Reviewed,
UniProtKB/Swiss-Prot Q13936 (CAC1C_HUMAN)
Last modified
November 25, 2008.
Version 105.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Voltage-dependent L-type calcium channel subunit alpha-1C Alternative name(s): Voltage-gated calcium channel subunit alpha Cav1.2 Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 2221 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1C gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). Calcium channels containing the alpha-1C subunit play an important role in excitation-contraction coupling in the heart. The various isoforms display marked differences in the sensitivity to DHP compounds. |
| Subunit structure | Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity. Interacts with CACNA2D4. |
| Subcellular location | |
| Tissue specificity | Expressed in brain, heart, jejunum, ovary, pancreatic beta-cells and vascular smooth muscle. Overall expression is reduced in atherosclerotic vascular smooth muscle. |
| Domain | Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position. Binding of intracellular calcium through the EF-hand motif inhibits the opening of the channel By similarity. |
| Post-translational modification | Phosphorylation by PKA activates the channel By similarity. |
| Involvement in disease | Defects in CACNA1C are the cause of Timothy syndrome (TS) [MIM:601005]. TS is a disorder characterized by multiorgan dysfunction including lethal arrhythmias, webbing of fingers and toes, congenital heart disease, immune deficiency, intermittent hypoglycemia, cognitive abnormalities and autism. Defects in CACNA1C are the cause of Brugada syndrome type 3 (BRS3) [MIM:611875]. BRS3 is a heart disease characterized by the association of Brugada syndrome with shortened QT intervals. Brugada syndrome is a tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset. |
| Sequence similarities | Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. [View classification] |
| Sequence caution | The sequence AAA02500.2 differs from that shown. Reason: Frameshift at position 1845. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CABP1 | Q9NZU7 | 2 | EBI-1038838,EBI-907894 | |
| CALM1 | P62158 | 1 | EBI-1038838,EBI-397435 |
Alternative products
| This entry describes 35 isoforms produced by alternative splicing. [Align] [Select] Notes: Additional isoforms seem to exist. Exons 8A, 21, 22, 31, 32, 33, 40B, 43A, 41A and 45 are alternatively spliced in a variety of combinations. Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q13936-1) Also known as: HFCC; Fibroblast; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13936-2) The sequence of this isoform differs from the canonical sequence as follows: 1864-1897: ERHVPMCEDLELRRDSGSAGTQAHCLLLRKANPS → MHCCDMLDGG...PAGCTAPQHA | ||||||
| Isoform 3 (identifier: Q13936-3) The sequence of this isoform differs from the canonical sequence as follows: 372-391: VNDAVGRDWPWIYFVTLIII → MQDAMGYELPWVYFVSLVIF | ||||||
| Notes: Contains exon 8a. | ||||||
| Isoform 4 (identifier: Q13936-4) The sequence of this isoform differs from the canonical sequence as follows: 932-951: Missing. | ||||||
| Notes: Lacks exon 21. | ||||||
| Isoform 5 (identifier: Q13936-5) The sequence of this isoform differs from the canonical sequence as follows: 952-971: Missing. | ||||||
| Notes: Lacks exon 22. | ||||||
| Isoform 6 (identifier: Q13936-6) The sequence of this isoform differs from the canonical sequence as follows: 1297-1324: Missing. | ||||||
| Notes: Lacks exon 31. | ||||||
