synthesis, structural analysis, and biological evaluation of thioxoquinazoline derivatives as phosphodiesterase 7 inhibitors." Castano T., Wang H., Campillo N.E., Ballester S., Gonzalez-Garcia C., Hernandez J., Perez C., Cuenca J., Perez-Castillo A., Martinez A., Huertas O., Gelpi J.L., Luque F.J., Ke H., Gil C. ChemMedChem 4:866-876(2009) [PubMed: 19350606] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.40 ANGSTROMS) OF 139-456 IN COMPLEX WITH METAL IONS, FUNCTION, COFACTOR. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L12052 mRNA. Translation: AAA35644.2. U67932 mRNA. Translation: AAB65772.1. AF332652 mRNA. Translation: AAK57640.1. AK290801 mRNA. Translation: BAF83490.1. AK292680 mRNA. Translation: BAF85369.1. AC055822 Genomic DNA. No translation available. AC100812 Genomic DNA. No translation available. BC126360 mRNA. Translation: AAI26361.1. | ||||||||||||||||||
| IPI | IPI00183153. IPI00217833. IPI00219721. | ||||||||||||||||||
| RefSeq | NP_001229247.1. NM_001242318.2. NP_002594.1. NM_002603.3. | ||||||||||||||||||
| UniGene | Hs.527119. Hs.728847. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q13946. | ||||||||||||||||||
| SMR | Q13946. Positions 77-457. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q13946. 1 interaction. | ||||||||||||||||||
| STRING | Q13946. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q13946. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 3182958. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q13946. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000379419; ENSP00000368730; ENSG00000205268. ENST00000396642; ENSP00000379881; ENSG00000205268. ENST00000401827; ENSP00000385632; ENSG00000205268. | ||||||||||||||||||
| GeneID | 5150. | ||||||||||||||||||
| KEGG | hsa:5150. | ||||||||||||||||||
| UCSC | uc003xvp.1. human. uc003xvq.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 5150. | ||||||||||||||||||
| GeneCards | GC08M066629. | ||||||||||||||||||
| HGNC | HGNC:8791. PDE7A. | ||||||||||||||||||
| HPA | CAB018770. HPA027340. | ||||||||||||||||||
| MIM | 171885. gene. | ||||||||||||||||||
| neXtProt | NX_Q13946. | ||||||||||||||||||
| PharmGKB | PA33139. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG05611. | ||||||||||||||||||
| GeneTree | ENSGT00590000082915. | ||||||||||||||||||
| HOGENOM | HBG403038. | ||||||||||||||||||
| HOVERGEN | HBG053543. | ||||||||||||||||||
| InParanoid | Q13946. | ||||||||||||||||||
| OMA | GLNKASW. | ||||||||||||||||||
| OrthoDB | EOG48KRBC. | ||||||||||||||||||
| PhylomeDB | Q13946. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q13946. | ||||||||||||||||||
| Bgee | Q13946. | ||||||||||||||||||
| CleanEx | HS_PDE7A. | ||||||||||||||||||
| Genevestigator | Q13946. | ||||||||||||||||||
| GermOnline | ENSG00000205268. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR003607. Metal-dep_PHydrolase_HD_dom. IPR023088. PDEase. IPR002073. PDEase_catalytic_dom. IPR023174. PDEase_CS. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:1.10.1300.10. PDEase_catalytic_dom. 1 hit. | ||||||||||||||||||
| KO | K01120. | ||||||||||||||||||
| Pfam | PF00233. PDEase_I. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00387. PDIESTERASE1. | ||||||||||||||||||
| SMART | SM00471. HDc. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| DrugBank | DB00651. Dyphylline. DB00920. Ketotifen. | ||||||||||||||||||
| NextBio | 19872. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | PDE7A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13946 Secondary accession number(s): A0AVH6 Q96T72 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with