Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 4

Gene

HTR4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

GO - Molecular functioni

  • G-protein coupled serotonin receptor activity Source: MGI

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000164270-MONOMER.
ReactomeiR-HSA-390666. Serotonin receptors.
R-HSA-418555. G alpha (s) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 4
Short name:
5-HT-4
Short name:
5-HT4
Alternative name(s):
Serotonin receptor 4
Gene namesi
Name:HTR4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:5299. HTR4.

Subcellular locationi

  • Cell membrane; Multi-pass membrane protein
  • Endosome

  • Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli.By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 19ExtracellularBy similarityAdd BLAST19
Transmembranei20 – 40Helical; Name=1By similarityAdd BLAST21
Topological domaini41 – 58CytoplasmicBy similarityAdd BLAST18
Transmembranei59 – 79Helical; Name=2By similarityAdd BLAST21
Topological domaini80 – 93ExtracellularBy similarityAdd BLAST14
Transmembranei94 – 116Helical; Name=3By similarityAdd BLAST23
Topological domaini117 – 137CytoplasmicBy similarityAdd BLAST21
Transmembranei138 – 158Helical; Name=4By similarityAdd BLAST21
Topological domaini159 – 192ExtracellularBy similarityAdd BLAST34
Transmembranei193 – 213Helical; Name=5By similarityAdd BLAST21
Topological domaini214 – 260CytoplasmicBy similarityAdd BLAST47
Transmembranei261 – 281Helical; Name=6By similarityAdd BLAST21
Topological domaini282 – 294ExtracellularBy similarityAdd BLAST13
Transmembranei295 – 315Helical; Name=7By similarityAdd BLAST21
Topological domaini316 – 388CytoplasmicBy similarityAdd BLAST73

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • endosome Source: UniProtKB-SubCell
  • integral component of plasma membrane Source: ProtInc
  • membrane Source: MGI
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi3360.
OpenTargetsiENSG00000164270.
PharmGKBiPA29557.

Chemistry databases

ChEMBLiCHEMBL1875.
DrugBankiDB08810. Cinitapride.
DB00604. Cisapride.
DB01049. Ergoloid mesylate.
DB01233. Metoclopramide.
DB00904. Ondansetron.
DB06480. Prucalopride.
GuidetoPHARMACOLOGYi9.

Polymorphism and mutation databases

BioMutaiHTR4.
DMDMi12644029.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000689651 – 3885-hydroxytryptamine receptor 4Add BLAST388

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi7N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi93 ↔ 184PROSITE-ProRule annotation
Lipidationi329S-palmitoyl cysteineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PRIDEiQ13639.

PTM databases

iPTMnetiQ13639.
PhosphoSitePlusiQ13639.
SwissPalmiQ13639.

Expressioni

Tissue specificityi

Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.1 Publication

Gene expression databases

BgeeiENSG00000164270.
ExpressionAtlasiQ13639. baseline and differential.
GenevisibleiQ13639. HS.

Organism-specific databases

HPAiHPA040591.

Interactioni

Subunit structurei

Isoform 5-HT4(A) interacts with MAGI2, MPP3, SLC9A3R1 and SNX27 isoforms 1 and 2. Isoform 5-HT4(E) interacts with PATJ, NOS1 and SEC23A. Isoform 5-HT4(A) forms a complex including SLC9A3R1 and EZR (By similarity). Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin).By similarity1 Publication

Protein-protein interaction databases

MINTiMINT-1347413.

Chemistry databases

BindingDBiQ13639.

Structurei

3D structure databases

ProteinModelPortaliQ13639.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118774.
HOGENOMiHOG000239242.
HOVERGENiHBG106962.
InParanoidiQ13639.
KOiK04160.
OMAiYRIYITA.
OrthoDBiEOG091G06VI.
PhylomeDBiQ13639.
TreeFamiTF316350.

