Q13639 (5HT4R_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 126.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 5-hydroxytryptamine receptor 4 Short name=5-HT-4 Short name=5-HT4 Alternative name(s): Serotonin receptor 4 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 388 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. |
| Subunit structure | Isoform 5-HT4(A) interacts with MAGI2, MPP3, SLC9A3R1 and SNX27 isoforms 1 and 2. Isoform 5-HT4(E) interacts with INADL, NOS1 and SEC23A. Isoform 5-HT4(A) forms a complex including SLC9A3R1 and EZR By similarity. Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin). Ref.13 |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Endosome. Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli By similarity. |
| Tissue specificity | Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle. Ref.7 |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Endosome Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Lipoprotein Palmitate |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger Traceable author statement Ref.1. Source: ProtInc positive regulation of cell proliferationInferred from mutant phenotype PubMed 15925089. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from direct assay PubMed 15925089. Source: UniProtKB endosomeInferred from electronic annotation. Source: UniProtKB-SubCell integral to plasma membraneTraceable author statement PubMed 9276448. Source: ProtInc |
| Molecular_function | serotonin receptor activity Inferred from direct assay PubMed 16102731. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 5-HT4(B) (identifier: Q13639-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 5-HT4(A) (identifier: Q13639-2) Also known as: 5-HT4S; The sequence of this isoform differs from the canonical sequence as follows: 360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → YTVLHRGHHQELEKLPIHNDPESLESCF | ||||||
| Isoform 5-HT4(C) (identifier: Q13639-3) The sequence of this isoform differs from the canonical sequence as follows: 360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → F | ||||||
| Isoform 5-HT4(D) (identifier: Q13639-4) The sequence of this isoform differs from the canonical sequence as follows: 359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRRNFGIRKRRLTKPS | ||||||
| Isoform 5-HT4(E) (identifier: Q13639-5) Also known as: H5-HT4(g); The sequence of this isoform differs from the canonical sequence as follows: 359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SGCSPVSSFLLLFCNRPVPV | ||||||
| Note: Mainly expressed in atria and cardiac ventricle. | ||||||
| Isoform 5-HT4(F) (identifier: Q13639-6) The sequence of this isoform differs from the canonical sequence as follows: 169-169: L → LERSLNQGLGQDFHA | ||||||
| Isoform 5-HT4(G) (identifier: Q13639-7) The sequence of this isoform differs from the canonical sequence as follows: 360-388: Missing. | ||||||
| Isoform 5-HT4(I) (identifier: Q13639-8) The sequence of this isoform differs from the canonical sequence as follows: 359-359: R → RTDFLFDRDILARYWTKPARAGPFSGTLSIRCLTARKPVLG | ||||||
| Note: Expressed in all cardiovascular tissues analyzed. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 388 | 388 | 5-hydroxytryptamine receptor 4 | PRO_0000068965 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 19 | 19 | Extracellular By similarity | ||||||||
| Transmembrane | 20 – 40 | 21 | Helical; Name=1; By similarity | ||||||||
| Topological domain | 41 – 58 | 18 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 59 – 79 | 21 | Helical; Name=2; By similarity | ||||||||
| Topological domain | 80 – 93 | 14 | Extracellular By similarity | ||||||||
| Transmembrane | 94 – 116 | 23 | Helical; Name=3; By similarity | ||||||||
| Topological domain | 117 – 137 | 21 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 138 – 158 | 21 | Helical; Name=4; By similarity | ||||||||
| Topological domain | 159 – 192 | 34 | Extracellular By similarity | ||||||||
| Transmembrane | 193 – 213 | 21 | Helical; Name=5; By similarity | ||||||||
| Topological domain | 214 – 260 | 47 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 261 – 281 | 21 | Helical; Name=6; By similarity | ||||||||
| Topological domain | 282 – 294 | 13 | Extracellular By similarity | ||||||||
| Transmembrane | 295 – 315 | 21 | Helical; Name=7; By similarity | ||||||||
