Q13822 (ENPP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 Short name=E-NPP 2 EC=3.1.4.39 Alternative name(s): Autotaxin Extracellular lysophospholipase D Short name=LysoPLD | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 863 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolyzes lysophospholipids to produce lysophosphatidic acid (LPA) in extracellular fluids. Major substrate is lysophosphatidylcholine. Also can act on sphingosylphosphphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP. Involved in several motility-related processes such as angiogenesis and neurite outgrowth. Acts as an angiogenic factor by stimulating migration of smooth muscle cells and microtubule formation. Stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein. May have a role in induction of parturition. Possible involvement in cell proliferation and adipose tissue development. Tumor cell motility-stimulating factor. Ref.9 Ref.10 Ref.11 Ref.12 |
| Catalytic activity | 1-alkyl-sn-glycero-3-phosphoethanolamine + H2O = 1-alkyl-sn-glycerol 3-phosphate + ethanolamine. Ref.12 |
| Cofactor | Binds 2 zinc ions per subunit By similarity. Binds 1 calcium ion per subunit By similarity. |
| Enzyme regulation | Inhibited by lysophosphatidic acid (LPA) and sphingosine-1-phosphate (S1P). Inhibited by EDTA and EGTA Probable. Ref.4 Ref.5 Ref.12 |
| Subcellular location | Secreted. Note: Secreted by most body fluids including serum and CSF. Also by adipocytes and numerous cancer cells. Ref.4 |
| Tissue specificity | Predominantly expressed in brain, placenta, ovary, and small intestine. Expressed in a number of carcinomas such as hepatocellular and prostate carcinoma, neuroblastoma and non-small-cell lung cancer. Expressed in body fluids such as plasma, cerebral spinal fluid (CSF), saliva, follicular and amniotic fluids. Not detected in leukocytes. Isoform 1 is more highly expressed in peripheral tissues than in the central nervous system (CNS). Adipocytes only express isoform 1. Isoform 3 is more highly expressed in the brain than in peripheral tissues. Ref.2 Ref.3 Ref.5 |
| Induction | Up-regulated in massively obese subjects with glucose intolerance, and during adipogenesis. Ref.4 Ref.5 Ref.11 Ref.12 |
| Post-translational modification | N-glycosylation, but not furin-cleavage, plays a critical role on secretion and on lysoPLD activity By similarity. It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both. |
| Sequence similarities | Belongs to the nucleotide pyrophosphatase/phosphodiesterase family. Contains 2 SMB (somatomedin-B) domains. |
| Biophysicochemical properties | Kinetic parameters: KM=0.5 mM for 16:0-LPC (at pH 8.5) Ref.5 Ref.8 KM=5.5 mM for pNP-TMP (at pH 8.5) KM=11.3 mM for pNppp (isoform 1) KM=5.7 mM for pNppp (isoform 2) KM=19.8 mM for pNppp (isoform 3) Vmax=1.9 nmol/min/µg enzyme with pNppp as substrate (isoform 1) Vmax=0.67 nmol/min/µg enzyme with pNppp as substrate (isoform 2) Vmax=1.6 nmol/min/µg enzyme with pNppp as substrate (isoform 3) pH dependence: Optimum pH is 9.0 (isoform 1), 8.0 (isoform 3). Isoform 1 is less sensitive to pH. Isoform 1, isoform 2 and isoform 3 all retain some activity at pH 9.5. Temperature dependence: Isoform 1 and isoform 3 are active from 45 to 60 degrees Celsius. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13822-1) Also known as: ATXter; Beta; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13822-2) Also known as: ATXmel; Alpha; The sequence of this isoform differs from the canonical sequence as follows: 324-324: E → EESSYGSPFTPAKRPKRKVAPKRRQERPVAPPKKRRRKIHRMDHYAAETRQDK | ||||||
| Isoform 3 (identifier: Q13822-3) Also known as: Gamma; The sequence of this isoform differs from the canonical sequence as follows: 593-593: E → EAETRKYRGTRNENKENINGNFEPRK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 27 | 27 | By similarity | ||||||||
| Propeptide | 28 – 35 | 8 | Removed by furin | PRO_0000281649 | |||||||
| Chain | 36 – 863 | 828 | Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 | PRO_0000188567 | |||||||