Family and domain databases

InterProiIPR001520. 5HT4_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PANTHERiPTHR24249:SF33. PTHR24249:SF33. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01059. 5HT4RECEPTR.
PR00237. GPCRRHODOPSN.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 5-HT4(B) (identifier: Q13639-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDKLDANVSS EEGFGSVEKV VLLTFLSTVI LMAILGNLLV MVAVCWDRQL
60 70 80 90 100
RKIKTNYFIV SLAFADLLVS VLVMPFGAIE LVQDIWIYGE VFCLVRTSLD
110 120 130 140 150
VLLTTASIFH LCCISLDRYY AICCQPLVYR NKMTPLRIAL MLGGCWVIPT
160 170 180 190 200
FISFLPIMQG WNNIGIIDLI EKRKFNQNSN STYCVFMVNK PYAITCSVVA
210 220 230 240 250
FYIPFLLMVL AYYRIYVTAK EHAHQIQMLQ RAGASSESRP QSADQHSTHR
260 270 280 290 300
MRTETKAAKT LCIIMGCFCL CWAPFFVTNI VDPFIDYTVP GQVWTAFLWL
310 320 330 340 350
GYINSGLNPF LYAFLNKSFR RAFLIILCCD DERYRRPSIL GQTVPCSTTT
360 370 380
INGSTHVLRD AVECGGQWES QCHPPATSPL VAAQPSDT
Length:388
Mass (Da):43,761
Last modified:January 11, 2001 - v2
Checksum:i7FCFEC60E7BDF560
GO
Isoform 5-HT4(A) (identifier: Q13639-2) [UniParc]FASTAAdd to basket
Also known as: 5-HT4S

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → YTVLHRGHHQELEKLPIHNDPESLESCF

Show »
Length:387
Mass (Da):44,109
Checksum:i43019BED75AC9D0F
GO
Isoform 5-HT4(C) (identifier: Q13639-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → F

Show »
Length:360
Mass (Da):40,944
Checksum:iF2BE6033F518178A
GO
Isoform 5-HT4(D) (identifier: Q13639-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRRNFGIRKRRLTKPS

Show »
Length:380
Mass (Da):43,186
Checksum:iC7591BFE6A9C1D62
GO
Isoform 5-HT4(E) (identifier: Q13639-5) [UniParc]FASTAAdd to basket
Also known as: H5-HT4(g)

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SGCSPVSSFLLLFCNRPVPV

Note: Mainly expressed in atria and cardiac ventricle.
Show »
Length:378
Mass (Da):42,746
Checksum:iE45038FEF832270D
GO
Isoform 5-HT4(F) (identifier: Q13639-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: L → LERSLNQGLGQDFHA

Show »
Length:402
Mass (Da):45,315
Checksum:i243F4AE87A6F77FA
GO
Isoform 5-HT4(G) (identifier: Q13639-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-388: Missing.

Show »
Length:359
Mass (Da):40,797
Checksum:iCE6033F518178AF3
GO
Isoform 5-HT4(I) (identifier: Q13639-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-359: R → RTDFLFDRDILARYWTKPARAGPFSGTLSIRCLTARKPVLG

Note: Expressed in all cardiovascular tissues analyzed.
Show »
Length:428
Mass (Da):48,255
Checksum:i463644AFC1C7D882
GO
Isoform 5-HT4c1 (identifier: Q13639-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRKK...GRKSCFREGK

Show »
Length:411
Mass (Da):46,907
Checksum:i7A842A2702C855D3
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06741227S → L in a patient with diffuse leukoencephalopathy with spheroids; unknown pathological significance. 1 PublicationCorresponds to variant rs199508638dbSNPEnsembl.1
Natural variantiVAR_049364372C → Y.Corresponds to variant rs34826744dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001845169L → LERSLNQGLGQDFHA in isoform 5-HT4(F). Curated1
Alternative sequenceiVSP_001847359 – 388RDAVE…QPSDT → SSGTETDRRNFGIRKRRLTK PS in isoform 5-HT4(D). CuratedAdd BLAST30
Alternative sequenceiVSP_001846359 – 388RDAVE…QPSDT → SGCSPVSSFLLLFCNRPVPV in isoform 5-HT4(E). CuratedAdd BLAST30
Alternative sequenceiVSP_047862359 – 388RDAVE…QPSDT → SSGTETDRKKLWNKEEKIDQ TIQMPKRKRKKKASLSYEDL ILLGRKSCFREGK in isoform 5-HT4c1. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_043316359R → RTDFLFDRDILARYWTKPAR AGPFSGTLSIRCLTARKPVL G in isoform 5-HT4(I). Curated1
Alternative sequenceiVSP_001849360 – 388DAVEC…QPSDT → YTVLHRGHHQELEKLPIHND PESLESCF in isoform 5-HT4(A). CuratedAdd BLAST29
Alternative sequenceiVSP_001848360 – 388DAVEC…QPSDT → F in isoform 5-HT4(C). CuratedAdd BLAST29
Alternative sequenceiVSP_001850360 – 388Missing in isoform 5-HT4(G). CuratedAdd BLAST29

