SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13639

- 5HT4R_HUMAN

UniProt

Q13639 - 5HT4R_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

5-hydroxytryptamine receptor 4

Gene
HTR4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

GO - Molecular functioni

  1. serotonin receptor activity Source: MGI

GO - Biological processi

  1. G-protein coupled receptor signaling pathway Source: ProtInc
  2. G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger Source: ProtInc
  3. positive regulation of cell proliferation Source: UniProtKB
  4. regulation of appetite Source: InterPro
  5. serotonin receptor signaling pathway Source: GOC
  6. synaptic transmission Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiREACT_17064. Serotonin receptors.
REACT_19327. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 4
Short name:
5-HT-4
Short name:
5-HT4
Alternative name(s):
Serotonin receptor 4
Gene namesi
Name:HTR4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:5299. HTR4.

Subcellular locationi

Cell membrane; Multi-pass membrane protein. Endosome
Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1919Extracellular By similarityAdd
BLAST
Transmembranei20 – 4021Helical; Name=1; By similarityAdd
BLAST
Topological domaini41 – 5818Cytoplasmic By similarityAdd
BLAST
Transmembranei59 – 7921Helical; Name=2; By similarityAdd
BLAST
Topological domaini80 – 9314Extracellular By similarityAdd
BLAST
Transmembranei94 – 11623Helical; Name=3; By similarityAdd
BLAST
Topological domaini117 – 13721Cytoplasmic By similarityAdd
BLAST
Transmembranei138 – 15821Helical; Name=4; By similarityAdd
BLAST
Topological domaini159 – 19234Extracellular By similarityAdd
BLAST
Transmembranei193 – 21321Helical; Name=5; By similarityAdd
BLAST
Topological domaini214 – 26047Cytoplasmic By similarityAdd
BLAST
Transmembranei261 – 28121Helical; Name=6; By similarityAdd
BLAST
Topological domaini282 – 29413Extracellular By similarityAdd
BLAST
Transmembranei295 – 31521Helical; Name=7; By similarityAdd
BLAST
Topological domaini316 – 38873Cytoplasmic By similarityAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. endosome Source: UniProtKB-SubCell
  3. integral component of plasma membrane Source: ProtInc
  4. membrane Source: MGI
  5. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29557.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 3883885-hydroxytryptamine receptor 4PRO_0000068965Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi7 – 71N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi93 ↔ 184 By similarity
Lipidationi329 – 3291S-palmitoyl cysteine By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiQ13639.
PRIDEiQ13639.

PTM databases

PhosphoSiteiQ13639.

Expressioni

Tissue specificityi

Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.1 Publication

Gene expression databases

ArrayExpressiQ13639.
BgeeiQ13639.
GenevestigatoriQ13639.

Organism-specific databases

HPAiHPA040591.

Interactioni

Subunit structurei

Isoform 5-HT4(A) interacts with MAGI2, MPP3, SLC9A3R1 and SNX27 isoforms 1 and 2. Isoform 5-HT4(E) interacts with INADL, NOS1 and SEC23A. Isoform 5-HT4(A) forms a complex including SLC9A3R1 and EZR By similarity. Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin).1 Publication

Protein-protein interaction databases

BioGridi109592. 1 interaction.
MINTiMINT-1347413.

Structurei

3D structure databases

ProteinModelPortaliQ13639.
SMRiQ13639. Positions 25-328.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG262978.
HOGENOMiHOG000239242.
HOVERGENiHBG106962.
KOiK04160.
OMAiYRIYITA.
OrthoDBiEOG7CG707.
PhylomeDBiQ13639.
TreeFamiTF316350.

Family and domain databases

Gene3Di1.20.1070.10. 1 hit.
InterProiIPR001520. 5HT4_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PANTHERiPTHR24249:SF33. PTHR24249:SF33. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01059. 5HT4RECEPTR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 5-HT4(B) (identifier: Q13639-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDKLDANVSS EEGFGSVEKV VLLTFLSTVI LMAILGNLLV MVAVCWDRQL    50
RKIKTNYFIV SLAFADLLVS VLVMPFGAIE LVQDIWIYGE VFCLVRTSLD 100
VLLTTASIFH LCCISLDRYY AICCQPLVYR NKMTPLRIAL MLGGCWVIPT 150
FISFLPIMQG WNNIGIIDLI EKRKFNQNSN STYCVFMVNK PYAITCSVVA 200
FYIPFLLMVL AYYRIYVTAK EHAHQIQMLQ RAGASSESRP QSADQHSTHR 250
MRTETKAAKT LCIIMGCFCL CWAPFFVTNI VDPFIDYTVP GQVWTAFLWL 300
GYINSGLNPF LYAFLNKSFR RAFLIILCCD DERYRRPSIL GQTVPCSTTT 350
INGSTHVLRD AVECGGQWES QCHPPATSPL VAAQPSDT 388
Length:388
Mass (Da):43,761
Last modified:January 11, 2001 - v2
Checksum:i7FCFEC60E7BDF560
GO
Isoform 5-HT4(A) (identifier: Q13639-2) [UniParc]FASTAAdd to Basket

