Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13946

- PDE7A_HUMAN

UniProt

Q13946 - PDE7A_HUMAN

Protein

High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A

Gene

PDE7A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 140 (01 Oct 2014)
      Sequence version 2 (15 Jul 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction.1 Publication

    Catalytic activityi

    Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.

    Cofactori

    Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.1 Publication

    Enzyme regulationi

    Insensitive to all selective PDE inhibitors.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei212 – 2121Proton donorBy similarity
    Metal bindingi216 – 2161Divalent metal cation 1
    Metal bindingi252 – 2521Divalent metal cation 1
    Metal bindingi253 – 2531Divalent metal cation 1
    Metal bindingi253 – 2531Divalent metal cation 2
    Metal bindingi362 – 3621Divalent metal cation 1

    GO - Molecular functioni

    1. 3',5'-cyclic-AMP phosphodiesterase activity Source: UniProtKB
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. cAMP catabolic process Source: UniProtKB-UniPathway
    2. signal transduction Source: InterPro

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    cAMP, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_19327. G alpha (s) signalling events.
    UniPathwayiUPA00762; UER00747.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (EC:3.1.4.53)
    Alternative name(s):
    HCP1
    TM22
    Gene namesi
    Name:PDE7A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:8791. PDE7A.

    Subcellular locationi

    Isoform PDE7A1 : Cytoplasmcytosol
    Note: PDE7A1 (57 kDa) is located mostly to soluble cellular fractions.
    Isoform PDE7A2 : Cytoplasm
    Note: PDE7A2 (50 kDa) is located to particulate cellular fractions.

    GO - Cellular componenti

    1. cytosol Source: Reactome

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33139.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 482482High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7APRO_0000198833Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei84 – 841PhosphoserineSequence Analysis

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ13946.
    PaxDbiQ13946.
    PRIDEiQ13946.

    PTM databases

    PhosphoSiteiQ13946.

    Expressioni

    Tissue specificityi

    PDE7A1 is found at high levels in skeletal muscle and at low levels in a variety of tissues including brain and heart. It is expressed as well in two T-cell lines. PDE7A2 is found abundantly in skeletal muscle and at low levels in heart.

    Developmental stagei

    Developmentally regulated. PDE7A1 and PDE7A2 are found in several fetal tissues, expression is reduced throughout development. It persists strongly only in adult skeletal muscle.

    Gene expression databases

    ArrayExpressiQ13946.
    BgeeiQ13946.
    CleanExiHS_PDE7A.
    GenevestigatoriQ13946.

    Organism-specific databases

    HPAiCAB018770.
    HPA027340.

    Interactioni

    Subunit structurei

    Interacts with CBFA2T3.3 Publications

    Protein-protein interaction databases

    BioGridi111176. 1 interaction.
    IntActiQ13946. 1 interaction.
    STRINGi9606.ENSP00000368730.

    Structurei

    Secondary structure

    1
    482
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi140 – 1489
    Turni149 – 1524
    Helixi158 – 1647
    Helixi169 – 18012
    Helixi183 – 1864
    Helixi191 – 20313
    Beta strandi209 – 2135
    Helixi214 – 22815
    Helixi231 – 2344
    Helixi239 – 25113
    Turni252 – 2554
    Helixi261 – 2666
    Helixi270 – 2745
    Turni275 – 2773
    Helixi280 – 29617
    Turni297 – 3015
    Helixi304 – 31916
    Helixi323 – 3253
    Helixi326 – 33914
    Helixi347 – 36216
    Helixi365 – 3673
    Helixi370 – 39324
    Turni404 – 4063
    Helixi409 – 41911
    Helixi421 – 43111
    Helixi435 – 45319

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1ZKLX-ray1.67A130-482[»]
    3G3NX-ray2.40A139-456[»]
    ProteinModelPortaliQ13946.
    SMRiQ13946. Positions 139-456.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ13946.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni187 – 451265CatalyticBy similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi28 – 336Poly-Ser

    Domaini

    Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG300643.
    HOGENOMiHOG000220881.
    HOVERGENiHBG053543.
    InParanoidiQ13946.
    KOiK01120.
    OMAiLCDRQTE.
    OrthoDBiEOG7M98G3.
    PhylomeDBiQ13946.
    TreeFamiTF314638.

