Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13639

- 5HT4R_HUMAN

UniProt

Q13639 - 5HT4R_HUMAN

Protein

5-hydroxytryptamine receptor 4

Gene

HTR4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 140 (01 Oct 2014)
      Sequence version 2 (11 Jan 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

    GO - Molecular functioni

    1. serotonin receptor activity Source: MGI

    GO - Biological processi

    1. G-protein coupled receptor signaling pathway Source: ProtInc
    2. G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger Source: ProtInc
    3. positive regulation of cell proliferation Source: UniProtKB
    4. regulation of appetite Source: InterPro
    5. serotonin receptor signaling pathway Source: GOC
    6. synaptic transmission Source: InterPro

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Enzyme and pathway databases

    ReactomeiREACT_17064. Serotonin receptors.
    REACT_19327. G alpha (s) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    5-hydroxytryptamine receptor 4
    Short name:
    5-HT-4
    Short name:
    5-HT4
    Alternative name(s):
    Serotonin receptor 4
    Gene namesi
    Name:HTR4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:5299. HTR4.

    Subcellular locationi

    Cell membrane; Multi-pass membrane protein. Endosome
    Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. endosome Source: UniProtKB-SubCell
    3. integral component of plasma membrane Source: ProtInc
    4. membrane Source: MGI
    5. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Endosome, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA29557.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 3883885-hydroxytryptamine receptor 4PRO_0000068965Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi7 – 71N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi93 ↔ 184PROSITE-ProRule annotation
    Lipidationi329 – 3291S-palmitoyl cysteineBy similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

    Proteomic databases

    PaxDbiQ13639.
    PRIDEiQ13639.

    PTM databases

    PhosphoSiteiQ13639.

    Expressioni

    Tissue specificityi

    Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.1 Publication

    Gene expression databases

    ArrayExpressiQ13639.
    BgeeiQ13639.
    GenevestigatoriQ13639.

    Organism-specific databases

    HPAiHPA040591.

    Interactioni

    Subunit structurei

    Isoform 5-HT4(A) interacts with MAGI2, MPP3, SLC9A3R1 and SNX27 isoforms 1 and 2. Isoform 5-HT4(E) interacts with INADL, NOS1 and SEC23A. Isoform 5-HT4(A) forms a complex including SLC9A3R1 and EZR By similarity. Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin).By similarity1 Publication

    Protein-protein interaction databases

    BioGridi109592. 1 interaction.
    MINTiMINT-1347413.

    Structurei

    3D structure databases

    ProteinModelPortaliQ13639.
    SMRiQ13639. Positions 25-328.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1919ExtracellularBy similarityAdd
    BLAST
    Topological domaini41 – 5818CytoplasmicBy similarityAdd
    BLAST
    Topological domaini80 – 9314ExtracellularBy similarityAdd
    BLAST
    Topological domaini117 – 13721CytoplasmicBy similarityAdd
    BLAST
    Topological domaini159 – 19234ExtracellularBy similarityAdd
    BLAST
    Topological domaini214 – 26047CytoplasmicBy similarityAdd
    BLAST
    Topological domaini282 – 29413ExtracellularBy similarityAdd
    BLAST
    Topological domaini316 – 38873CytoplasmicBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei20 – 4021Helical; Name=1By similarityAdd
    BLAST
    Transmembranei59 – 7921Helical; Name=2By similarityAdd
    BLAST
    Transmembranei94 – 11623Helical; Name=3By similarityAdd
    BLAST
    Transmembranei138 – 15821Helical; Name=4By similarityAdd
    BLAST
    Transmembranei193 – 21321Helical; Name=5By similarityAdd
    BLAST
    Transmembranei261 – 28121Helical; Name=6By similarityAdd
    BLAST
    Transmembranei295 – 31521Helical; Name=7By similarityAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG262978.
    HOGENOMiHOG000239242.
    HOVERGENiHBG106962.
    KOiK04160.
    OMAiYRIYITA.
    OrthoDBiEOG7CG707.
    PhylomeDBiQ13639.
    TreeFamiTF316350.