Also known as: 5-HT4S

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → YTVLHRGHHQELEKLPIHNDPESLESCF

Show »
Length:387
Mass (Da):44,109
Checksum:i43019BED75AC9D0F
GO
Isoform 5-HT4(C) (identifier: Q13639-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → F

Show »
Length:360
Mass (Da):40,944
Checksum:iF2BE6033F518178A
GO
Isoform 5-HT4(D) (identifier: Q13639-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRRNFGIRKRRLTKPS

Show »
Length:380
Mass (Da):43,186
Checksum:iC7591BFE6A9C1D62
GO
Isoform 5-HT4(E) (identifier: Q13639-5) [UniParc]FASTAAdd to Basket

Also known as: H5-HT4(g)

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SGCSPVSSFLLLFCNRPVPV

Note: Mainly expressed in atria and cardiac ventricle.

Show »
Length:378
Mass (Da):42,746
Checksum:iE45038FEF832270D
GO
Isoform 5-HT4(F) (identifier: Q13639-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: L → LERSLNQGLGQDFHA

Show »
Length:402
Mass (Da):45,315
Checksum:i243F4AE87A6F77FA
GO
Isoform 5-HT4(G) (identifier: Q13639-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: Missing.

Show »
Length:359
Mass (Da):40,797
Checksum:iCE6033F518178AF3
GO
Isoform 5-HT4(I) (identifier: Q13639-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-359: R → RTDFLFDRDILARYWTKPARAGPFSGTLSIRCLTARKPVLG

Note: Expressed in all cardiovascular tissues analyzed.

Show »
Length:428
Mass (Da):48,255
Checksum:i463644AFC1C7D882
GO
Isoform 5-HT4c1 (identifier: Q13639-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRKK...GRKSCFREGK

Show »
Length:411
Mass (Da):46,907
Checksum:i7A842A2702C855D3
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti27 – 271S → L in a patient with diffuse leukoencephalopathy with spheroids; unknown pathological significance. 1 Publication
VAR_067412
Natural varianti372 – 3721C → Y.
Corresponds to variant rs34826744 [ dbSNP | Ensembl ].
VAR_049364

