Q13642 (FHL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Four and a half LIM domains protein 1 Short name=FHL-1 Alternative name(s): Skeletal muscle LIM-protein 1 Short name=SLIM Short name=SLIM-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 323 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May have an involvement in muscle development or hypertrophy. |
| Subcellular location | Isoform 3: Cytoplasm. Nucleus. Isoform 2: Nucleus. Cytoplasm › cytosol. Note: Predominantly nuclear in myoblasts but is cytosolic in differentiated myotubes. Ref.5 Ref.6 Ref.7 |
| Tissue specificity | Isoform 1 is highly expressed in skeletal muscle and to a lesser extent in heart, placenta, ovary, prostate, testis, small intestine, colon and spleen. Expression is barely detectable in brain, lung, liver, kidney, pancreas, thymus and peripheral blood leukocytes. Isoform 2 is expressed in brain, skeletal muscle and to a lesser extent in heart, colon, prostate and small intestine. Isoform 3 is expressed in testis, heart and skeletal muscle. Ref.3 Ref.4 Ref.5 Ref.6 Ref.7 |
| Developmental stage | Elevated levels during postnatal muscle growth. Ref.13 |
| Involvement in disease | X-linked dominant scapuloperoneal myopathy (SPM) [MIM:300695]: Scapuloperoneal syndrome (SPS) was initially described more than 120 years ago by Jules Broussard as 'une forme hereditaire d'atrophie musculaire progressive' beginning in the lower legs and affecting the shoulder region earlier and more severely than distal arm. The etiology of this condition remains unclear. X-linked myopathy with postural muscle atrophy (XMPMA) [MIM:300696]: Myopathies are inherited muscle disorders characterized by weakness and atrophy of voluntary skeletal muscle, and several types of myopathy also show involvement of cardiac muscle. XMPMA is a distinct form of adult-onset X-linked recessive myopathy with several features in common with other myopathies, but the presentation of a pseudoathletic phenotype, scapuloperoneal weakness, and bent spine is unique and might render the clinical phenotype distinguishable from other myopathies. X-linked severe early-onset reducing body myopathy (RBM) [MIM:300717]: Rare muscle disorder causing progressive muscular weakness and characteristic intracytoplasmic inclusions in myofibers. Clinical presentations of RBM have ranged from early-onset fatal to childhood onset to adult onset cases. X-linked childhood-onset reducing body myopathy (CO-RBM) [MIM:300718]: This disorder is allelic to severe early-onset reducing body myopathy (RBM). |
| Sequence similarities | Contains 3 LIM zinc-binding domains. |
| Sequence caution | The sequence AAH88369.1 differs from that shown. Reason: Erroneous initiation. The sequence CAI41055.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| NRIP1 | P48552 | 6 | EBI-912547,EBI-746484 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q13642-2) Also known as: FHL1B; SLIMMER; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q13642-1) Also known as: FHL1; FHL1A; SLIM1; The sequence of this isoform differs from the canonical sequence as follows: 231-323: KRTVSRVSHP...TTASTAKNAP → FGKGSSVVAY...VYCPDCAKKL | ||||||
| Isoform 3 (identifier: Q13642-3) Also known as: FHL1C; The sequence of this isoform differs from the canonical sequence as follows: 168-296: Missing. | ||||||
| Isoform 4 (identifier: Q13642-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MTFYVASLALELIWMLSSPAGPSSYKVGTM 231-323: KRTVSRVSHP...TTASTAKNAP → FGKGSSVVAY...VYCPDCAKKL | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q13642-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MASHRHSGPSSYKVGTM 231-323: KRTVSRVSHP...TTASTAKNAP → FGKGSSVVAY...VYCPDCAKKL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 323 | 322 | Four and a half LIM domains protein 1 | PRO_0000075735 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 40 – 92 | 53 | LIM zinc-binding 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 101 – 153 | 53 | LIM zinc-binding 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 162 – 212 | 51 | LIM zinc-binding 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 7 – 31 | 25 | C4-type Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MTFYVASLALELIWMLSSPA GPSSYKVGTM in isoform 4. | VSP_043162 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MASHRHSGPSSYKVGTM in isoform 5. | VSP_043404 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 168 – 296 | 129 | Missing in isoform 3. | VSP_010693 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 231 – 323 | 93 | KRTVS…AKNAP → FGKGSSVVAYEGQSWHDYCF HCKKCSVNLANKRFVFHQEQ VYCPDCAKKL in isoform 1, isoform 4 and isoform 5. | VSP_010694 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 122 | 1 | W → S in SPM. Ref.19 | VAR_042603 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 123 | 1 | H → Y in RBM; X-linked severe early-onset; the mutant protein initiates aggregation of the FHL1 protein, forms reducing bodies and traps wild-type FHL1 into the inclusion bodies; consistent with a dominant-negative effect. Ref.20 | VAR_045999 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 128 | 1 | T → TI in XMPMA. Ref.18 | VAR_042604 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 132 | 1 | C → F in RBM; X-linked severe early-onset; the mutant protein initiates aggregation of the FHL1 protein, forms reducing bodies and traps wild-type FHL1 into the inclusion bodies; consistent with a dominant-negative effect. Ref.20 | VAR_046000 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 153 | 1 | C → R in RBM; X-linked childhood-onset. Ref.20 | VAR_046001 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 153 | 1 | C → Y in RBM; X-linked childhood-onset. Ref.20 | VAR_046002 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 224 | 1 | C → W in XMPMA. Ref.18 | VAR_042605 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 73 | 1 | H → Q in AAC52021. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 81 – 91 | 11 | VAKDNKILCNK → CGQGQQRSCAQ in AAD21579. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 98 | 1 | S → F Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 98 | 1 | S → F Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 158 | 1 | F → L Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 158 | 1 | F → L Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 239 | 1 | H → R in AAC72390. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 41 – 43 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 49 – 51 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 53 – 56 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 59 – 62 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 63 – 65 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 69 – 71 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 81 – 83 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 86 – 88 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 90 – 93 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 104 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 110 – 112 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 114 – 116 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 121 – 123 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 124 – 126 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 130 – 132 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 141 – 144 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 147 – 150 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 151 – 157 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 163 – 165 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 174 – 176 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 179 – 181 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 183 – 186 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 189 – 191 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 200 – 202 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 207 – 209 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 210 – 216 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 222 – 224 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Slim defines a novel family of LIM-proteins expressed in skeletal muscle." Morgan M.J., Madgwick A.J.A. Biochem. Biophys. Res. Commun. 225:632-638(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Skeletal muscle. |
| [2] | Morgan M.J. Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "Chromosomal mapping, tissue distribution and cDNA sequence of four-and-a-half LIM domain protein 1 (FHL1)." Lee S.M.Y., Tsui S.K.W., Chan K.K., Garcia-Barcelo M., Waye M.M.Y., Fung K.P., Liew C.C., Lee C.Y. Gene 216:163-170(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Heart. |
| [4] | "Genomic structure, tissue expression and chromosomal location of the LIM-only gene, SLIM1." Greene W.K., Baker E., Rabbitts T.H., Kees U.R. Gene 232:203-207(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [5] | "Characterization of a brain-specific nuclear LIM domain protein (FHL1B) which is an alternatively spliced variant of FHL1." Lee S.M.Y., Li H.-Y., Ng E.K.O., Or S.M.W., Chan K.K., Kotaka M., Chim S.S.C., Tsui S.K.W., Waye M.M.Y., Fung K.-P., Lee C.-Y. Gene 237:253-263(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Brain. |
| [6] | "Characterization of two isoforms of the skeletal muscle LIM protein 1, SLIM1. Localization of SLIM1 at focal adhesions and the isoform slimmer in the nucleus of myoblasts and cytoplasm of myotubes suggests distinct roles in the cytoskeleton and in nuclear-cytoplasmic communication." Brown S., McGrath M.J., Ooms L.M., Gurung R., Maimone M.M., Mitchell C.A. J. Biol. Chem. 274:27083-27091(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Bone marrow. |
| [7] | "Characterization of tissue-specific LIM domain protein (FHL1C) which is an alternatively spliced isoform of a human LIM-only protein (FHL1)." Ng E.K.O., Lee S.M.Y., Li H.-Y., Ngai S.-M., Tsui S.K.W., Waye M.M.Y., Lee C.-Y., Fung K.-P. J. Cell. Biochem. 82:1-10(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Testis. |
| [8] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5). Tissue: Esophagus, Thalamus and Tongue. |
| [9] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [10] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [12] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Muscle. |
| [13] | "The developmental regulation of a novel muscle LIM-protein." Morgan M.J., Madgwick A.J.A., Charleston B., Pell J.M., Loughna P.T. Biochem. Biophys. Res. Commun. 212:840-846(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 106-255 (ISOFORM 1), DEVELOPMENTAL STAGE. Tissue: Muscle. |
| [14] | "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-11. Tissue: Platelet. |
| [15] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [16] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [17] | "Solution structure of LIM domains from human four and a half LIM domains 1." RIKEN structural genomics initiative (RSGI) Submitted (SEP-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 40-280 IN COMPLEXES WITH ZINC IONS. |
| [18] | "An X-linked myopathy with postural muscle atrophy and generalized hypertrophy, termed XMPMA, is caused by mutations in FHL1." Windpassinger C., Schoser B., Straub V., Hochmeister S., Noor A., Lohberger B., Farra N., Petek E., Schwarzbraun T., Ofner L., Loescher W.N., Wagner K., Lochmueller H., Vincent J.B., Quasthoff S. Am. J. Hum. Genet. 82:88-99(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS XMPMA ILE-128 INS AND TRP-224. |
