Reviewed,
UniProtKB/Swiss-Prot Q13946 (PDE7A_HUMAN)
Last modified
July 7, 2009.
Version 87.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A EC=3.1.4.17 Alternative name(s): HCP1 TM22 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 482 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase is highly specific for cAMP and may have a role in muscle signal transduction. |
| Catalytic activity | Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate. |
| Cofactor | Divalent cations. |
| Enzyme regulation | Insensitive to all selective PDE inhibitors. |
| Pathway | Purine metabolism; cAMP degradation; AMP from cAMP: step 1/1. |
| Subunit structure | Interacts with CBFA2T3. Ref.6 |
| Subcellular location | Note: PDE7A1 (57 kDa) is located mostly to soluble cellular fractions. PDE7A2 (50 kDa) is located to particulate cellular fractions. |
| Tissue specificity | PDE7A1 is found at high levels in skeletal muscle and at low levels in a variety of tissues including brain and heart. It is expressed as well in two T-cell lines. PDE7A2 is found abundantly in skeletal muscle and at low levels in heart. |
| Developmental stage | Developmentally regulated. PDE7A1 and PDE7A2 are found in several fetal tissues, expression is reduced throughout development. It persists strongly only in adult skeletal muscle. |
| Domain | Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | cAMP |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | signal transduction Non-traceable author statement. Source: UniProtKB |
| Cellular component | cell fraction Non-traceable author statement. Source: UniProtKB |
| Molecular function | 3',5'-cyclic-AMP phosphodiesterase activity Ref.1 Traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PDE7A1 (identifier: Q13946-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PDE7A2 (identifier: Q13946-2) The sequence of this isoform differs from the canonical sequence as follows: 1-46: MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQ → MGITLIWCLALVLIKWITSK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 482 | 482 | High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A | PRO_0000198833 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 187 – 451 | 265 | Catalytic By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 28 – 33 | 6 | Poly-Ser | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 84 | 1 | Phosphoserine Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 46 | 46 | MEVCY…RQLSQ → MGITLIWCLALVLIKWITSK in isoform PDE7A2. | VSP_004593 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 76 | 1 | G → E: dbSNP rs11557049. | VAR_056661 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 140 – 148 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 149 – 152 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 158 – 164 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 169 – 180 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 183 – 186 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 191 – 203 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 209 – 213 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 214 – 228 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 231 – 234 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 239 – 251 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 252 – 255 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 261 – 266 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 270 – 274 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 275 – 277 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 280 – 296 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 297 – 301 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 304 – 319 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 323 – 325 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 326 – 339 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 347 – 362 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 365 – 367 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 370 – 393 | 24 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 404 – 406 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 409 – 419 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 421 – 431 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 435 – 453 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of a previously undetected human cAMP phosphodiesterase by complementation of cAMP phosphodiesterase-deficient Saccharomyces cerevisiae." Michaeli T., Bloom T.J., Martins T., Loughney K., Ferguson K., Riggs M., Rodgers L., Beavo J.A., Wigler M. J. Biol. Chem. 268:12925-12932(1993) [PubMed: 8389765] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE7A1). |
| [2] | "Alternative splicing of the high affinity cAMP-specific phosphodiesterase (PDE7A) mRNA in human skeletal muscle and heart." Han P., Zhu X., Michaeli T. J. Biol. Chem. 272:16152-16157(1997) [PubMed: 9195912] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PDE7A2). Tissue: Skeletal muscle. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE7A1). Tissue: Thymus. |
| [4] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM PDE7A2). |
| [6] | "A-kinase anchoring proteins interact with phosphodiesterases in T lymphocyte cell lines." Asirvatham A.L., Galligan S.G., Schillace R.V., Davey M.P., Vasta V., Beavo J.A., Carr D.W. J. Immunol. 173:4806-4814(2004) [PubMed: 15470020] [Abstract] Cited for: INTERACTION WITH CBFA2T3. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| L12052 mRNA. Translation: AAA35644.2. U67932 mRNA. Translation: AAB65772.1. AK292680 mRNA. Translation: BAF85369.1. AC055822 Genomic DNA. No translation available. AC100812 Genomic DNA. No translation available. BC126360 mRNA. Translation: AAI26361.1. | |||||||||||||||||||
| IPI | IPI00217833. IPI00219721. | ||||||||||||||||||
| RefSeq | NP_002594.1. | ||||||||||||||||||
| UniGene | Hs.584788 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q13946. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q13946. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSG00000205268. Homo sapiens. [Contig view] | ||||||||||||||||||
| GeneID | 5150. | ||||||||||||||||||
| UCSC | uc003xvp.1. human. uc003xvq.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| GeneCards | GC08M066793. | ||||||||||||||||||
| H-InvDB | HIX0007547. | ||||||||||||||||||
| HGNC | HGNC:8791. PDE7A. | ||||||||||||||||||
| MIM | 171885. gene. | ||||||||||||||||||
| PharmGKB | PA33139. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOGENOM | Q13946. | ||||||||||||||||||
| HOVERGEN | Q13946. | ||||||||||||||||||
| OMA | Q13946. SHMPLES. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 3.1.4.17. 247. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q13946. | ||||||||||||||||||
| Bgee | Q13946. | ||||||||||||||||||
| CleanEx | HS_PDE7A. | ||||||||||||||||||
| GermOnline | ENSG00000205268. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR003607. Met-dep_phosphohydro_HD. IPR002073. PDEase. [Graphical view] | ||||||||||||||||||
| Pfam | PF00233. PDEase_I. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00387. PDIESTERASE1. | ||||||||||||||||||
| SMART | SM00471. HDc. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| DrugBank | DB00651. Dyphylline. DB00920. Ketotifen. | ||||||||||||||||||
| NextBio | 19872. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | PDE7A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13946 Secondary accession number(s): A0AVH6, A8K9G5, O15380 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