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei169 – 1691L → LERSLNQGLGQDFHA in isoform 5-HT4(F). VSP_001845
Alternative sequencei359 – 38830RDAVE…QPSDT → SSGTETDRRNFGIRKRRLTK PS in isoform 5-HT4(D). VSP_001847Add
BLAST
Alternative sequencei359 – 38830RDAVE…QPSDT → SGCSPVSSFLLLFCNRPVPV in isoform 5-HT4(E). VSP_001846Add
BLAST
Alternative sequencei359 – 38830RDAVE…QPSDT → SSGTETDRKKLWNKEEKIDQ TIQMPKRKRKKKASLSYEDL ILLGRKSCFREGK in isoform 5-HT4c1. VSP_047862Add
BLAST
Alternative sequencei359 – 3591R → RTDFLFDRDILARYWTKPAR AGPFSGTLSIRCLTARKPVL G in isoform 5-HT4(I). VSP_043316
Alternative sequencei360 – 38829DAVEC…QPSDT → YTVLHRGHHQELEKLPIHND PESLESCF in isoform 5-HT4(A). VSP_001849Add
BLAST
Alternative sequencei360 – 38829DAVEC…QPSDT → F in isoform 5-HT4(C). VSP_001848Add
BLAST
Alternative sequencei360 – 38829Missing in isoform 5-HT4(G). VSP_001850Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y08756 mRNA. Translation: CAA70002.1.
Y12505 mRNA. Translation: CAA73107.1.
Y12506 mRNA. Translation: CAA73108.1.
Y12507 mRNA. Translation: CAA73109.1.
Y10437 mRNA. Translation: CAA71462.1.
Y13584 mRNA. Translation: CAA73911.1.
Y09586 mRNA. Translation: CAA70774.1.
AJ131724 mRNA. Translation: CAC20411.1.
AJ011371 mRNA. Translation: CAA09600.1.
AJ278979 mRNA. Translation: CAC22248.1.
AJ278980 mRNA. Translation: CAC22249.1.
AJ278981 mRNA. Translation: CAC22250.1.
AJ278982 mRNA. Translation: CAC22251.1.
AJ131725 mRNA. Translation: CAC79533.1.
AJ131726 mRNA. Translation: CAC79538.1.
AJ633645 mRNA. Translation: CAG17627.1.
AM712912 mRNA. Translation: CAN84676.1.
AC008627 Genomic DNA. No translation available.
AC011390 Genomic DNA. No translation available.
AC091971 Genomic DNA. No translation available.
AC114939 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61800.1.
CH471062 Genomic DNA. Translation: EAW61801.1.
CH471062 Genomic DNA. Translation: EAW61804.1.
BC074755 mRNA. Translation: AAH74755.1.
BC095497 mRNA. Translation: AAH95497.1.
AJ243213 Genomic DNA. Translation: CAB71316.1.
Z48150 mRNA. Translation: CAA88167.1.
CCDSiCCDS34270.1. [Q13639-2]
CCDS34271.1. [Q13639-5]
CCDS34272.1. [Q13639-8]
CCDS34273.2. [Q13639-3]
CCDS4291.1. [Q13639-1]
PIRiS66493.
RefSeqiNP_000861.1. NM_000870.6. [Q13639-1]
NP_001035259.1. NM_001040169.2. [Q13639-2]
NP_001035262.2. NM_001040172.2. [Q13639-3]
NP_001035263.1. NM_001040173.2. [Q13639-8]
NP_001273339.1. NM_001286410.1. [Q13639-9]
NP_955525.1. NM_199453.3. [Q13639-5]
UniGeneiHs.483773.

Genome annotation databases

EnsembliENST00000314512; ENSP00000314906; ENSG00000164270. [Q13639-5]
ENST00000354217; ENSP00000346156; ENSG00000164270. [Q13639-2]
ENST00000360693; ENSP00000353915; ENSG00000164270. [Q13639-8]
ENST00000362016; ENSP00000355037; ENSG00000164270. [Q13639-6]
ENST00000377888; ENSP00000367120; ENSG00000164270. [Q13639-1]
ENST00000517929; ENSP00000435904; ENSG00000164270. [Q13639-3]
ENST00000520514; ENSP00000427913; ENSG00000164270. [Q13639-9]
ENST00000521530; ENSP00000428320; ENSG00000164270. [Q13639-2]
ENST00000521735; ENSP00000430979; ENSG00000164270. [Q13639-5]
ENST00000522588; ENSP00000430874; ENSG00000164270. [Q13639-5]
GeneIDi3360.
KEGGihsa:3360.
UCSCiuc003lpn.3. human. [Q13639-1]
uc021yfg.1. human. [Q13639-5]
uc021yfh.1. human. [Q13639-2]
uc021yfi.1. human. [Q13639-3]
uc021yfj.1. human. [Q13639-8]