| Isoform 7 (identifier: Q13936-7) The sequence of this isoform differs from the canonical sequence as follows: 1325-1352: Missing. | ||||||
| Notes: Lacks exon 32. | ||||||
| Isoform 8 (identifier: Q13936-8) The sequence of this isoform differs from the canonical sequence as follows: 1353-1363: Missing. | ||||||
| Notes: Lacks exon 33. | ||||||
| Isoform 9 (identifier: Q13936-9) The sequence of this isoform differs from the canonical sequence as follows: 1618-1699: LRIKTEGNLE...KPSQRNALSL → LRETELSSQV...RGPHHPPLGF | ||||||
| Notes: Contains exon 40B and 43A. | ||||||
| Isoform 10 (identifier: Q13936-10) The sequence of this isoform differs from the canonical sequence as follows: 1623-1623: E → EEGPSPSEAHQGAEDPFRPA | ||||||
| Notes: Contains exon 41A. | ||||||
| Isoform 11 (identifier: Q13936-11) Also known as: Alpha-1C.90; The sequence of this isoform differs from the canonical sequence as follows: 1864-1898: Missing. | ||||||
| Notes: Lacks exon 45. | ||||||
| Isoform 12 (identifier: Q13936-12) Also known as: Alpha-1C.70; The sequence of this isoform differs from the canonical sequence as follows: 952-971: Missing. 1297-1324: Missing. 1864-1898: Missing. | ||||||
| Isoform 13 (identifier: Q13936-13) Also known as: Alpha-1C.127; The sequence of this isoform differs from the canonical sequence as follows: 952-971: Missing. 1325-1352: Missing. 1623-1623: E → EEGPSPSEAHQGAEDPFRPA 1864-1898: Missing. | ||||||
| Isoform 14 (identifier: Q13936-14) Also known as: Alpha-1C.126; The sequence of this isoform differs from the canonical sequence as follows: 952-971: Missing. 1297-1324: Missing. 1363-1363: M → MGPSCSHPPLAVLTAPPVADGFQ 1623-1623: E → EEGPSPSEAHQGAEDPFRPA 1864-1898: Missing. | ||||||
| Isoform 15 (identifier: Q13936-15) Also known as: Alpha-1C.125; The sequence of this isoform differs from the canonical sequence as follows: 952-971: Missing. 1297-1324: Missing. 1351-1363: Missing. 1623-1623: E → EEGPSPSEAHQGAEDPFRPA 1864-1898: Missing. | ||||||
| Isoform 16 (identifier: Q13936-16) The sequence of this isoform differs from the canonical sequence as follows: 1-29: Missing. 372-391: VNDAVGRDWPWIYFVTLIII → MQDAMGYELPWVYFVSLVIF 952-971: Missing. 1325-1352: Missing. | ||||||
| Isoform 17 (identifier: Q13936-17) The sequence of this isoform differs from the canonical sequence as follows: 1-29: Missing. 372-391: VNDAVGRDWPWIYFVTLIII → MQDAMGYELPWVYFVSLVIF 952-971: Missing. 1325-1352: Missing. 1864-1898: Missing. | ||||||
| Isoform 18 (identifier: Q13936-18) Also known as: HHT-1; The sequence of this isoform differs from the canonical sequence as follows: 1-29: Missing. 372-391: VNDAVGRDWPWIYFVTLIII → MQDAMGYELPWVYFVSLVIF 952-971: Missing. 1325-1352: Missing. 1864-1897: ERHVPMCEDLELRRDSGSAGTQAHCLLLRKANPS → MHCCDMLDGG...PAGCTAPQHA | ||||||
| Isoform 19 (identifier: Q13936-19) Also known as: Alpha-1C.76; The sequence of this isoform differs from the canonical sequence as follows: 932-951: Missing. 1297-1324: Missing. 1353-1363: Missing. 1864-1898: Missing. | ||||||
| Isoform 20 (identifier: Q13936-20) Also known as: Alpha-1C.77; The sequence of this isoform differs from the canonical sequence as follows: 932-951: Missing. 1297-1324: Missing. 1864-1898: Missing. | ||||||
| Notes: Predominant isoform in atherosclerotic vascular smooth muscle cells. | ||||||
| Isoform 21 (identifier: Q13936-21) Also known as: Alpha-1C.69; The sequence of this isoform differs from the canonical sequence as follows: 932-951: Missing. 1325-1352: Missing. 1864-1898: Missing. | ||||||
| Isoform 22 (identifier: Q13936-22) Also known as: Alpha-1C.78; The sequence of this isoform differs from the canonical sequence as follows: 952-971: Missing. 1325-1352: Missing. 1864-1898: Missing. | ||||||
| Isoform 23 (identifier: Q13936-23) Also known as: Alpha-1C.105; The sequence of this isoform differs from the canonical sequence as follows: 372-391: VNDAVGRDWPWIYFVTLIII → MQDAMGYELPWVYFVSLVIF 932-951: Missing. 1297-1324: Missing. 1864-1898: Missing. | ||||||
| Isoform 24 (identifier: Q13936-24) Also known as: Alpha-1C.71; The sequence of this isoform differs from the canonical sequence as follows: 952-971: Missing. 1297-1324: Missing. 1623-1623: E → EEGPSPSEAHQGAEDPFRPA 1864-1898: Missing. | ||||||
| Isoform 25 (identifier: Q13936-25) Also known as: Alpha-1C.73; The sequence of this isoform differs from the canonical sequence as follows: 952-971: Missing. 1297-1324: Missing. 1353-1363: Missing. 1623-1623: E → EEGPSPSEAHQGAEDPFRPA 1864-1898: Missing. | ||||||
| Isoform 26 (identifier: Q13936-26) Also known as: Alpha-1C.86; The sequence of this isoform differs from the canonical sequence as follows: 932-951: Missing. 1297-1324: Missing. 1618-1699: LRIKTEGNLE...KPSQRNALSL → LRETELSSQV...RGPHHPPLGF 1864-1898: Missing. | ||||||
| Notes: Not inhibited by calcium. | ||||||
| Isoform 27 (identifier: Q13936-27) Also known as: Alpha-1C.72; The sequence of this isoform differs from the canonical sequence as follows: 932-951: Missing. 1297-1324: Missing. 1623-1623: E → EEGPSPSEAHQGAEDPFRPA 1864-1898: Missing. | ||||||
| Isoform 28 (identifier: Q13936-28) The sequence of this isoform differs from the canonical sequence as follows: 1-29: Missing. 372-391: VNDAVGRDWPWIYFVTLIII → MQDAMGYELPWVYFVSLVIF 952-971: Missing. 1297-1324: Missing. 1353-1363: Missing. 1864-1897: ERHVPMCEDLELRRDSGSAGTQAHCLLLRKANPS → MHCCDMLDGG...PAGCTAPQHA | ||||||
| Isoform 29 (identifier: Q13936-29) Also known as: Alpha-1C.74; The sequence of this isoform differs from the canonical sequence as follows: 932-951: Missing. 1297-1324: Missing. 1353-1363: Missing. 1623-1623: E → EEGPSPSEAHQGAEDPFRPA 1864-1898: Missing. | ||||||
| Isoform 30 (identifier: Q13936-30) Also known as: Alpha-1C.87; The sequence of this isoform differs from the canonical sequence as follows: 1297-1324: Missing. 1864-1898: Missing. | ||||||
| Isoform 31 (identifier: Q13936-31) Also known as: Alpha-1C.88; The sequence of this isoform differs from the canonical sequence as follows: 952-971: Missing. 1864-1898: Missing. | ||||||
| Isoform 32 (identifier: Q13936-32) Also known as: Alpha-1C.89; The sequence of this isoform differs from the canonical sequence as follows: 932-951: Missing. 1353-1363: Missing. 1864-1898: Missing. | ||||||
| Isoform 33 (identifier: Q13936-33) Also known as: Alpha-1C.85; The sequence of this isoform differs from the canonical sequence as follows: 932-951: Missing. 1297-1324: Missing. | ||||||
| Isoform 34 (identifier: Q13936-34) Also known as: Alpha-1C,long-NT; The sequence of this isoform differs from the canonical sequence as follows: 1-16: MVNENTRMYIPEENHQ → MLRAFVQPGTPAYQPLPSHLSANTEVKFKGTLVHEAQLNYFYISPG | ||||||
| Notes: Enhanced by PKC activator. | ||||||
| Isoform 35 (identifier: Q13936-35) The sequence of this isoform differs from the canonical sequence as follows: 306-308: Missing. 952-971: Missing. 1325-1352: Missing. 1864-1898: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2221 | 2221 | Voltage-dependent L-type calcium channel subunit alpha-1C | PRO_0000053928 | |||||
Regions | |||||||||