| Topological domain | 316 – 388 | 73 | Cytoplasmic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Lipidation | 329 | 1 | S-palmitoyl cysteine By similarity | ||||||||
| Glycosylation | 7 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 93 ↔ 184 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 169 | 1 | L → LERSLNQGLGQDFHA in isoform 5-HT4(F). | VSP_001845 | |||||||
| Alternative sequence | 359 – 388 | 30 | RDAVE…QPSDT → SSGTETDRRNFGIRKRRLTK PS in isoform 5-HT4(D). | VSP_001847 | |||||||
| Alternative sequence | 359 – 388 | 30 | RDAVE…QPSDT → SGCSPVSSFLLLFCNRPVPV in isoform 5-HT4(E). | VSP_001846 | |||||||
| Alternative sequence | 359 | 1 | R → RTDFLFDRDILARYWTKPAR AGPFSGTLSIRCLTARKPVL G in isoform 5-HT4(I). | VSP_043316 | |||||||
| Alternative sequence | 360 – 388 | 29 | DAVEC…QPSDT → YTVLHRGHHQELEKLPIHND PESLESCF in isoform 5-HT4(A). | VSP_001849 | |||||||
| Alternative sequence | 360 – 388 | 29 | DAVEC…QPSDT → F in isoform 5-HT4(C). | VSP_001848 | |||||||
| Alternative sequence | 360 – 388 | 29 | Missing in isoform 5-HT4(G). | VSP_001850 | |||||||
| Natural variant | 27 | 1 | S → L in a patient with diffuse leukoencephalopathy with spheroids; unknown pathological significance. Ref.14 | VAR_067412 | |||||||
| Natural variant | 372 | 1 | C → Y. Corresponds to variant rs34826744 [ dbSNP | Ensembl ]. | VAR_049364 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, expression, and pharmacology of four human 5-hydroxytryptamine 4 receptor isoforms produced by alternative splicing in the carboxyl terminus." Blondel O., Gastineau M., Dahmoune Y., Langlois M., Fischmeister R. J. Neurochem. 70:2252-2261(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(C) AND 5-HT4(D)). Tissue: Intestine. |
| [2] | "Cloning and expression of 5-HT4 receptor species and splice variants." Van den Wyngaert I., Gommeren W., Jurzak M., Verhasselt P., Gordon R., Leysen J., Luyten W., Bender E. Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A) AND 5-HT4(B)). Tissue: Brain. |
| [3] | "Cloning and expression of human 5-HT4S receptors. Effect of receptor density on their coupling to adenylyl cyclase." Claeysen S., Faye P., Sebben M., Lemaire S., Bockaert J., Dumuis A. NeuroReport 8:3189-3195(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(A)). Tissue: Heart. |
| [4] | "Molecular cloning of the human serotonin receptor 5-HT4(b) and pharmacological comparison with the cloned human 5-HT4(a) receptor." Syversveen T., Bach T., Kvingedal A.M., Krobert K.A., Kaumann A.J., Levy F.O. Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(B)). |
| [5] | "Novel brain-specific 5-HT4 receptor splice variants show marked constitutive activity: role of the C-terminal intracellular domain." Claeysen S., Sebben M., Becamel C., Bockaert J., Dumuis A. Mol. Pharmacol. 55:910-920(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(E)). Tissue: Brain. |
| [6] | "Cloning and characterization of a novel human 5-HT4 receptor variant that lacks the alternatively spliced carboxy terminal exon. RT-PCR distribution in human brain and periphery of multiple 5-HT4 receptor variants." Vilaro M.T., Domenech T., Palacios J.M., Mengod G. Neuropharmacology 42:60-73(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(E) AND 5-HT4(G)). Tissue: Brain and Hippocampus. |
| [7] | "Cloning, pharmacological characterisation and tissue distribution of a novel 5-HT4 receptor splice variant, 5-HT4(i)." Brattelid T., Kvingedal A.M., Krobert K.A., Andressen K.W., Bach T., Hystad M.E., Kaumann A.J., Levy F.O. Naunyn Schmiedebergs Arch. Pharmacol. 369:616-628(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(E) AND 5-HT4(I)), TISSUE SPECIFICITY. |
| [8] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5-HT4(B)). |
| [11] | "Structure of the human serotonin 5-HT4 receptor gene and cloning of a novel 5-HT4 splice variant." Bender E., Pindon A., van Oers I., Zhang Y.B., Gommeren W., Verhasselt P., Jurzak M., Leysen J., Luyten W. J. Neurochem. 74:478-489(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 10-388 (ISOFORM 5-HT4(F)). |
| [12] | "Expression of serotonin receptor mRNAs in blood vessels." Ullmer C., Schmuck K., Kalkman H.O., Luebbert H. FEBS Lett. 370:215-221(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 112-255. Tissue: Brain. |
| [13] | "Beta-arrestin1 phosphorylation by GRK5 regulates G protein-independent 5-HT4 receptor signalling." Barthet G., Carrat G., Cassier E., Barker B., Gaven F., Pillot M., Framery B., Pellissier L.P., Augier J., Kang D.S., Claeysen S., Reiter E., Baneres J.L., Benovic J.L., Marin P., Bockaert J., Dumuis A. EMBO J. 28:2706-2718(2009) [PubMed] [Europe PMC] [Abstract] Cited for: MASS SPECTROMETRY, INTERACTION WITH GRK5. |
| [14] | "Mutations in the colony stimulating factor 1 receptor (CSF1R) gene cause hereditary diffuse leukoencephalopathy with spheroids." Rademakers R., Baker M., Nicholson A.M., Rutherford N.J., Finch N., Soto-Ortolaza A., Lash J., Wider C., Wojtas A., DeJesus-Hernandez M., Adamson J., Kouri N., Sundal C., Shuster E.A., Aasly J., MacKenzie J., Roeber S., Kretzschmar H.A. Wszolek Z.K.Nat. Genet. 44:200-205(2012) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LEU-27. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y08756 mRNA. Translation: CAA70002.1. Y12505 mRNA. Translation: CAA73107.1. Y12506 mRNA. Translation: CAA73108.1. Y12507 mRNA. Translation: CAA73109.1. Y10437 mRNA. Translation: CAA71462.1. Y13584 mRNA. Translation: CAA73911.1. Y09586 mRNA. Translation: CAA70774.1. AJ131724 mRNA. Translation: CAC20411.1. AJ011371 mRNA. Translation: CAA09600.1. AJ278979 mRNA. Translation: CAC22248.1. AJ278980 mRNA. Translation: CAC22249.1. AJ278981 mRNA. Translation: CAC22250.1. AJ278982 mRNA. Translation: CAC22251.1. AJ131725 mRNA. Translation: CAC79533.1. AJ131726 mRNA. Translation: CAC79538.1. AJ633645 mRNA. Translation: CAG17627.1. AC008627 Genomic DNA. No translation available. AC011390 Genomic DNA. No translation available. AC091971 Genomic DNA. No translation available. AC114939 Genomic DNA. No translation available. CH471062 Genomic DNA. Translation: EAW61800.1. CH471062 Genomic DNA. Translation: EAW61801.1. CH471062 Genomic DNA. Translation: EAW61804.1. BC074755 mRNA. Translation: AAH74755.1. BC095497 mRNA. Translation: AAH95497.1. AJ243213 Genomic DNA. Translation: CAB71316.1. Z48150 mRNA. Translation: CAA88167.1. |
| IPI | IPI00014378. IPI00064638. IPI00186777. IPI00216427. IPI00216428. IPI00216429. IPI00291659. IPI00748585. |
| PIR | S66493. |
| RefSeq | NP_000861.1. NM_000870.5. NP_001035259.1. NM_001040169.2. NP_001035262.2. NM_001040172.2. NP_001035263.1. NM_001040173.2. NP_955525.1. NM_199453.3. |
| UniGene | Hs.483773. |
3D structure databases | |
| ProteinModelPortal | Q13639. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1347413. |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | Q13639. |
Polymorphism databases | |
| DMDM | 12644029. |
Proteomic databases | |
| PaxDb | Q13639. |
| PRIDE | Q13639. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000314512; ENSP00000314906; ENSG00000164270. ENST00000354217; ENSP00000346156; ENSG00000164270. ENST00000360693; ENSP00000353915; ENSG00000164270. ENST00000362016; ENSP00000355037; ENSG00000164270. ENST00000377888; ENSP00000367120; ENSG00000164270. ENST00000517929; ENSP00000435904; ENSG00000164270. ENST00000521530; ENSP00000428320; ENSG00000164270. ENST00000521735; ENSP00000430979; ENSG00000164270. ENST00000522588; ENSP00000430874; ENSG00000164270. |
| GeneID | 3360. |
| KEGG | hsa:3360. |
| UCSC | uc003lpn.3. human. uc021yfh.1. human. uc021yfi.1. human. |
Organism-specific databases | |
| CTD | 3360. |
| GeneCards | GC05M147810. |
| H-InvDB | HIX0078165. |
| HGNC | HGNC:5299. HTR4. |
| HPA | HPA040591. |
| MIM | 602164. gene. |
| neXtProt | NX_Q13639. |
| PharmGKB | PA29557. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG262978. |
| HOGENOM | HOG000239242. |
| HOVERGEN | HBG106962. |
| KO | K04160. |
| OrthoDB | EOG4933HZ. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | Q13639. |
| Bgee | Q13639. |
| Genevestigator | Q13639. |
| GermOnline | ENSG00000164270. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001520. 5HT4_rcpt. IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. [Graphical view] |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR01059. 5HT4RECEPTR. PR00237. GPCRRHODOPSN. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q13639. |
| ChEMBL | CHEMBL1875. |
| DrugBank | DB00604. Cisapride. DB00953. Rizatriptan. DB01079. Tegaserod. DB00315. Zolmitriptan. |
| GenomeRNAi | 3360. |
| NextBio | 13288. |
| SOURCE | Search... |
Entry information
| Entry name | 5HT4R_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13639 Secondary accession number(s): Q546Q1 Q9UQR6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