    Family and domain databases

    Gene3Di1.20.1070.10. 1 hit.
    InterProiIPR001520. 5HT4_rcpt.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view]
    PANTHERiPTHR24249:SF33. PTHR24249:SF33. 1 hit.
    PfamiPF00001. 7tm_1. 1 hit.
    [Graphical view]
    PRINTSiPR01059. 5HT4RECEPTR.
    PR00237. GPCRRHODOPSN.
    PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 5-HT4(B) (identifier: Q13639-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDKLDANVSS EEGFGSVEKV VLLTFLSTVI LMAILGNLLV MVAVCWDRQL    50
    RKIKTNYFIV SLAFADLLVS VLVMPFGAIE LVQDIWIYGE VFCLVRTSLD 100
    VLLTTASIFH LCCISLDRYY AICCQPLVYR NKMTPLRIAL MLGGCWVIPT 150
    FISFLPIMQG WNNIGIIDLI EKRKFNQNSN STYCVFMVNK PYAITCSVVA 200
    FYIPFLLMVL AYYRIYVTAK EHAHQIQMLQ RAGASSESRP QSADQHSTHR 250
    MRTETKAAKT LCIIMGCFCL CWAPFFVTNI VDPFIDYTVP GQVWTAFLWL 300
    GYINSGLNPF LYAFLNKSFR RAFLIILCCD DERYRRPSIL GQTVPCSTTT 350
    INGSTHVLRD AVECGGQWES QCHPPATSPL VAAQPSDT 388
    Length:388
    Mass (Da):43,761
    Last modified:January 11, 2001 - v2
    Checksum:i7FCFEC60E7BDF560
    GO
    Isoform 5-HT4(A) (identifier: Q13639-2) [UniParc]FASTAAdd to Basket

    Also known as: 5-HT4S

    The sequence of this isoform differs from the canonical sequence as follows:
         360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → YTVLHRGHHQELEKLPIHNDPESLESCF

    Show »
    Length:387
    Mass (Da):44,109
    Checksum:i43019BED75AC9D0F
    GO
    Isoform 5-HT4(C) (identifier: Q13639-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-388: DAVECGGQWESQCHPPATSPLVAAQPSDT → F

    Show »
    Length:360
    Mass (Da):40,944
    Checksum:iF2BE6033F518178A
    GO
    Isoform 5-HT4(D) (identifier: Q13639-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRRNFGIRKRRLTKPS

    Show »
    Length:380
    Mass (Da):43,186
    Checksum:iC7591BFE6A9C1D62
    GO
    Isoform 5-HT4(E) (identifier: Q13639-5) [UniParc]FASTAAdd to Basket

    Also known as: H5-HT4(g)

    The sequence of this isoform differs from the canonical sequence as follows:
         359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SGCSPVSSFLLLFCNRPVPV

    Note: Mainly expressed in atria and cardiac ventricle.

    Show »
    Length:378
    Mass (Da):42,746
    Checksum:iE45038FEF832270D
    GO
    Isoform 5-HT4(F) (identifier: Q13639-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         169-169: L → LERSLNQGLGQDFHA

    Show »
    Length:402
    Mass (Da):45,315
    Checksum:i243F4AE87A6F77FA
    GO
    Isoform 5-HT4(G) (identifier: Q13639-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         360-388: Missing.

    Show »
    Length:359
    Mass (Da):40,797
    Checksum:iCE6033F518178AF3
    GO
    Isoform 5-HT4(I) (identifier: Q13639-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         359-359: R → RTDFLFDRDILARYWTKPARAGPFSGTLSIRCLTARKPVLG

    Note: Expressed in all cardiovascular tissues analyzed.

    Show »
    Length:428
    Mass (Da):48,255
    Checksum:i463644AFC1C7D882
    GO
    Isoform 5-HT4c1 (identifier: Q13639-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         359-388: RDAVECGGQWESQCHPPATSPLVAAQPSDT → SSGTETDRKK...GRKSCFREGK

    Show »
    Length:411
    Mass (Da):46,907
    Checksum:i7A842A2702C855D3
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti27 – 271S → L in a patient with diffuse leukoencephalopathy with spheroids; unknown pathological significance. 1 Publication
    VAR_067412
    Natural varianti372 – 3721C → Y.
    Corresponds to variant rs34826744 [ dbSNP | Ensembl ].
    VAR_049364

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei169 – 1691L → LERSLNQGLGQDFHA in isoform 5-HT4(F). CuratedVSP_001845
    Alternative sequencei359 – 38830RDAVE…QPSDT → SSGTETDRRNFGIRKRRLTK PS in isoform 5-HT4(D). CuratedVSP_001847Add
    BLAST
    Alternative sequencei359 – 38830RDAVE…QPSDT → SGCSPVSSFLLLFCNRPVPV in isoform 5-HT4(E). CuratedVSP_001846Add
    BLAST
    Alternative sequencei359 – 38830RDAVE…QPSDT → SSGTETDRKKLWNKEEKIDQ TIQMPKRKRKKKASLSYEDL ILLGRKSCFREGK in isoform 5-HT4c1. 1 PublicationVSP_047862Add
    BLAST
    Alternative sequencei359 – 3591R → RTDFLFDRDILARYWTKPAR AGPFSGTLSIRCLTARKPVL G in isoform 5-HT4(I). CuratedVSP_043316
    Alternative sequencei360 – 38829DAVEC…QPSDT → YTVLHRGHHQELEKLPIHND PESLESCF in isoform 5-HT4(A). CuratedVSP_001849Add
    BLAST
    Alternative sequencei360 – 38829DAVEC…QPSDT → F in isoform 5-HT4(C). CuratedVSP_001848Add
    BLAST
    Alternative sequencei360 – 38829Missing in isoform 5-HT4(G). CuratedVSP_001850Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y08756 mRNA. Translation: CAA70002.1.
    Y12505 mRNA. Translation: CAA73107.1.
    Y12506 mRNA. Translation: CAA73108.1.
    Y12507 mRNA. Translation: CAA73109.1.
    Y10437 mRNA. Translation: CAA71462.1.
    Y13584 mRNA. Translation: CAA73911.1.
    Y09586 mRNA. Translation: CAA70774.1.
    AJ131724 mRNA. Translation: CAC20411.1.
    AJ011371 mRNA. Translation: CAA09600.1.
    AJ278979 mRNA. Translation: CAC22248.1.
    AJ278980 mRNA. Translation: CAC22249.1.
    AJ278981 mRNA. Translation: CAC22250.1.
    AJ278982 mRNA. Translation: CAC22251.1.
    AJ131725 mRNA. Translation: CAC79533.1.
    AJ131726 mRNA. Translation: CAC79538.1.
    AJ633645 mRNA. Translation: CAG17627.1.
    AM712912 mRNA. Translation: CAN84676.1.
    AC008627 Genomic DNA. No translation available.
    AC011390 Genomic DNA. No translation available.
    AC091971 Genomic DNA. No translation available.
    AC114939 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW61800.1.
    CH471062 Genomic DNA. Translation: EAW61801.1.
    CH471062 Genomic DNA. Translation: EAW61804.1.
    BC074755 mRNA. Translation: AAH74755.1.
    BC095497 mRNA. Translation: AAH95497.1.
    AJ243213 Genomic DNA. Translation: CAB71316.1.
    Z48150 mRNA. Translation: CAA88167.1.
    CCDSiCCDS34270.1. [Q13639-2]
    CCDS34271.1. [Q13639-5]
    CCDS34272.1. [Q13639-8]
    CCDS34273.2. [Q13639-3]
    CCDS4291.1. [Q13639-1]
    PIRiS66493.
    RefSeqiNP_000861.1. NM_000870.6. [Q13639-1]
    NP_001035259.1. NM_001040169.2. [Q13639-2]
    NP_001035262.2. NM_001040172.2. [Q13639-3]
    NP_001035263.1. NM_001040173.2. [Q13639-8]
    NP_001273339.1. NM_001286410.1. [Q13639-9]
    NP_955525.1. NM_199453.3. [Q13639-5]
    UniGeneiHs.483773.