| Topological domain | 1 – 124 | 124 | Cytoplasmic Potential | ||||||
| Transmembrane | 125 – 143 | 19 | S1 of repeat I Potential | ||||||
| Topological domain | 144 – 160 | 17 | Extracellular Potential | ||||||
| Transmembrane | 161 – 181 | 21 | S2 of repeat I Potential | ||||||
| Topological domain | 182 – 193 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 194 – 212 | 19 | S3 of repeat I Potential | ||||||
| Topological domain | 213 – 232 | 20 | Extracellular Potential | ||||||
| Transmembrane | 233 – 251 | 19 | S4 of repeat I Potential | ||||||
| Topological domain | 252 – 270 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 271 – 290 | 20 | S5 of repeat I Potential | ||||||
| Topological domain | 291 – 380 | 90 | Extracellular Potential | ||||||
| Transmembrane | 381 – 405 | 25 | S6 of repeat I Potential | ||||||
| Topological domain | 406 – 524 | 119 | Cytoplasmic Potential | ||||||
| Transmembrane | 525 – 543 | 19 | S1 of repeat II Potential | ||||||
| Topological domain | 544 – 558 | 15 | Extracellular Potential | ||||||
| Transmembrane | 559 – 578 | 20 | S2 of repeat II Potential | ||||||
| Topological domain | 579 – 586 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 587 – 605 | 19 | S3 of repeat II Potential | ||||||
| Topological domain | 606 – 615 | 10 | Extracellular Potential | ||||||
| Transmembrane | 616 – 634 | 19 | S4 of repeat II Potential | ||||||
| Topological domain | 635 – 653 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 654 – 673 | 20 | S5 of repeat II Potential | ||||||
| Topological domain | 674 – 728 | 55 | Extracellular Potential | ||||||
| Transmembrane | 729 – 753 | 25 | S6 of repeat II Potential | ||||||
| Topological domain | 754 – 900 | 147 | Cytoplasmic Potential | ||||||
| Transmembrane | 901 – 919 | 19 | S1 of repeat III Potential | ||||||
| Topological domain | 920 – 935 | 16 | Extracellular Potential | ||||||
| Transmembrane | 936 – 955 | 20 | S2 of repeat III Potential | ||||||
| Topological domain | 956 – 987 | 32 | Cytoplasmic Potential | ||||||
| Transmembrane | 988 – 1006 | 19 | S3 of repeat III Potential | ||||||
| Topological domain | 1007 – 1013 | 7 | Extracellular Potential | ||||||
| Transmembrane | 1014 – 1032 | 19 | S4 of repeat III Potential | ||||||
| Topological domain | 1033 – 1051 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 1052 – 1071 | 20 | S5 of repeat III Potential | ||||||
| Topological domain | 1072 – 1161 | 90 | Extracellular Potential | ||||||
| Transmembrane | 1162 – 1186 | 25 | S6 of repeat III Potential | ||||||
| Topological domain | 1187 – 1239 | 53 | Cytoplasmic Potential | ||||||
| Transmembrane | 1240 – 1258 | 19 | S1 of repeat IV Potential | ||||||
| Topological domain | 1259 – 1273 | 15 | Extracellular Potential | ||||||
| Transmembrane | 1274 – 1293 | 20 | S2 of repeat IV Potential | ||||||
| Topological domain | 1294 – 1301 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 1302 – 1320 | 19 | S3 of repeat IV Potential | ||||||
| Topological domain | 1321 – 1372 | 52 | Extracellular Potential | ||||||
| Transmembrane | 1373 – 1391 | 19 | S4 of repeat IV Potential | ||||||
| Topological domain | 1392 – 1410 | 19 | Cytoplasmic Potential | ||||||
| Transmembrane | 1411 – 1430 | 20 | S5 of repeat IV Potential | ||||||
| Topological domain | 1431 – 1499 | 69 | Extracellular Potential | ||||||
| Transmembrane | 1500 – 1524 | 25 | S6 of repeat IV Potential | ||||||
| Topological domain | 1525 – 2221 | 697 | Cytoplasmic Potential | ||||||

Clusters with