Polymorphism databases

DMDMi12644029.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
Y08756 mRNA. Translation: CAA70002.1 .
Y12505 mRNA. Translation: CAA73107.1 .
Y12506 mRNA. Translation: CAA73108.1 .
Y12507 mRNA. Translation: CAA73109.1 .
Y10437 mRNA. Translation: CAA71462.1 .
Y13584 mRNA. Translation: CAA73911.1 .
Y09586 mRNA. Translation: CAA70774.1 .
AJ131724 mRNA. Translation: CAC20411.1 .
AJ011371 mRNA. Translation: CAA09600.1 .
AJ278979 mRNA. Translation: CAC22248.1 .
AJ278980 mRNA. Translation: CAC22249.1 .
AJ278981 mRNA. Translation: CAC22250.1 .
AJ278982 mRNA. Translation: CAC22251.1 .
AJ131725 mRNA. Translation: CAC79533.1 .
AJ131726 mRNA. Translation: CAC79538.1 .
AJ633645 mRNA. Translation: CAG17627.1 .
AM712912 mRNA. Translation: CAN84676.1 .
AC008627 Genomic DNA. No translation available.
AC011390 Genomic DNA. No translation available.
AC091971 Genomic DNA. No translation available.
AC114939 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61800.1 .
CH471062 Genomic DNA. Translation: EAW61801.1 .
CH471062 Genomic DNA. Translation: EAW61804.1 .
BC074755 mRNA. Translation: AAH74755.1 .
BC095497 mRNA. Translation: AAH95497.1 .
AJ243213 Genomic DNA. Translation: CAB71316.1 .
Z48150 mRNA. Translation: CAA88167.1 .
CCDSi CCDS34270.1. [Q13639-2 ]
CCDS34271.1. [Q13639-5 ]
CCDS34272.1. [Q13639-8 ]
CCDS34273.2. [Q13639-3 ]
CCDS4291.1. [Q13639-1 ]
PIRi S66493.
RefSeqi NP_000861.1. NM_000870.6. [Q13639-1 ]
NP_001035259.1. NM_001040169.2. [Q13639-2 ]
NP_001035262.2. NM_001040172.2. [Q13639-3 ]
NP_001035263.1. NM_001040173.2. [Q13639-8 ]
NP_001273339.1. NM_001286410.1. [Q13639-9 ]
NP_955525.1. NM_199453.3. [Q13639-5 ]
UniGenei Hs.483773.

3D structure databases

ProteinModelPortali Q13639.
SMRi Q13639. Positions 25-328.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109592. 1 interaction.
MINTi MINT-1347413.

Chemistry

BindingDBi Q13639.
ChEMBLi CHEMBL1875.
DrugBanki DB00604. Cisapride.
DB00953. Rizatriptan.
DB01079. Tegaserod.
DB00315. Zolmitriptan.
GuidetoPHARMACOLOGYi 9.

Protein family/group databases

GPCRDBi Search...

PTM databases

PhosphoSitei Q13639.

Polymorphism databases

DMDMi 12644029.

Proteomic databases

PaxDbi Q13639.
PRIDEi Q13639.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000314512 ; ENSP00000314906 ; ENSG00000164270 . [Q13639-5 ]
ENST00000354217 ; ENSP00000346156 ; ENSG00000164270 . [Q13639-2 ]
ENST00000360693 ; ENSP00000353915 ; ENSG00000164270 . [Q13639-8 ]
ENST00000362016 ; ENSP00000355037 ; ENSG00000164270 . [Q13639-6 ]
ENST00000377888 ; ENSP00000367120 ; ENSG00000164270 . [Q13639-1 ]
ENST00000517929 ; ENSP00000435904 ; ENSG00000164270 . [Q13639-3 ]
ENST00000520514 ; ENSP00000427913 ; ENSG00000164270 . [Q13639-9 ]
ENST00000521530 ; ENSP00000428320 ; ENSG00000164270 . [Q13639-2 ]
ENST00000521735 ; ENSP00000430979 ; ENSG00000164270 . [Q13639-5 ]
ENST00000522588 ; ENSP00000430874 ; ENSG00000164270 . [Q13639-5 ]
GeneIDi 3360.
KEGGi hsa:3360.
UCSCi uc003lpn.3. human. [Q13639-1 ]
uc021yfg.1. human. [Q13639-5 ]
uc021yfh.1. human. [Q13639-2 ]
uc021yfi.1. human. [Q13639-3 ]
uc021yfj.1. human. [Q13639-8 ]

Organism-specific databases

CTDi 3360.
GeneCardsi GC05M147810.
H-InvDB HIX0078165.
HGNCi HGNC:5299. HTR4.
HPAi HPA040591.
MIMi 602164. gene.
neXtProti NX_Q13639.
PharmGKBi PA29557.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG262978.
HOGENOMi HOG000239242.
HOVERGENi HBG106962.
KOi K04160.
OMAi YRIYITA.
OrthoDBi EOG7CG707.
PhylomeDBi Q13639.
TreeFami TF316350.

Enzyme and pathway databases

Reactomei REACT_17064. Serotonin receptors.
REACT_19327. G alpha (s) signalling events.

Miscellaneous databases

GeneWikii 5-HT4_receptor.
GenomeRNAii 3360.
NextBioi 13288.
PROi Q13639.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13639.
Bgeei Q13639.
Genevestigatori Q13639.