    Genome annotation databases

    EnsembliENST00000360693; ENSP00000353915; ENSG00000164270. [Q13639-8]
    ENST00000362016; ENSP00000355037; ENSG00000164270. [Q13639-6]
    ENST00000377888; ENSP00000367120; ENSG00000164270. [Q13639-1]
    ENST00000517929; ENSP00000435904; ENSG00000164270. [Q13639-3]
    ENST00000520514; ENSP00000427913; ENSG00000164270. [Q13639-9]
    ENST00000521530; ENSP00000428320; ENSG00000164270. [Q13639-2]
    ENST00000521735; ENSP00000430979; ENSG00000164270. [Q13639-5]
    ENST00000522588; ENSP00000430874; ENSG00000164270. [Q13639-5]
    GeneIDi3360.
    KEGGihsa:3360.
    UCSCiuc003lpn.3. human. [Q13639-1]
    uc021yfg.1. human. [Q13639-5]
    uc021yfh.1. human. [Q13639-2]
    uc021yfi.1. human. [Q13639-3]
    uc021yfj.1. human. [Q13639-8]

    Polymorphism databases

    DMDMi12644029.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y08756 mRNA. Translation: CAA70002.1 .
    Y12505 mRNA. Translation: CAA73107.1 .
    Y12506 mRNA. Translation: CAA73108.1 .
    Y12507 mRNA. Translation: CAA73109.1 .
    Y10437 mRNA. Translation: CAA71462.1 .
    Y13584 mRNA. Translation: CAA73911.1 .
    Y09586 mRNA. Translation: CAA70774.1 .
    AJ131724 mRNA. Translation: CAC20411.1 .
    AJ011371 mRNA. Translation: CAA09600.1 .
    AJ278979 mRNA. Translation: CAC22248.1 .
    AJ278980 mRNA. Translation: CAC22249.1 .
    AJ278981 mRNA. Translation: CAC22250.1 .
    AJ278982 mRNA. Translation: CAC22251.1 .
    AJ131725 mRNA. Translation: CAC79533.1 .
    AJ131726 mRNA. Translation: CAC79538.1 .
    AJ633645 mRNA. Translation: CAG17627.1 .
    AM712912 mRNA. Translation: CAN84676.1 .
    AC008627 Genomic DNA. No translation available.
    AC011390 Genomic DNA. No translation available.
    AC091971 Genomic DNA. No translation available.
    AC114939 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW61800.1 .
    CH471062 Genomic DNA. Translation: EAW61801.1 .
    CH471062 Genomic DNA. Translation: EAW61804.1 .
    BC074755 mRNA. Translation: AAH74755.1 .
    BC095497 mRNA. Translation: AAH95497.1 .
    AJ243213 Genomic DNA. Translation: CAB71316.1 .
    Z48150 mRNA. Translation: CAA88167.1 .
    CCDSi CCDS34270.1. [Q13639-2 ]
    CCDS34271.1. [Q13639-5 ]
    CCDS34272.1. [Q13639-8 ]
    CCDS34273.2. [Q13639-3 ]
    CCDS4291.1. [Q13639-1 ]
    PIRi S66493.
    RefSeqi NP_000861.1. NM_000870.6. [Q13639-1 ]
    NP_001035259.1. NM_001040169.2. [Q13639-2 ]
    NP_001035262.2. NM_001040172.2. [Q13639-3 ]
    NP_001035263.1. NM_001040173.2. [Q13639-8 ]
    NP_001273339.1. NM_001286410.1. [Q13639-9 ]
    NP_955525.1. NM_199453.3. [Q13639-5 ]
    UniGenei Hs.483773.

    3D structure databases

    ProteinModelPortali Q13639.
    SMRi Q13639. Positions 25-328.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109592. 1 interaction.
    MINTi MINT-1347413.

    Chemistry

    BindingDBi Q13639.
    ChEMBLi CHEMBL1875.
    DrugBanki DB00604. Cisapride.
    DB00953. Rizatriptan.
    DB01079. Tegaserod.
    DB00315. Zolmitriptan.
    GuidetoPHARMACOLOGYi 9.

    Protein family/group databases

    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q13639.

    Polymorphism databases

    DMDMi 12644029.

    Proteomic databases

    PaxDbi Q13639.
    PRIDEi Q13639.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000360693 ; ENSP00000353915 ; ENSG00000164270 . [Q13639-8 ]
    ENST00000362016 ; ENSP00000355037 ; ENSG00000164270 . [Q13639-6 ]
    ENST00000377888 ; ENSP00000367120 ; ENSG00000164270 . [Q13639-1 ]
    ENST00000517929 ; ENSP00000435904 ; ENSG00000164270 . [Q13639-3 ]
    ENST00000520514 ; ENSP00000427913 ; ENSG00000164270 . [Q13639-9 ]
    ENST00000521530 ; ENSP00000428320 ; ENSG00000164270 . [Q13639-2 ]
    ENST00000521735 ; ENSP00000430979 ; ENSG00000164270 . [Q13639-5 ]
    ENST00000522588 ; ENSP00000430874 ; ENSG00000164270 . [Q13639-5 ]
    GeneIDi 3360.
    KEGGi hsa:3360.
    UCSCi uc003lpn.3. human. [Q13639-1 ]
    uc021yfg.1. human. [Q13639-5 ]
    uc021yfh.1. human. [Q13639-2 ]
    uc021yfi.1. human. [Q13639-3 ]
    uc021yfj.1. human. [Q13639-8 ]

    Organism-specific databases

    CTDi 3360.
    GeneCardsi GC05M147810.
    H-InvDB HIX0078165.
    HGNCi HGNC:5299. HTR4.
    HPAi HPA040591.
    MIMi 602164. gene.
    neXtProti NX_Q13639.
    PharmGKBi PA29557.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG262978.
    HOGENOMi HOG000239242.
    HOVERGENi HBG106962.
    KOi K04160.
    OMAi YRIYITA.
    OrthoDBi EOG7CG707.
    PhylomeDBi Q13639.
    TreeFami TF316350.

    Enzyme and pathway databases

    Reactomei REACT_17064. Serotonin receptors.
    REACT_19327. G alpha (s) signalling events.

    Miscellaneous databases

    GeneWikii 5-HT4_receptor.
    GenomeRNAii 3360.
    NextBioi 13288.
    PROi Q13639.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13639.
    Bgeei Q13639.
    Genevestigatori Q13639.

    Family and domain databases

    Gene3Di 1.20.1070.10. 1 hit.
    InterProi IPR001520. 5HT4_rcpt.
    IPR000276. GPCR_Rhodpsn.
    IPR017452. GPCR_Rhodpsn_7TM.
    [Graphical view ]
    PANTHERi PTHR24249:SF33. PTHR24249:SF33. 1 hit.
    Pfami PF00001. 7tm_1. 1 hit.
    [Graphical view ]
    PRINTSi PR01059. 5HT4RECEPTR.
    PR00237. GPCRRHODOPSN.
    PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
    PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, expression, and pharmacology of four human 5-hydroxytryptamine 4 receptor isoforms produced by alternative splicing in the carboxyl terminus."
      Blondel O., Gastineau M., Dahmoune Y., Langlois M., Fischmeister R.
      J. Neurochem. 70:2252-2261(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(C) AND 5-HT4(D)).
      Tissue: Intestine.
    2. "Cloning and expression of 5-HT4 receptor species and splice variants."
      Van den Wyngaert I., Gommeren W., Jurzak M., Verhasselt P., Gordon R., Leysen J., Luyten W., Bender E.
      Submitted (JUN-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A) AND 5-HT4(B)).
      Tissue: Brain.
    3. "Cloning and expression of human 5-HT4S receptors. Effect of receptor density on their coupling to adenylyl cyclase."
      Claeysen S., Faye P., Sebben M., Lemaire S., Bockaert J., Dumuis A.
      NeuroReport 8:3189-3195(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(A)).
      Tissue: Heart.
    4. "Molecular cloning of the human serotonin receptor 5-HT4(b) and pharmacological comparison with the cloned human 5-HT4(a) receptor."
      Syversveen T., Bach T., Kvingedal A.M., Krobert K.A., Kaumann A.J., Levy F.O.
      Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(B)).
    5. "Novel brain-specific 5-HT4 receptor splice variants show marked constitutive activity: role of the C-terminal intracellular domain."
      Claeysen S., Sebben M., Becamel C., Bockaert J., Dumuis A.
      Mol. Pharmacol. 55:910-920(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(E)).
      Tissue: Brain.
    6. "Cloning and characterization of a novel human 5-HT4 receptor variant that lacks the alternatively spliced carboxy terminal exon. RT-PCR distribution in human brain and periphery of multiple 5-HT4 receptor variants."
      Vilaro M.T., Domenech T., Palacios J.M., Mengod G.
      Neuropharmacology 42:60-73(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(E) AND 5-HT4(G)).
      Tissue: Brain and Hippocampus.
    7. "Cloning, pharmacological characterisation and tissue distribution of a novel 5-HT4 receptor splice variant, 5-HT4(i)."
      Brattelid T., Kvingedal A.M., Krobert K.A., Andressen K.W., Bach T., Hystad M.E., Kaumann A.J., Levy F.O.
      Naunyn Schmiedebergs Arch. Pharmacol. 369:616-628(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(E) AND 5-HT4(I)), TISSUE SPECIFICITY.
    8. "Cloning, expression and characterisation of a novel rat 5-HT4 receptor splice variant (5-HT4c1)."
      Reid A.M., Kelsell R.E., Houp J.A., Kelly F.M., Medhurst A.D., Cox H.M., Calver A.R.
      Submitted (MAY-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4C1).
      Tissue: Small intestine.
    9. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5-HT4(B)).
    12. "Structure of the human serotonin 5-HT4 receptor gene and cloning of a novel 5-HT4 splice variant."
      Bender E., Pindon A., van Oers I., Zhang Y.B., Gommeren W., Verhasselt P., Jurzak M., Leysen J., Luyten W.
      J. Neurochem. 74:478-489(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 10-388 (ISOFORM 5-HT4(F)).
    13. "Expression of serotonin receptor mRNAs in blood vessels."
      Ullmer C., Schmuck K., Kalkman H.O., Luebbert H.
      FEBS Lett. 370:215-221(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 112-255.
      Tissue: Brain.
    14. Cited for: INTERACTION WITH GRK5, IDENTIFICATION BY MASS SPECTROMETRY.
    15. Cited for: VARIANT LEU-27.

    Entry informationi

    Entry namei5HT4R_HUMAN
    AccessioniPrimary (citable) accession number: Q13639
    Secondary accession number(s): C4WYH4
    , Q546Q1, Q684M0, Q712M9, Q96KH9, Q96KI0, Q9H199, Q9NY73, Q9UBM6, Q9UBT4, Q9UE22, Q9UE23, Q9UQR6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: January 11, 2001
    Last modified: October 1, 2014
    This is version 140 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3