Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q13639 (5HT4R_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 138. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
5-hydroxytryptamine receptor 4

Short name=5-HT-4
Short name=5-HT4
Alternative name(s):
Serotonin receptor 4
Gene names
Name:HTR4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length388 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

Subunit structure

Isoform 5-HT4(A) interacts with MAGI2, MPP3, SLC9A3R1 and SNX27 isoforms 1 and 2. Isoform 5-HT4(E) interacts with INADL, NOS1 and SEC23A. Isoform 5-HT4(A) forms a complex including SLC9A3R1 and EZR By similarity. Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin). Ref.14

Subcellular location

Cell membrane; Multi-pass membrane protein. Endosome. Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli By similarity.

Tissue specificity

Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle. Ref.7

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Alternative products

This entry describes 9 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 5-HT4(B) (identifier: Q13639-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 5-HT4(A) (identifier: Q13639-2)

Also known as: 5-HT4S;

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → YTVLHRGHHQELEKLPIHNDPESLESCF
Isoform 5-HT4(C) (identifier: Q13639-3)

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → F
Isoform 5-HT4(D) (identifier: Q13639-4)

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRRNFGIRKRRLTKPS
Isoform 5-HT4(E) (identifier: Q13639-5)

Also known as: H5-HT4(g);

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SGCSPVSSFLLLFCNRPVPV
Note: Mainly expressed in atria and cardiac ventricle.
Isoform 5-HT4(F) (identifier: Q13639-6)

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: L → LERSLNQGLGQDFHA
Isoform 5-HT4(G) (identifier: Q13639-7)

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: Missing.
Isoform 5-HT4(I) (identifier: Q13639-8)

The sequence of this isoform differs from the canonical sequence as follows:
     359-359: R → RTDFLFDRDILARYWTKPARAGPFSGTLSIRCLTARKPVLG
Note: Expressed in all cardiovascular tissues analyzed.
Isoform 5-HT4c1 (identifier: Q13639-9)

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRKK...GRKSCFREGK

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 3883885-hydroxytryptamine receptor 4
PRO_0000068965

Regions

Topological domain1 – 1919Extracellular By similarity
Transmembrane20 – 4021Helical; Name=1; By similarity
Topological domain41 – 5818Cytoplasmic By similarity
Transmembrane59 – 7921Helical; Name=2; By similarity
Topological domain80 – 9314Extracellular By similarity
Transmembrane94 – 11623Helical; Name=3; By similarity
Topological domain117 – 13721Cytoplasmic By similarity
Transmembrane138 – 15821Helical; Name=4; By similarity
Topological domain159 – 19234Extracellular By similarity
Transmembrane193 – 21321Helical; Name=5; By similarity
Topological domain214 – 26047Cytoplasmic By similarity
Transmembrane261 – 28121Helical; Name=6; By similarity
Topological domain282 – 29413Extracellular By similarity
Transmembrane295 – 31521Helical; Name=7; By similarity
Topological domain316 – 38873Cytoplasmic By similarity

Amino acid modifications

Lipidation3291S-palmitoyl cysteine By similarity
Glycosylation71N-linked (GlcNAc...) Potential
Disulfide bond93 ↔ 184 By similarity

Natural variations

Alternative sequence1691L → LERSLNQGLGQDFHA in isoform 5-HT4(F).
VSP_001845
Alternative sequence359 – 38830RDAVE…QPSDT → SSGTETDRRNFGIRKRRLTK PS in isoform 5-HT4(D).
VSP_001847
Alternative sequence359 – 38830RDAVE…QPSDT → SGCSPVSSFLLLFCNRPVPV in isoform 5-HT4(E).
VSP_001846
Alternative sequence359 – 38830RDAVE…QPSDT → SSGTETDRKKLWNKEEKIDQ TIQMPKRKRKKKASLSYEDL ILLGRKSCFREGK in isoform 5-HT4c1.
VSP_047862
Alternative sequence3591R → RTDFLFDRDILARYWTKPAR AGPFSGTLSIRCLTARKPVL G in isoform 5-HT4(I).
VSP_043316
Alternative sequence360 – 38829DAVEC…QPSDT → YTVLHRGHHQELEKLPIHND PESLESCF in isoform 5-HT4(A).
VSP_001849
Alternative sequence360 – 38829DAVEC…QPSDT → F in isoform 5-HT4(C).
VSP_001848
Alternative sequence360 – 38829Missing in isoform 5-HT4(G).
VSP_001850
Natural variant271S → L in a patient with diffuse leukoencephalopathy with spheroids; unknown pathological significance. Ref.15
VAR_067412
Natural variant3721C → Y.
Corresponds to variant rs34826744 [ dbSNP | Ensembl ].
VAR_049364

Sequences

Sequence LengthMass (Da)Tools
Isoform 5-HT4(B) [UniParc].