    Family and domain databases

    Gene3Di1.10.1300.10. 1 hit.
    InterProiIPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    [Graphical view]
    PfamiPF00233. PDEase_I. 1 hit.
    [Graphical view]
    PRINTSiPR00387. PDIESTERASE1.
    SMARTiSM00471. HDc. 1 hit.
    [Graphical view]
    PROSITEiPS00126. PDEASE_I. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform PDE7A1 (identifier: Q13946-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEVCYQLPVL PLDRPVPQHV LSRRGAISFS SSSALFGCPN PRQLSQRRGA    50
    ISYDSSDQTA LYIRMLGDVR VRSRAGFESE RRGSHPYIDF RIFHSQSEIE 100
    VSVSARNIRR LLSFQRYLRS SRFFRGTAVS NSLNILDDDY NGQAKCMLEK 150
    VGNWNFDIFL FDRLTNGNSL VSLTFHLFSL HGLIEYFHLD MMKLRRFLVM 200
    IQEDYHSQNP YHNAVHAADV TQAMHCYLKE PKLANSVTPW DILLSLIAAA 250
    THDLDHPGVN QPFLIKTNHY LATLYKNTSV LENHHWRSAV GLLRESGLFS 300
    HLPLESRQQM ETQIGALILA TDISRQNEYL SLFRSHLDRG DLCLEDTRHR 350
    HLVLQMALKC ADICNPCRTW ELSKQWSEKV TEEFFHQGDI EKKYHLGVSP 400
    LCDRHTESIA NIQIGFMTYL VEPLFTEWAR FSNTRLSQTM LGHVGLNKAS 450
    WKGLQREQSS SEDTDAAFEL NSQLLPQENR LS 482
    Length:482
    Mass (Da):55,505
    Last modified:July 15, 1998 - v2
    Checksum:i3B3C8F6E9154F88C
    GO
    Isoform PDE7A2 (identifier: Q13946-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQ → MGITLIWCLALVLIKWITSK

    Show »
    Length:456
    Mass (Da):52,725
    Checksum:iCAA62B0BFEF074AF
    GO
    Isoform PDE7A3 (identifier: Q13946-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         416-424: FMTYLVEPL → NYTYLDIAG
         425-482: Missing.

    Show »
    Length:424
    Mass (Da):48,828
    Checksum:iA7DBF40D08A7B561
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti204 – 2041D → G in BAF83490. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti76 – 761G → E.
    Corresponds to variant rs11557049 [ dbSNP | Ensembl ].
    VAR_056661

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4646MEVCY…RQLSQ → MGITLIWCLALVLIKWITSK in isoform PDE7A2. 2 PublicationsVSP_004593Add
    BLAST
    Alternative sequencei416 – 4249FMTYLVEPL → NYTYLDIAG in isoform PDE7A3. 1 PublicationVSP_038645
    Alternative sequencei425 – 48258Missing in isoform PDE7A3. 1 PublicationVSP_038646Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L12052 mRNA. Translation: AAA35644.2.
    U67932 mRNA. Translation: AAB65772.1.
    AF332652 mRNA. Translation: AAK57640.1.
    AK290801 mRNA. Translation: BAF83490.1.
    AK292680 mRNA. Translation: BAF85369.1.
    AC055822 Genomic DNA. No translation available.
    AC100812 Genomic DNA. No translation available.
    BC126360 mRNA. Translation: AAI26361.1.
    CCDSiCCDS34901.1. [Q13946-2]
    CCDS56538.1. [Q13946-1]
    RefSeqiNP_001229247.1. NM_001242318.2. [Q13946-1]
    NP_002594.1. NM_002603.3. [Q13946-2]
    UniGeneiHs.527119.

    Genome annotation databases

    EnsembliENST00000379419; ENSP00000368730; ENSG00000205268. [Q13946-2]
    ENST00000396642; ENSP00000379881; ENSG00000205268. [Q13946-3]
    ENST00000401827; ENSP00000385632; ENSG00000205268. [Q13946-1]
    GeneIDi5150.
    KEGGihsa:5150.
    UCSCiuc003xvp.3. human. [Q13946-2]
    uc003xvq.3. human. [Q13946-1]
    uc003xvr.3. human. [Q13946-3]

    Polymorphism databases

    DMDMi3182958.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L12052 mRNA. Translation: AAA35644.2 .
    U67932 mRNA. Translation: AAB65772.1 .
    AF332652 mRNA. Translation: AAK57640.1 .
    AK290801 mRNA. Translation: BAF83490.1 .
    AK292680 mRNA. Translation: BAF85369.1 .
    AC055822 Genomic DNA. No translation available.
    AC100812 Genomic DNA. No translation available.
    BC126360 mRNA. Translation: AAI26361.1 .
    CCDSi CCDS34901.1. [Q13946-2 ]
    CCDS56538.1. [Q13946-1 ]
    RefSeqi NP_001229247.1. NM_001242318.2. [Q13946-1 ]
    NP_002594.1. NM_002603.3. [Q13946-2 ]
    UniGenei Hs.527119.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1ZKL X-ray 1.67 A 130-482 [» ]
    3G3N X-ray 2.40 A 139-456 [» ]
    ProteinModelPortali Q13946.
    SMRi Q13946. Positions 139-456.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 111176. 1 interaction.
    IntActi Q13946. 1 interaction.
    STRINGi 9606.ENSP00000368730.

    Chemistry

    BindingDBi Q13946.
    ChEMBLi CHEMBL3012.
    DrugBanki DB00651. Dyphylline.
    DB00920. Ketotifen.
    GuidetoPHARMACOLOGYi 1305.