Family and domain databases

Gene3Di 1.20.1070.10. 1 hit.
InterProi IPR001520. 5HT4_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view ]
PANTHERi PTHR24249:SF33. PTHR24249:SF33. 1 hit.
Pfami PF00001. 7tm_1. 1 hit.
[Graphical view ]
PRINTSi PR01059. 5HT4RECEPTR.
PR00237. GPCRRHODOPSN.
PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, expression, and pharmacology of four human 5-hydroxytryptamine 4 receptor isoforms produced by alternative splicing in the carboxyl terminus."
    Blondel O., Gastineau M., Dahmoune Y., Langlois M., Fischmeister R.
    J. Neurochem. 70:2252-2261(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(C) AND 5-HT4(D)).
    Tissue: Intestine.
  2. "Cloning and expression of 5-HT4 receptor species and splice variants."
    Van den Wyngaert I., Gommeren W., Jurzak M., Verhasselt P., Gordon R., Leysen J., Luyten W., Bender E.
    Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A) AND 5-HT4(B)).
    Tissue: Brain.
  3. "Cloning and expression of human 5-HT4S receptors. Effect of receptor density on their coupling to adenylyl cyclase."
    Claeysen S., Faye P., Sebben M., Lemaire S., Bockaert J., Dumuis A.
    NeuroReport 8:3189-3195(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(A)).
    Tissue: Heart.
  4. "Molecular cloning of the human serotonin receptor 5-HT4(b) and pharmacological comparison with the cloned human 5-HT4(a) receptor."
    Syversveen T., Bach T., Kvingedal A.M., Krobert K.A., Kaumann A.J., Levy F.O.
    Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(B)).
  5. "Novel brain-specific 5-HT4 receptor splice variants show marked constitutive activity: role of the C-terminal intracellular domain."
    Claeysen S., Sebben M., Becamel C., Bockaert J., Dumuis A.
    Mol. Pharmacol. 55:910-920(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(E)).
    Tissue: Brain.
  6. "Cloning and characterization of a novel human 5-HT4 receptor variant that lacks the alternatively spliced carboxy terminal exon. RT-PCR distribution in human brain and periphery of multiple 5-HT4 receptor variants."
    Vilaro M.T., Domenech T., Palacios J.M., Mengod G.
    Neuropharmacology 42:60-73(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(E) AND 5-HT4(G)).
    Tissue: Brain and Hippocampus.
  7. "Cloning, pharmacological characterisation and tissue distribution of a novel 5-HT4 receptor splice variant, 5-HT4(i)."
    Brattelid T., Kvingedal A.M., Krobert K.A., Andressen K.W., Bach T., Hystad M.E., Kaumann A.J., Levy F.O.
    Naunyn Schmiedebergs Arch. Pharmacol. 369:616-628(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(E) AND 5-HT4(I)), TISSUE SPECIFICITY.
  8. "Cloning, expression and characterisation of a novel rat 5-HT4 receptor splice variant (5-HT4c1)."
    Reid A.M., Kelsell R.E., Houp J.A., Kelly F.M., Medhurst A.D., Cox H.M., Calver A.R.
    Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4C1).
    Tissue: Small intestine.
  9. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5-HT4(B)).
  12. "Structure of the human serotonin 5-HT4 receptor gene and cloning of a novel 5-HT4 splice variant."
    Bender E., Pindon A., van Oers I., Zhang Y.B., Gommeren W., Verhasselt P., Jurzak M., Leysen J., Luyten W.
    J. Neurochem. 74:478-489(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 10-388 (ISOFORM 5-HT4(F)).
  13. "Expression of serotonin receptor mRNAs in blood vessels."
    Ullmer C., Schmuck K., Kalkman H.O., Luebbert H.
    FEBS Lett. 370:215-221(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 112-255.
    Tissue: Brain.
  14. Cited for: INTERACTION WITH GRK5, IDENTIFICATION BY MASS SPECTROMETRY.
  15. Cited for: VARIANT LEU-27.

Entry informationi

Entry namei5HT4R_HUMAN
AccessioniPrimary (citable) accession number: Q13639
Secondary accession number(s): C4WYH4
, Q546Q1, Q684M0, Q712M9, Q96KH9, Q96KI0, Q9H199, Q9NY73, Q9UBM6, Q9UBT4, Q9UE22, Q9UE23, Q9UQR6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: September 3, 2014
This is version 139 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi