Q13907 (IDI1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 117.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Isopentenyl-diphosphate Delta-isomerase 1 EC=5.3.3.2 Alternative name(s): Isopentenyl pyrophosphate isomerase 1 Short name=IPP isomerase 1 Short name=IPPI1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 227 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). Ref.10 |
| Catalytic activity | Isopentenyl diphosphate = dimethylallyl diphosphate. |
| Cofactor | Binds 1 magnesium ion per subunit. Ref.10 |
| Pathway | |
| Subunit structure | Monomer. Ref.13 |
| Subcellular location | |
| Sequence similarities | Belongs to the IPP isomerase type 1 family. Contains 1 nudix hydrolase domain. |
| Sequence caution | The sequence AAH57827.1 differs from that shown. Reason: Erroneous initiation. The sequence AAK29357.1 differs from that shown. Reason: Erroneous initiation. The sequence AAK49434.1 differs from that shown. Reason: Erroneous initiation. The sequence AAK49435.1 differs from that shown. Reason: Erroneous initiation. The sequence AAP35407.1 differs from that shown. Reason: Erroneous initiation. The sequence CAA34890.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cholesterol biosynthesis Isoprene biosynthesis Lipid synthesis Steroid biosynthesis Sterol biosynthesis |
| Cellular component | Peroxisome |
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Metal-binding |
| Molecular function | Isomerase |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cholesterol biosynthetic process Traceable author statement. Source: Reactome isoprenoid biosynthetic processTraceable author statement. Source: ProtInc |
| Cellular component | cytosol Traceable author statement. Source: Reactome peroxisomeTraceable author statement. Source: ProtInc |
| Molecular function | hydrolase activity Inferred from electronic annotation. Source: InterPro isopentenyl-diphosphate delta-isomerase activityTraceable author statement. Source: Reactome metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: Q13907-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: Q13907-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MWRGLALARAIGCAARGRGQWAVRAADCAQSGRHPGPAVVCGRRLISVLEQIRHFVMM | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 39 | 1 | V → G in AAI07894. Ref.8 | ||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 227 | 227 | Isopentenyl-diphosphate Delta-isomerase 1 | PRO_0000205222 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 49 – 199 | 151 | Nudix hydrolase | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 225 – 227 | 3 | Microbody targeting signal | |||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 86 | 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 148 | 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 40 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 51 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 146 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 148 | 1 | Magnesium | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 36 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 70 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 74 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 87 | 1 | Substrate | |||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 176 | 1 | N6-acetyllysine Ref.11 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MWRGLALARAIGCAARGRGQ WAVRAADCAQSGRHPGPAVV CGRRLISVLEQIRHFVMM in isoform 2. | VSP_037889 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 45 | 1 | I → V in BAD96595. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 101 | 1 | A → T in AAH19227. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 156 | 1 | R → G in BAD96595. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 173 | 1 | Y → H in AAH06999. Ref.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 6 – 8 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 20 – 24 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 30 – 35 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 36 – 39 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 42 – 45 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 46 – 48 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 51 – 59 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 65 – 70 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 75 – 77 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 81 – 87 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 90 – 92 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 93 – 96 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 99 – 101 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 102 – 116 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 120 – 122 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 125 – 127 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 128 – 139 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 141 – 156 | 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 165 – 167 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 168 – 174 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 176 – 187 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 195 – 203 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 205 – 209 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 210 – 213 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 216 – 218 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 224 – 226 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A human promyelocyte mRNA transiently induced by TPA is homologous to yeast IPP isomerase." Xuan J.W., Kowalski J., Chambers A.F., Denhardt D.T. Genomics 20:129-131(1994) [PubMed: 8020941] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Two genes for isopentenyl diphosphate isomerase in human." Masuda K., Breitling R., Krisans S.K., Keller B., Moeller G., Adamski J. Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [3] | "Characterisation of a human gene for isopentenyl diphosphate dimethylally diphosphate isomerase 1 (IDI1)." Masuda K., Krisans S.K., Keller B., Moeller G., Adamski J. Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1). |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Kidney. |
| [6] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Bone marrow, Skin and Urinary bladder. |
| [9] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 40-227 (ISOFORM 2). Tissue: Liver. |
| [10] | "Human isopentenyl diphosphate: dimethylallyl diphosphate isomerase: overproduction, purification, and characterization." Hahn F.M., Xuan J.W., Chambers A.F., Poulter C.D. Arch. Biochem. Biophys. 332:30-34(1996) [PubMed: 8806705] [Abstract] Cited for: FUNCTION, COFACTOR. |
| [11] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-176, MASS SPECTROMETRY. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [13] | "The crystal structure of human isopentenyl diphosphate isomerase at 1.7 A resolution reveals its catalytic mechanism in isoprenoid biosynthesis." Zheng W., Sun F., Bartlam M., Li X., Li R., Rao Z. J. Mol. Biol. 366:1447-1458(2007) [PubMed: 17250851] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) IN COMPLEX WITH SUBSTRATE AND METAL IONS, SUBUNIT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X17025 mRNA. Translation: CAA34890.1. Different initiation. AF291755 Genomic DNA. Translation: AAK29357.1. Different initiation. AF271720 mRNA. Translation: AAK49435.1. Different initiation. AF271724 AF271723 Genomic DNA. Translation: AAK49434.1. Different initiation.BT006761 mRNA. Translation: AAP35407.1. Different initiation. AK303669 mRNA. Translation: BAG64667.1. AC022536 Genomic DNA. No translation available. CH471072 Genomic DNA. Translation: EAW86521.1. BC005247 mRNA. Translation: AAH05247.2. BC006999 mRNA. Translation: AAH06999.2. BC019227 mRNA. Translation: AAH19227.2. BC022418 mRNA. Translation: AAH22418.2. BC025375 mRNA. Translation: AAH25375.2. BC057827 mRNA. Translation: AAH57827.1. Different initiation. BC107893 mRNA. Translation: AAI07894.1. AK222875 mRNA. Translation: BAD96595.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00220014. IPI00645307. | ||||||||||||||||||||||||||||||
| RefSeq | NP_004499.2. NM_004508.2. | ||||||||||||||||||||||||||||||
| UniGene | Hs.644603. Hs.727514. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q13907. | ||||||||||||||||||||||||||||||
| SMR | Q13907. Positions 9-227. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| STRING | Q13907. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q13907. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 6225527. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | Q13907. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000381344; ENSP00000370748; ENSG00000067064. | ||||||||||||||||||||||||||||||
| GeneID | 3422. | ||||||||||||||||||||||||||||||
| KEGG | hsa:3422. | ||||||||||||||||||||||||||||||
| NMPDR | fig|9606.3.peg.3477. | ||||||||||||||||||||||||||||||
| UCSC | uc001ifz.1. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 3422. | ||||||||||||||||||||||||||||||
| GeneCards | GC10M001075. | ||||||||||||||||||||||||||||||
| H-InvDB | HIX0008587. HIX0008588. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:5387. IDI1. | ||||||||||||||||||||||||||||||
| HPA | HPA039169. | ||||||||||||||||||||||||||||||
| MIM | 604055. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q13907. | ||||||||||||||||||||||||||||||
| PharmGKB | PA29635. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | prNOG13546. | ||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000008527. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG002995. | ||||||||||||||||||||||||||||||
| InParanoid | Q13907. | ||||||||||||||||||||||||||||||
| OMA | NYELGIP. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4PK28T. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q13907. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| BioCyc | MetaCyc:ENSG00000067064-MONOMER. | ||||||||||||||||||||||||||||||
| BRENDA | 5.3.3.2. 2681. | ||||||||||||||||||||||||||||||
| Reactome | REACT_22258. Metabolism of lipids and lipoproteins. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q13907. | ||||||||||||||||||||||||||||||
| Bgee | Q13907. | ||||||||||||||||||||||||||||||
| CleanEx | HS_IDI1. | ||||||||||||||||||||||||||||||
| Genevestigator | Q13907. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000067064. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR011876. IsopentenylPP_isomerase_typ1. IPR000086. NUDIX_hydrolase_dom. IPR015797. NUDIX_hydrolase_dom-like. [Graphical view] | ||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.90.79.10. NUDIX_hydrolase. 1 hit. | ||||||||||||||||||||||||||||||
| KO | K01823. | ||||||||||||||||||||||||||||||
| PANTHER | PTHR10885. IPP_isom_1. 1 hit. | ||||||||||||||||||||||||||||||
| Pfam | PF00293. NUDIX. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PIRSF | PIRSF018427. Isopntndiph_ism. 1 hit. | ||||||||||||||||||||||||||||||
| SUPFAM | SSF55811. NUDIX_hydrolase. 1 hit. | ||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR02150. IPP_isom_1. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS51462. NUDIX. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | IDI1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13907 Secondary accession number(s): B4E155 Q9BQ74 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with