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08756 mRNA. Translation: CAA70002.1.
Y12505 mRNA. Translation: CAA73107.1.
Y12506 mRNA. Translation: CAA73108.1.
Y12507 mRNA. Translation: CAA73109.1.
Y10437 mRNA. Translation: CAA71462.1.
Y13584 mRNA. Translation: CAA73911.1.
Y09586 mRNA. Translation: CAA70774.1.
AJ131724 mRNA. Translation: CAC20411.1.
AJ011371 mRNA. Translation: CAA09600.1.
AJ278979 mRNA. Translation: CAC22248.1.
AJ278980 mRNA. Translation: CAC22249.1.
AJ278981 mRNA. Translation: CAC22250.1.
AJ278982 mRNA. Translation: CAC22251.1.
AJ131725 mRNA. Translation: CAC79533.1.
AJ131726 mRNA. Translation: CAC79538.1.
AJ633645 mRNA. Translation: CAG17627.1.
AM712912 mRNA. Translation: CAN84676.1.
AC008627 Genomic DNA. No translation available.
AC011390 Genomic DNA. No translation available.
AC091971 Genomic DNA. No translation available.
AC114939 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61800.1.
CH471062 Genomic DNA. Translation: EAW61801.1.
CH471062 Genomic DNA. Translation: EAW61804.1.
BC074755 mRNA. Translation: AAH74755.1.
BC095497 mRNA. Translation: AAH95497.1.
AJ243213 Genomic DNA. Translation: CAB71316.1.
Z48150 mRNA. Translation: CAA88167.1.
CCDSiCCDS34270.1. [Q13639-2]
CCDS34271.1. [Q13639-5]
CCDS34272.1. [Q13639-8]
CCDS34273.2. [Q13639-3]
CCDS4291.1. [Q13639-1]
CCDS75353.1. [Q13639-9]
PIRiS66493.
RefSeqiNP_000861.1. NM_000870.6. [Q13639-1]
NP_001035259.1. NM_001040169.2. [Q13639-2]
NP_001035262.2. NM_001040172.2. [Q13639-3]
NP_001035263.1. NM_001040173.2. [Q13639-8]
NP_001273339.1. NM_001286410.1. [Q13639-9]
NP_955525.1. NM_199453.3. [Q13639-5]
UniGeneiHs.483773.

Genome annotation databases

EnsembliENST00000360693; ENSP00000353915; ENSG00000164270. [Q13639-8]
ENST00000362016; ENSP00000355037; ENSG00000164270. [Q13639-8]
ENST00000377888; ENSP00000367120; ENSG00000164270. [Q13639-1]
ENST00000517929; ENSP00000435904; ENSG00000164270. [Q13639-3]
ENST00000520514; ENSP00000427913; ENSG00000164270. [Q13639-9]
ENST00000521530; ENSP00000428320; ENSG00000164270. [Q13639-2]
ENST00000521735; ENSP00000430979; ENSG00000164270. [Q13639-5]
ENST00000522588; ENSP00000430874; ENSG00000164270. [Q13639-5]
ENST00000631296; ENSP00000485747; ENSG00000164270. [Q13639-1]
GeneIDi3360.
KEGGihsa:3360.
UCSCiuc003lpn.5. human. [Q13639-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08756 mRNA. Translation: CAA70002.1.
Y12505 mRNA. Translation: CAA73107.1.
Y12506 mRNA. Translation: CAA73108.1.
Y12507 mRNA. Translation: CAA73109.1.
Y10437 mRNA. Translation: CAA71462.1.
Y13584 mRNA. Translation: CAA73911.1.
Y09586 mRNA. Translation: CAA70774.1.
AJ131724 mRNA. Translation: CAC20411.1.
AJ011371 mRNA. Translation: CAA09600.1.
AJ278979 mRNA. Translation: CAC22248.1.
AJ278980 mRNA. Translation: CAC22249.1.
AJ278981 mRNA. Translation: CAC22250.1.
AJ278982 mRNA. Translation: CAC22251.1.
AJ131725 mRNA. Translation: CAC79533.1.
AJ131726 mRNA. Translation: CAC79538.1.
AJ633645 mRNA. Translation: CAG17627.1.
AM712912 mRNA. Translation: CAN84676.1.
AC008627 Genomic DNA. No translation available.
AC011390 Genomic DNA. No translation available.
AC091971 Genomic DNA. No translation available.
AC114939 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61800.1.
CH471062 Genomic DNA. Translation: EAW61801.1.
CH471062 Genomic DNA. Translation: EAW61804.1.
BC074755 mRNA. Translation: AAH74755.1.
BC095497 mRNA. Translation: AAH95497.1.
AJ243213 Genomic DNA. Translation: CAB71316.1.
Z48150 mRNA. Translation: CAA88167.1.
CCDSiCCDS34270.1. [Q13639-2]
CCDS34271.1. [Q13639-5]
CCDS34272.1. [Q13639-8]
CCDS34273.2. [Q13639-3]
CCDS4291.1. [Q13639-1]
CCDS75353.1. [Q13639-9]
PIRiS66493.
RefSeqiNP_000861.1. NM_000870.6. [Q13639-1]
NP_001035259.1. NM_001040169.2. [Q13639-2]
NP_001035262.2. NM_001040172.2. [Q13639-3]
NP_001035263.1. NM_001040173.2. [Q13639-8]
NP_001273339.1. NM_001286410.1. [Q13639-9]
NP_955525.1. NM_199453.3. [Q13639-5]
UniGeneiHs.483773.

3D structure databases

ProteinModelPortaliQ13639.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-1347413.

Chemistry databases

BindingDBiQ13639.
ChEMBLiCHEMBL1875.
DrugBankiDB08810. Cinitapride.
DB00604. Cisapride.
DB01049. Ergoloid mesylate.
DB01233. Metoclopramide.
DB00904. Ondansetron.
DB06480. Prucalopride.
GuidetoPHARMACOLOGYi9.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiQ13639.
PhosphoSitePlusiQ13639.
SwissPalmiQ13639.

Polymorphism and mutation databases

BioMutaiHTR4.
DMDMi12644029.

Proteomic databases

PRIDEiQ13639.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360693; ENSP00000353915; ENSG00000164270. [Q13639-8]
ENST00000362016; ENSP00000355037; ENSG00000164270. [Q13639-8]
ENST00000377888; ENSP00000367120; ENSG00000164270. [Q13639-1]
ENST00000517929; ENSP00000435904; ENSG00000164270. [Q13639-3]
ENST00000520514; ENSP00000427913; ENSG00000164270. [Q13639-9]
ENST00000521530; ENSP00000428320; ENSG00000164270. [Q13639-2]
ENST00000521735; ENSP00000430979; ENSG00000164270. [Q13639-5]
ENST00000522588; ENSP00000430874; ENSG00000164270. [Q13639-5]
ENST00000631296; ENSP00000485747; ENSG00000164270. [Q13639-1]
GeneIDi3360.
KEGGihsa:3360.
UCSCiuc003lpn.5. human. [Q13639-1]

Organism-specific databases

CTDi3360.
DisGeNETi3360.
GeneCardsiHTR4.
H-InvDBHIX0078165.
HGNCiHGNC:5299. HTR4.
HPAiHPA040591.
MIMi602164. gene.
neXtProtiNX_Q13639.
OpenTargetsiENSG00000164270.
PharmGKBiPA29557.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118774.
HOGENOMiHOG000239242.
HOVERGENiHBG106962.
InParanoidiQ13639.
KOiK04160.
OMAiYRIYITA.
OrthoDBiEOG091G06VI.
PhylomeDBiQ13639.
TreeFamiTF316350.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000164270-MONOMER.
ReactomeiR-HSA-390666. Serotonin receptors.
R-HSA-418555. G alpha (s) signalling events.

Miscellaneous databases

GeneWikii5-HT4_receptor.
GenomeRNAii3360.
PROiQ13639.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000164270.
ExpressionAtlasiQ13639. baseline and differential.
GenevisibleiQ13639. HS.

Family and domain databases

InterProiIPR001520. 5HT4_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PANTHERiPTHR24249:SF33. PTHR24249:SF33. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01059. 5HT4RECEPTR.
PR00237. GPCRRHODOPSN.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry namei5HT4R_HUMAN
AccessioniPrimary (citable) accession number: Q13639
Secondary accession number(s): C4WYH4
, Q546Q1, Q684M0, Q712M9, Q96KH9, Q96KI0, Q9H199, Q9NY73, Q9UBM6, Q9UBT4, Q9UE22, Q9UE23, Q9UQR6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: November 2, 2016
This is version 159 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.