Last modified January 11, 2001. Version 2.
Checksum: 7FCFEC60E7BDF560

FASTA38843,761
        10         20         30         40         50         60 
MDKLDANVSS EEGFGSVEKV VLLTFLSTVI LMAILGNLLV MVAVCWDRQL RKIKTNYFIV 

        70         80         90        100        110        120 
SLAFADLLVS VLVMPFGAIE LVQDIWIYGE VFCLVRTSLD VLLTTASIFH LCCISLDRYY 

       130        140        150        160        170        180 
AICCQPLVYR NKMTPLRIAL MLGGCWVIPT FISFLPIMQG WNNIGIIDLI EKRKFNQNSN 

       190        200        210        220        230        240 
STYCVFMVNK PYAITCSVVA FYIPFLLMVL AYYRIYVTAK EHAHQIQMLQ RAGASSESRP 

       250        260        270        280        290        300 
QSADQHSTHR MRTETKAAKT LCIIMGCFCL CWAPFFVTNI VDPFIDYTVP GQVWTAFLWL 

       310        320        330        340        350        360 
GYINSGLNPF LYAFLNKSFR RAFLIILCCD DERYRRPSIL GQTVPCSTTT INGSTHVLRD 

       370        380 
AVECGGQWES QCHPPATSPL VAAQPSDT 

« Hide

Isoform 5-HT4(A) (5-HT4S) [UniParc].

Checksum: 43019BED75AC9D0F
Show »

FASTA38744,109
Isoform 5-HT4(C) [UniParc].

Checksum: F2BE6033F518178A
Show »

FASTA36040,944
Isoform 5-HT4(D) [UniParc].

Checksum: C7591BFE6A9C1D62
Show »

FASTA38043,186
Isoform 5-HT4(E) (H5-HT4(g)) [UniParc].

Checksum: E45038FEF832270D
Show »

FASTA37842,746
Isoform 5-HT4(F) [UniParc].

Checksum: 243F4AE87A6F77FA
Show »

FASTA40245,315
Isoform 5-HT4(G) [UniParc].

Checksum: CE6033F518178AF3
Show »

FASTA35940,797
Isoform 5-HT4(I) [UniParc].

Checksum: 463644AFC1C7D882
Show »

FASTA42848,255
Isoform 5-HT4c1 [UniParc].

Checksum: 7A842A2702C855D3
Show »