    PTM databases

    PhosphoSitei Q13946.

    Polymorphism databases

    DMDMi 3182958.

    Proteomic databases

    MaxQBi Q13946.
    PaxDbi Q13946.
    PRIDEi Q13946.

    Protocols and materials databases

    DNASUi 5150.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000379419 ; ENSP00000368730 ; ENSG00000205268 . [Q13946-2 ]
    ENST00000396642 ; ENSP00000379881 ; ENSG00000205268 . [Q13946-3 ]
    ENST00000401827 ; ENSP00000385632 ; ENSG00000205268 . [Q13946-1 ]
    GeneIDi 5150.
    KEGGi hsa:5150.
    UCSCi uc003xvp.3. human. [Q13946-2 ]
    uc003xvq.3. human. [Q13946-1 ]
    uc003xvr.3. human. [Q13946-3 ]

    Organism-specific databases

    CTDi 5150.
    GeneCardsi GC08M066629.
    HGNCi HGNC:8791. PDE7A.
    HPAi CAB018770.
    HPA027340.
    MIMi 171885. gene.
    neXtProti NX_Q13946.
    PharmGKBi PA33139.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG300643.
    HOGENOMi HOG000220881.
    HOVERGENi HBG053543.
    InParanoidi Q13946.
    KOi K01120.
    OMAi LCDRQTE.
    OrthoDBi EOG7M98G3.
    PhylomeDBi Q13946.
    TreeFami TF314638.

    Enzyme and pathway databases

    UniPathwayi UPA00762 ; UER00747 .
    Reactomei REACT_19327. G alpha (s) signalling events.

    Miscellaneous databases

    EvolutionaryTracei Q13946.
    GeneWikii PDE7A.
    GenomeRNAii 5150.
    NextBioi 19872.
    PROi Q13946.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13946.
    Bgeei Q13946.
    CleanExi HS_PDE7A.
    Genevestigatori Q13946.

    Family and domain databases

    Gene3Di 1.10.1300.10. 1 hit.
    InterProi IPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    [Graphical view ]
    Pfami PF00233. PDEase_I. 1 hit.
    [Graphical view ]
    PRINTSi PR00387. PDIESTERASE1.
    SMARTi SM00471. HDc. 1 hit.
    [Graphical view ]
    PROSITEi PS00126. PDEASE_I. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and characterization of a previously undetected human cAMP phosphodiesterase by complementation of cAMP phosphodiesterase-deficient Saccharomyces cerevisiae."
      Michaeli T., Bloom T.J., Martins T., Loughney K., Ferguson K., Riggs M., Rodgers L., Beavo J.A., Wigler M.
      J. Biol. Chem. 268:12925-12932(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE7A1).
    2. "Alternative splicing of the high affinity cAMP-specific phosphodiesterase (PDE7A) mRNA in human skeletal muscle and heart."
      Han P., Zhu X., Michaeli T.
      J. Biol. Chem. 272:16152-16157(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE7A2).
      Tissue: Skeletal muscle.
    3. "T cell activation up-regulates cyclic nucleotide phosphodiesterases 8A1 and 7A3."
      Glavas N.A., Ostenson C., Schaefer J.B., Vasta V., Beavo J.A.
      Proc. Natl. Acad. Sci. U.S.A. 98:6319-6324(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE7A3).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE7A1).
      Tissue: Kidney and Thymus.
    5. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE7A2).
    7. "A-kinase anchoring proteins interact with phosphodiesterases in T lymphocyte cell lines."
      Asirvatham A.L., Galligan S.G., Schillace R.V., Davey M.P., Vasta V., Beavo J.A., Carr D.W.
      J. Immunol. 173:4806-4814(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CBFA2T3.
    8. "Multiple elements jointly determine inhibitor selectivity of cyclic nucleotide phosphodiesterases 4 and 7."
      Wang H., Liu Y., Chen Y., Robinson H., Ke H.
      J. Biol. Chem. 280:30949-30955(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.67 ANGSTROMS) OF 130-482 IN COMPLEX WITH METAL IONS AND THE INHIBITOR IBMX.
    9. "Synthesis, structural analysis, and biological evaluation of thioxoquinazoline derivatives as phosphodiesterase 7 inhibitors."
      Castano T., Wang H., Campillo N.E., Ballester S., Gonzalez-Garcia C., Hernandez J., Perez C., Cuenca J., Perez-Castillo A., Martinez A., Huertas O., Gelpi J.L., Luque F.J., Ke H., Gil C.
      ChemMedChem 4:866-876(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.40 ANGSTROMS) OF 139-456 IN COMPLEX WITH METAL IONS, FUNCTION, COFACTOR.

    Entry informationi

    Entry nameiPDE7A_HUMAN
    AccessioniPrimary (citable) accession number: Q13946
    Secondary accession number(s): A0AVH6
    , A8K436, A8K9G5, O15380, Q96T72
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: July 15, 1998
    Last modified: October 1, 2014
    This is version 140 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3