| [19] | "X-linked dominant scapuloperoneal myopathy is due to a mutation in the gene encoding four-and-a-half-LIM protein 1." Quinzii C.M., Vu T.H., Min K.C., Tanji K., Barral S., Grewal R.P., Kattah A., Camano P., Otaegui D., Kunimatsu T., Blake D.M., Wilhelmsen K.C., Rowland L.P., Hays A.P., Bonilla E., Hirano M. Am. J. Hum. Genet. 82:208-213(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SPM SER-122. |
| [20] | "Proteomic identification of FHL1 as the protein mutated in human reducing body myopathy." Schessl J., Zou Y., McGrath M.J., Cowling B.S., Maiti B., Chin S.S., Sewry C., Battini R., Hu Y., Cottle D.L., Rosenblatt M., Spruce L., Ganguly A., Kirschner J., Judkins A.R., Golden J.A., Goebel H.-H., Muntoni F. Boennemann C.G.J. Clin. Invest. 118:904-912(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS RBM TYR-123; PHE-132; TYR-153 AND ARG-153. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U60115 mRNA. Translation: AAC52021.1. U29538 mRNA. Translation: AAC35421.1. AF110763 Genomic DNA. Translation: AAD21579.1. AF098518 mRNA. Translation: AAC72390.1. AF063002 mRNA. Translation: AAC72886.1. AF220153 mRNA. Translation: AAF32351.1. AK122708 mRNA. Translation: BAG53680.1. AK289411 mRNA. Translation: BAF82100.1. AK299381 mRNA. Translation: BAH13020.1. AK301642 mRNA. Translation: BAH13529.1. CR456974 mRNA. Translation: CAG33255.1. AL078638 Genomic DNA. Translation: CAC18881.1. AL078638 Genomic DNA. Translation: CAI41062.1. AL078638 Genomic DNA. Translation: CAI41055.1. Different initiation. CH471150 Genomic DNA. Translation: EAW88476.1. CH471150 Genomic DNA. Translation: EAW88478.1. CH471150 Genomic DNA. Translation: EAW88479.1. BC010998 mRNA. Translation: AAH10998.1. BC088369 mRNA. Translation: AAH88369.1. Different initiation. U60118 mRNA. Translation: AAC50795.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00014398. IPI00029028. IPI00055606. IPI00647207. IPI00930706. | ||||||||||||||||||||||||||||||
| PIR | G01884. G02741. JC4893. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001153171.1. NM_001159699.1. NP_001153172.1. NM_001159700.1. NP_001153173.1. NM_001159701.1. NP_001153174.1. NM_001159702.2. NP_001153175.1. NM_001159703.1. NP_001153176.1. NM_001159704.1. NP_001161291.1. NM_001167819.1. NP_001440.2. NM_001449.4. | ||||||||||||||||||||||||||||||
| UniGene | Hs.435369. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q13642. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| IntAct | Q13642. 19 interactions. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 59800384. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q13642. | ||||||||||||||||||||||||||||||
| PRIDE | Q13642. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| DNASU | 2273. | ||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000345434; ENSP00000071281; ENSG00000022267. ENST00000370683; ENSP00000359717; ENSG00000022267. ENST00000370690; ENSP00000359724; ENSG00000022267. ENST00000394153; ENSP00000377709; ENSG00000022267. ENST00000394155; ENSP00000377710; ENSG00000022267. ENST00000535737; ENSP00000444815; ENSG00000022267. ENST00000539015; ENSP00000437673; ENSG00000022267. ENST00000543669; ENSP00000443333; ENSG00000022267. | ||||||||||||||||||||||||||||||
| GeneID | 2273. | ||||||||||||||||||||||||||||||
| KEGG | hsa:2273. | ||||||||||||||||||||||||||||||
| UCSC | uc004ezo.3. human. uc004ezq.2. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 2273. | ||||||||||||||||||||||||||||||
| GeneCards | GC0XP135229. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:3702. FHL1. | ||||||||||||||||||||||||||||||
| HPA | CAB020817. HPA001040. HPA001391. | ||||||||||||||||||||||||||||||
| MIM | 300163. gene. 300695. phenotype. 300696. phenotype. 300717. phenotype. 300718. phenotype. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q13642. | ||||||||||||||||||||||||||||||
| Orphanet | 97239. Reducing body myopathy. 85146. Scapuloperoneal amyotrophy. 98863. X-linked Emery-Dreifuss muscular dystrophy. 178461. X-linked myopathy with postural muscle atrophy. | ||||||||||||||||||||||||||||||
| PharmGKB | PA28141. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG314122. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG074526. | ||||||||||||||||||||||||||||||
| InParanoid | Q13642. | ||||||||||||||||||||||||||||||
| KO | K14365. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4GQQ56. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q13642. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q13642. | ||||||||||||||||||||||||||||||
| Bgee | Q13642. | ||||||||||||||||||||||||||||||
| Genevestigator | Q13642. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000022267. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| Gene3D | 2.10.110.10. 3 hits. | ||||||||||||||||||||||||||||||
| InterPro | IPR001781. Znf_LIM. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00412. LIM. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| SMART | SM00132. LIM. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| PROSITE | PS00478. LIM_DOMAIN_1. 3 hits. PS50023. LIM_DOMAIN_2. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| ChiTaRS | FHL1. human. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q13642. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 2273. | ||||||||||||||||||||||||||||||
| NextBio | 9243. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | FHL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13642 Secondary accession number(s): B7Z5T4 Q9Y630 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