Regions | |||||||||||
| Domain | 55 – 98 | 44 | SMB 1 | ||||||||
| Domain | 99 – 143 | 45 | SMB 2 | ||||||||
| Region | 211 – 214 | 4 | Substrate binding By similarity | ||||||||
| Region | 244 – 255 | 12 | Substrate binding By similarity | ||||||||
| Region | 830 – 851 | 22 | Required for secretion By similarity | ||||||||
| Motif | 127 – 129 | 3 | Cell attachment site Potential | ||||||||
Sites | |||||||||||
| Active site | 210 | 1 | By similarity | ||||||||
| Metal binding | 172 | 1 | Zinc 1 By similarity | ||||||||
| Metal binding | 210 | 1 | Zinc 1 By similarity | ||||||||
| Metal binding | 312 | 1 | Zinc 2 By similarity | ||||||||
| Metal binding | 316 | 1 | Zinc 2 By similarity | ||||||||
| Metal binding | 359 | 1 | Zinc 1 By similarity | ||||||||
| Metal binding | 360 | 1 | Zinc 1 By similarity | ||||||||
| Metal binding | 475 | 1 | Zinc 2 By similarity | ||||||||
| Metal binding | 740 | 1 | Calcium By similarity | ||||||||
| Metal binding | 744 | 1 | Calcium By similarity | ||||||||
| Metal binding | 746 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||||
| Metal binding | 748 | 1 | Calcium By similarity | ||||||||
| Site | 853 | 1 | Essential for catalytic activity By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 54 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 411 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 525 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 807 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 59 ↔ 76 | Alternate By similarity | |||||||||
| Disulfide bond | 59 ↔ 63 | Alternate By similarity | |||||||||
| Disulfide bond | 63 ↔ 94 | Alternate By similarity | |||||||||
| Disulfide bond | 74 ↔ 87 | Alternate By similarity | |||||||||
| Disulfide bond | 74 ↔ 76 | Alternate By similarity | |||||||||
| Disulfide bond | 80 ↔ 86 | By similarity | |||||||||
| Disulfide bond | 87 ↔ 94 | Alternate By similarity | |||||||||
| Disulfide bond | 103 ↔ 120 | Alternate By similarity | |||||||||
| Disulfide bond | 103 ↔ 108 | Alternate By similarity | |||||||||
| Disulfide bond | 108 ↔ 138 | Alternate By similarity | |||||||||
| Disulfide bond | 118 ↔ 131 | Alternate By similarity | |||||||||
| Disulfide bond | 118 ↔ 120 | Alternate By similarity | |||||||||
| Disulfide bond | 124 ↔ 130 | By similarity | |||||||||
| Disulfide bond | 131 ↔ 138 | Alternate By similarity | |||||||||
| Disulfide bond | 149 ↔ 195 | By similarity | |||||||||
| Disulfide bond | 157 ↔ 351 | By similarity | |||||||||
| Disulfide bond | 367 ↔ 469 | By similarity | |||||||||
| Disulfide bond | 414 ↔ 806 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 324 | 1 | E → EESSYGSPFTPAKRPKRKVA PKRRQERPVAPPKKRRRKIH RMDHYAAETRQDK in isoform 2. | VSP_006750 | |||||||
| Alternative sequence | 593 | 1 | E → EAETRKYRGTRNENKENING NFEPRK in isoform 3. | VSP_036398 | |||||||
| Natural variant | 493 | 1 | S → P. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.7 Ref.9 Corresponds to variant rs10283100 [ dbSNP | Ensembl ]. | VAR_060469 | |||||||
| Natural variant | 577 | 1 | N → S. Corresponds to variant rs2289886 [ dbSNP | Ensembl ]. | VAR_057472 | |||||||
| Natural variant | 726 | 1 | S → L. Corresponds to variant rs16892767 [ dbSNP | Ensembl ]. | VAR_057473 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 170 | 1 | S → E: Reduces lysophospholipase activity by about 70%. | ||||||||
| Mutagenesis | 210 | 1 | T → A: Loss of lysophospholipase activity. Ref.12 | ||||||||
| Mutagenesis | 211 | 1 | F → Y: Reduces lysophospholipase activity by about 70%. Ref.12 | ||||||||
| Mutagenesis | 218 | 1 | A → V: Reduces lysophospholipase activity by about 50%. Ref.12 | ||||||||
| Mutagenesis | 231 | 1 | N → A: Strongly reduced lysophospholipase activity. Ref.12 | ||||||||
| Mutagenesis | 307 | 1 | Y → Q: Reduces lysophospholipase activity by about 70%. Ref.12 | ||||||||
| Sequence conflict | 23 | 1 | N → S in AAA64785. Ref.1 | ||||||||
| Sequence conflict | 23 | 1 | N → S in ABW38316. Ref.5 | ||||||||
| Sequence conflict | 73 | 1 | D → H in BAA08260. Ref.2 | ||||||||
| Sequence conflict | 100 | 1 | G → A in AAB00855. Ref.3 | ||||||||
| Sequence conflict | 291 | 1 | Q → R in AAA64785. Ref.1 | ||||||||
| Sequence conflict | 291 | 1 | Q → R in ABW38316. Ref.5 | ||||||||
| Sequence conflict | 349 | 1 | H → R in AAA64785. Ref.1 | ||||||||
| Sequence conflict | 349 | 1 | H → R in ABW38316. Ref.5 | ||||||||
| Sequence conflict | 457 | 1 | K → P AA sequence Ref.9 | ||||||||
| Sequence conflict | 501 | 1 | V → S AA sequence Ref.9 | ||||||||
| Sequence conflict | 508 | 1 | E → N AA sequence Ref.9 | ||||||||
| Sequence conflict | 554 | 1 | P → L AA sequence Ref.9 | ||||||||
| Sequence conflict | 629 | 1 | P → L in AAA64785. Ref.1 | ||||||||
| Sequence conflict | 629 | 1 | P → L in ABW38316. Ref.5 | ||||||||
| Sequence conflict | 644 | 1 | S → R in BAA08260. Ref.2 | ||||||||
| Sequence conflict | 703 | 1 | V → A in BAA08260. Ref.2 | ||||||||
| Sequence conflict | 769 | 1 | Y → H in BAA08260. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning of the human tumor motility-stimulating protein, autotaxin, reveals a homology with phosphodiesterases." Murata J., Lee H.Y., Clair T., Krutzsch H.C., Arestad A.A., Sobel M.E., Liotta L.A., Stracke M.L. J. Biol. Chem. 269:30479-30484(1994) [PubMed: 7982964] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), PARTIAL PROTEIN SEQUENCE, CHARACTERIZATION, VARIANT PRO-493. Tissue: Melanoma. |
| [2] | "Molecular cloning and chromosomal assignment of the human brain-type phosphodiesterase I/nucleotide pyrophosphatase gene (PDNP2)." Kawagoe H., Soma O., Goji J., Nishimura N., Narita M., Inazawa J., Nakamura H., Sano K. Genomics 30:380-384(1995) [PubMed: 8586446] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-45, TISSUE SPECIFICITY, VARIANT PRO-493. |
| [3] | "Cloning, chromosomal localization, and tissue expression of autotaxin from human teratocarcinoma cells." Lee H.Y., Murata J., Clair T., Polymeropoulos M.H., Torres R., Manrow R.E., Liotta L.A., Stracke M.L. Biochem. Biophys. Res. Commun. 218:714-719(1996) [PubMed: 8579579] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT PRO-493. Tissue: Teratocarcinoma. |
| [4] | "Inhibition of autotaxin by lysophosphatidic acid and sphingosine 1-phosphate." van Meeteren L.A., Ruurs P., Christodoulou E., Goding J.W., Takakusa H., Kikuchi K., Perrakis A., Nagano T., Moolenaar W.H. J. Biol. Chem. 280:21155-21161(2005) [PubMed: 15769751] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, ENZYME REGULATION, VARIANT PRO-493. |
| [5] | "Murine and human autotaxin alpha, beta, and gamma isoforms: gene organization, tissue distribution, and biochemical characterization." Giganti A., Rodriguez M., Fould B., Moulharat N., Coge F., Chomarat P., Galizzi J.-P., Valet P., Saulnier-Blache J.-S., Boutin J.A., Ferry G. J. Biol. Chem. 283:7776-7789(2008) [PubMed: 18175805] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), PROTEIN SEQUENCE OF 36-42 AND 49-54, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES, TISSUE SPECIFICITY, VARIANT PRO-493. Tissue: Brain and Melanoma. |
| [6] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-493. Tissue: Testis. |
| [8] | "Identification of human plasma lysophospholipase D, a lysophosphatidic acid-producing enzyme, as autotaxin, a multifunctional phosphodiesterase." Tokumura A., Majima E., Kariya Y., Tominaga K., Kogure K., Yasuda K., Fukuzawa K. J. Biol. Chem. 277:39436-39442(2002) [PubMed: 12176993] [Abstract] Cited for: PROTEIN SEQUENCE OF 36-49; 318-330; 335-344; 440-450 AND 854-863, IDENTIFICATION, BIOPHYSICOCHEMICAL PROPERTIES. |
| [9] | "Identification, purification, and partial sequence analysis of autotaxin, a novel motility-stimulating protein." Stracke M.L., Krutzsch H.C., Unsworth E.J., Aarestad A., Cioce V., Schiffmann E., Liotta L.A. J. Biol. Chem. 267:2524-2529(1992) [PubMed: 1733949] [Abstract] Cited for: PROTEIN SEQUENCE OF 256-266; 370-392; 457-463; 481-496; 501-510; 545-554; 639-643; 706-710 AND 829-840, FUNCTION, VARIANT PRO-493. Tissue: Melanoma. |
| [10] | "Autotaxin (NPP-2), a metastasis-enhancing mitogen, is an angiogenic factor." Nam S.W., Clair T., Kim Y.S., McMarlin A., Schiffmann E., Liotta L.A., Stracke M.L. Cancer Res. 61:6938-6944(2001) [PubMed: 11559573] [Abstract] Cited for: FUNCTION IN ANGIOGENESIS. |
| [11] | "Potential involvement of adipocyte insulin resistance in obesity-associated up-regulation of adipocyte lysophospholipase D/autotaxin expression." Boucher J., Quilliot D., Pradere J.P., Simon M.F., Gres S., Guigne C., Prevot D., Ferry G., Boutin J.A., Carpene C., Valet P., Saulnier-Blache J.S. Diabetologia 48:569-577(2005) [PubMed: 15700135] [Abstract] Cited for: INDUCTION, POSSIBLE FUNCTION IN OBESITY. |
| [12] | "Structural basis of substrate discrimination and integrin binding by autotaxin." Hausmann J., Kamtekar S., Christodoulou E., Day J.E., Wu T., Fulkerson Z., Albers H.M., van Meeteren L.A., Houben A.J., van Zeijl L., Jansen S., Andries M., Hall T., Pegg L.E., Benson T.E., Kasiem M., Harlos K., Kooi C.W. Perrakis A.Nat. Struct. Mol. Biol. 18:198-204(2011) [PubMed: 21240271] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, ENZYME REGULATION, MUTAGENESIS OF THR-210; PHE-211; ALA-218; ASN-231 AND TYR-307. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L35594 mRNA. Translation: AAA64785.1. D45421 mRNA. Translation: BAA08260.1. D45914 Genomic DNA. Translation: BAA08342.1. L46720 mRNA. Translation: AAB00855.1. EU131011 mRNA. Translation: ABW38316.2. AC099818 Genomic DNA. No translation available. AC107960 Genomic DNA. No translation available. BC034961 mRNA. Translation: AAH34961.1. |
| IPI | IPI00156171. IPI00303210. IPI00878576. |
| PIR | A55144. |
| RefSeq | NP_001035181.1. NM_001040092.2. NP_006200.3. NM_006209.4. |
| UniGene | Hs.190977. |
3D structure databases | |
| ProteinModelPortal | Q13822. |
| SMR | Q13822. Positions 52-860. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q13822. |
PTM databases | |
| PhosphoSite | Q13822. |
Polymorphism databases | |
| DMDM | 290457674. |
Proteomic databases | |
| PRIDE | Q13822. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000075322; ENSP00000075322; ENSG00000136960. |
| GeneID | 5168. |
| KEGG | hsa:5168. |
| UCSC | uc003yos.1. human. uc003yot.1. human. |
Organism-specific databases | |
| CTD | 5168. |
| GeneCards | GC08M120569. |
| H-InvDB | HIX0025550. |
| HGNC | HGNC:3357. ENPP2. |
| HPA | HPA023700. |
| MIM | 601060. gene. |
| neXtProt | NX_Q13822. |
| PharmGKB | PA27792. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG07851. |
| GeneTree | ENSGT00550000074244. |
| HOVERGEN | HBG051484. |
| OMA | RCVNVIF. |
| PhylomeDB | Q13822. |
Gene expression databases | |
| ArrayExpress | Q13822. |
| Bgee | Q13822. |
| CleanEx | HS_ENPP2. |
| Genevestigator | Q13822. |
| GermOnline | ENSG00000136960. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR017849. Alkaline_Pase-like_a/b/a. IPR017850. Alkaline_phosphatase_core. IPR001604. DNA/RNA_non-sp_Endonuclease. IPR024873. E-NPP. IPR020821. Extracellular_endonuc_su_A. IPR002591. Phosphodiest/P_Trfase. IPR020436. Somatomedin_B_chordata. IPR001212. Somatomedin_B_dom. [Graphical view] |
| Gene3D | G3DSA:3.40.720.10. Alk_phosphtse. 2 hits. G3DSA:3.40.570.10. Endonuclease. 1 hit. |
| KO | K01122. |
| PANTHER | PTHR10151. PTHR10151. 1 hit. |
| Pfam | PF01223. Endonuclease_NS. 1 hit. PF01663. Phosphodiest. 2 hits. PF01033. Somatomedin_B. 2 hits. [Graphical view] |
| PRINTS | PR00022. SOMATOMEDINB. |
| SMART | SM00892. Endonuclease_NS. 1 hit. SM00477. NUC. 1 hit. SM00201. SO. 2 hits. [Graphical view] |
| SUPFAM | SSF53649. Alkaline_phosphatase_core. 1 hit. |
| PROSITE | PS00524. SMB_1. 2 hits. PS50958. SMB_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 19994. |
| SOURCE | Search... |
Entry information
| Entry name | ENPP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13822 Secondary accession number(s): A8UHA1 Q9UCR4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with