FASTA41146,907

References

« Hide 'large scale' references
[1]"Cloning, expression, and pharmacology of four human 5-hydroxytryptamine 4 receptor isoforms produced by alternative splicing in the carboxyl terminus."
Blondel O., Gastineau M., Dahmoune Y., Langlois M., Fischmeister R.
J. Neurochem. 70:2252-2261(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(C) AND 5-HT4(D)).
Tissue: Intestine.
[2]"Cloning and expression of 5-HT4 receptor species and splice variants."
Van den Wyngaert I., Gommeren W., Jurzak M., Verhasselt P., Gordon R., Leysen J., Luyten W., Bender E.
Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A) AND 5-HT4(B)).
Tissue: Brain.
[3]"Cloning and expression of human 5-HT4S receptors. Effect of receptor density on their coupling to adenylyl cyclase."
Claeysen S., Faye P., Sebben M., Lemaire S., Bockaert J., Dumuis A.
NeuroReport 8:3189-3195(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(A)).
Tissue: Heart.
[4]"Molecular cloning of the human serotonin receptor 5-HT4(b) and pharmacological comparison with the cloned human 5-HT4(a) receptor."
Syversveen T., Bach T., Kvingedal A.M., Krobert K.A., Kaumann A.J., Levy F.O.
Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(B)).
[5]"Novel brain-specific 5-HT4 receptor splice variants show marked constitutive activity: role of the C-terminal intracellular domain."
Claeysen S., Sebben M., Becamel C., Bockaert J., Dumuis A.
Mol. Pharmacol. 55:910-920(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(E)).
Tissue: Brain.
[6]"Cloning and characterization of a novel human 5-HT4 receptor variant that lacks the alternatively spliced carboxy terminal exon. RT-PCR distribution in human brain and periphery of multiple 5-HT4 receptor variants."
Vilaro M.T., Domenech T., Palacios J.M., Mengod G.
Neuropharmacology 42:60-73(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(E) AND 5-HT4(G)).
Tissue: Brain and Hippocampus.
[7]"Cloning, pharmacological characterisation and tissue distribution of a novel 5-HT4 receptor splice variant, 5-HT4(i)."
Brattelid T., Kvingedal A.M., Krobert K.A., Andressen K.W., Bach T., Hystad M.E., Kaumann A.J., Levy F.O.
Naunyn Schmiedebergs Arch. Pharmacol. 369:616-628(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(E) AND 5-HT4(I)), TISSUE SPECIFICITY.
[8]"Cloning, expression and characterisation of a novel rat 5-HT4 receptor splice variant (5-HT4c1)."
Reid A.M., Kelsell R.E., Houp J.A., Kelly F.M., Medhurst A.D., Cox H.M., Calver A.R.
Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4C1).
Tissue: Small intestine.
[9]"The DNA sequence and comparative analysis of human chromosome 5."
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. expand/collapse author list , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[11]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5-HT4(B)).
[12]"Structure of the human serotonin 5-HT4 receptor gene and cloning of a novel 5-HT4 splice variant."
Bender E., Pindon A., van Oers I., Zhang Y.B., Gommeren W., Verhasselt P., Jurzak M., Leysen J., Luyten W.
J. Neurochem. 74:478-489(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 10-388 (ISOFORM 5-HT4(F)).
[13]"Expression of serotonin receptor mRNAs in blood vessels."
Ullmer C., Schmuck K., Kalkman H.O., Luebbert H.
FEBS Lett. 370:215-221(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 112-255.
Tissue: Brain.
[14]"Beta-arrestin1 phosphorylation by GRK5 regulates G protein-independent 5-HT4 receptor signalling."
Barthet G., Carrat G., Cassier E., Barker B., Gaven F., Pillot M., Framery B., Pellissier L.P., Augier J., Kang D.S., Claeysen S., Reiter E., Baneres J.L., Benovic J.L., Marin P., Bockaert J., Dumuis A.
EMBO J. 28:2706-2718(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH GRK5, IDENTIFICATION BY MASS SPECTROMETRY.
[15]"Mutations in the colony stimulating factor 1 receptor (CSF1R) gene cause hereditary diffuse leukoencephalopathy with spheroids."
Rademakers R., Baker M., Nicholson A.M., Rutherford N.J., Finch N., Soto-Ortolaza A., Lash J., Wider C., Wojtas A., DeJesus-Hernandez M., Adamson J., Kouri N., Sundal C., Shuster E.A., Aasly J., MacKenzie J., Roeber S., Kretzschmar H.A. expand/collapse author list , Boeve B.F., Knopman D.S., Petersen R.C., Cairns N.J., Ghetti B., Spina S., Garbern J., Tselis A.C., Uitti R., Das P., Van Gerpen J.A., Meschia J.F., Levy S., Broderick D.F., Graff-Radford N., Ross O.A., Miller B.B., Swerdlow R.H., Dickson D.W., Wszolek Z.K.
Nat. Genet. 44:200-205(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT LEU-27.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
Y08756 mRNA. Translation: CAA70002.1.
Y12505 mRNA. Translation: CAA73107.1.
Y12506 mRNA. Translation: CAA73108.1.
Y12507 mRNA. Translation: CAA73109.1.
Y10437 mRNA. Translation: CAA71462.1.
Y13584 mRNA. Translation: CAA73911.1.
Y09586 mRNA. Translation: CAA70774.1.
AJ131724 mRNA. Translation: CAC20411.1.
AJ011371 mRNA. Translation: CAA09600.1.
AJ278979 mRNA. Translation: CAC22248.1.
AJ278980 mRNA. Translation: CAC22249.1.
AJ278981 mRNA. Translation: CAC22250.1.
AJ278982 mRNA. Translation: CAC22251.1.
AJ131725 mRNA. Translation: CAC79533.1.
AJ131726 mRNA. Translation: CAC79538.1.
AJ633645 mRNA. Translation: CAG17627.1.
AM712912 mRNA. Translation: CAN84676.1.
AC008627 Genomic DNA. No translation available.
AC011390 Genomic DNA. No translation available.
AC091971 Genomic DNA. No translation available.
AC114939 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61800.1.
CH471062 Genomic DNA. Translation: EAW61801.1.
CH471062 Genomic DNA. Translation: EAW61804.1.
BC074755 mRNA. Translation: AAH74755.1.
BC095497 mRNA. Translation: AAH95497.1.
AJ243213 Genomic DNA. Translation: CAB71316.1.
Z48150 mRNA. Translation: CAA88167.1.
CCDSCCDS34270.1. [Q13639-2]
CCDS34271.1. [Q13639-5]
CCDS34272.1. [Q13639-8]
CCDS34273.2. [Q13639-3]
CCDS4291.1. [Q13639-1]
PIRS66493.
RefSeqNP_000861.1. NM_000870.6. [Q13639-1]
NP_001035259.1. NM_001040169.2. [Q13639-2]
NP_001035262.2. NM_001040172.2. [Q13639-3]
NP_001035263.1. NM_001040173.2. [Q13639-8]
NP_001273339.1. NM_001286410.1. [Q13639-9]
NP_955525.1. NM_199453.3. [Q13639-5]
UniGeneHs.483773.

3D structure databases

ProteinModelPortalQ13639.
SMRQ13639. Positions 25-328.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid109592. 1 interaction.
MINTMINT-1347413.

Chemistry

BindingDBQ13639.
ChEMBLCHEMBL1875.
DrugBankDB00604. Cisapride.
DB00953. Rizatriptan.
DB01079. Tegaserod.
DB00315. Zolmitriptan.
GuidetoPHARMACOLOGY9.

Protein family/group databases

GPCRDBSearch...

PTM databases

PhosphoSiteQ13639.

Polymorphism databases

DMDM12644029.

Proteomic databases

PaxDbQ13639.
PRIDEQ13639.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000314512; ENSP00000314906; ENSG00000164270. [Q13639-5]
ENST00000354217; ENSP00000346156; ENSG00000164270. [Q13639-2]
ENST00000360693; ENSP00000353915; ENSG00000164270. [Q13639-8]
ENST00000362016; ENSP00000355037; ENSG00000164270. [Q13639-6]
ENST00000377888; ENSP00000367120; ENSG00000164270. [Q13639-1]
ENST00000517929; ENSP00000435904; ENSG00000164270. [Q13639-3]
ENST00000520514; ENSP00000427913; ENSG00000164270. [Q13639-9]
ENST00000521530; ENSP00000428320; ENSG00000164270. [Q13639-2]
ENST00000521735; ENSP00000430979; ENSG00000164270. [Q13639-5]
ENST00000522588; ENSP00000430874; ENSG00000164270. [Q13639-5]
GeneID3360.
KEGGhsa:3360.
UCSCuc003lpn.3. human. [Q13639-1]
uc021yfg.1. human. [Q13639-5]
uc021yfh.1. human. [Q13639-2]
uc021yfi.1. human. [Q13639-3]
uc021yfj.1. human. [Q13639-8]

Organism-specific databases

CTD3360.
GeneCardsGC05M147810.
H-InvDBHIX0078165.
HGNCHGNC:5299. HTR4.
HPAHPA040591.
MIM602164. gene.
neXtProtNX_Q13639.
PharmGKBPA29557.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG262978.
HOGENOMHOG000239242.
HOVERGENHBG106962.
KOK04160.
OMAYRIYITA.
OrthoDBEOG7CG707.
PhylomeDBQ13639.
TreeFamTF316350.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.

Gene expression databases

ArrayExpressQ13639.
BgeeQ13639.
GenevestigatorQ13639.

Family and domain databases

Gene3D1.20.1070.10. 1 hit.
InterProIPR001520. 5HT4_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PANTHERPTHR24249:SF33. PTHR24249:SF33. 1 hit.
PfamPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSPR01059. 5HT4RECEPTR.
PR00237. GPCRRHODOPSN.
PROSITEPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWiki5-HT4_receptor.
GenomeRNAi3360.
NextBio13288.
PROQ13639.
SOURCESearch...

Entry information

Entry name5HT4R_HUMAN
AccessionPrimary (citable) accession number: Q13639
Secondary accession number(s): C4WYH4 expand/collapse secondary AC list , Q546Q1, Q684M0, Q712M9, Q96KH9, Q96KI0, Q9H199, Q9NY73, Q9UBM6, Q9UBT4, Q9UE22, Q9UE23, Q9UQR6
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: July 9, 2014
This is version 138 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries