Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cadherin-18

Gene

CDH18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro

GO - Biological processi

  1. adherens junction organization Source: Reactome
  2. cell-cell junction organization Source: Reactome
  3. cell junction assembly Source: Reactome
  4. homophilic cell adhesion via plasma membrane adhesion molecules Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_19195. Adherens junctions interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-18
Alternative name(s):
Cadherin-14
Gene namesi
Name:CDH18
Synonyms:CDH14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:1757. CDH18.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini54 – 608555ExtracellularSequence AnalysisAdd
BLAST
Transmembranei609 – 63628HelicalSequence AnalysisAdd
BLAST
Topological domaini637 – 790154CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26291.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424Sequence AnalysisAdd
BLAST
Propeptidei25 – 5329Sequence AnalysisPRO_0000003815Add
BLAST
Chaini54 – 790737Cadherin-18PRO_0000003816Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
Glycosylationi255 – 2551N-linked (GlcNAc...)Sequence Analysis
Glycosylationi455 – 4551N-linked (GlcNAc...)Sequence Analysis
Glycosylationi536 – 5361N-linked (GlcNAc...)Sequence Analysis
Modified residuei786 – 7861PhosphoserineBy similarity

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ13634.
PRIDEiQ13634.

PTM databases

PhosphoSiteiQ13634.

Expressioni

Gene expression databases

BgeeiQ13634.
CleanExiHS_CDH18.
ExpressionAtlasiQ13634. baseline and differential.
GenevestigatoriQ13634.

Organism-specific databases

HPAiHPA014365.

Interactioni

Protein-protein interaction databases

BioGridi107451. 5 interactions.
IntActiQ13634. 1 interaction.
STRINGi9606.ENSP00000274170.

Structurei

3D structure databases

ProteinModelPortaliQ13634.
SMRiQ13634. Positions 54-589, 688-782.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini54 – 159106Cadherin 1PROSITE-ProRule annotationAdd
BLAST
Domaini160 – 268109Cadherin 2PROSITE-ProRule annotationAdd
BLAST
Domaini269 – 383115Cadherin 3PROSITE-ProRule annotationAdd
BLAST
Domaini384 – 486103Cadherin 4PROSITE-ProRule annotationAdd
BLAST
Domaini487 – 608122Cadherin 5PROSITE-ProRule annotationAdd
BLAST

Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

Sequence similaritiesi

Contains 5 cadherin domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG287458.
GeneTreeiENSGT00760000118954.
HOGENOMiHOG000231252.
HOVERGENiHBG005217.
InParanoidiQ13634.
KOiK06805.
OMAiDDFANGQ.
OrthoDBiEOG7GBFW7.
PhylomeDBiQ13634.
TreeFamiTF329887.

Family and domain databases

Gene3Di2.60.40.60. 5 hits.
4.10.900.10. 1 hit.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
[Graphical view]
PfamiPF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 5 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 5 hits.
PROSITEiPS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13634-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKITSTSCIC PVLVCLCFVQ RCYGTAHHSS IKVMRNQTKH IEGETEVHHR
60 70 80 90 100
PKRGWVWNQF FVLEEHMGPD PQYVGKLHSN SDKGDGSVKY ILTGEGAGTI
110 120 130 140 150
FIIDDTTGDI HSTKSLDREQ KTHYVLHAQA IDRRTNKPLE PESEFIIKVQ
160 170 180 190 200
DINDNAPKFT DGPYIVTVPE MSDMGTSVLQ VTATDADDPT YGNSARVVYS
210 220 230 240 250
ILQGQPYFSV DPKTGVIRTA LHNMDREARE HYSVVIQAKD MAGQVGGLSG
260 270 280 290 300
STTVNITLTD VNDNPPRFPQ KHYQLYVPES AQVGSAVGKI KANDADTGSN
310 320 330 340 350
ADMTYSIING DGMGIFSIST DKETREGILS LKKPLNYEKK KSYTLNIEGA
360 370 380 390 400
NTHLDFRFSH LGPFKDATML KIIVGDVDEP PLFSMPSYLM EVYENAKIGT
410 420 430 440 450
VVGTVLAQDP DSTNSLVRYF INYNVEDDRF FNIDANTGTI RTTKVLDREE
460 470 480 490 500
TPWYNITVTA SEIDNPDLLS HVTVGIRVLD VNDNPPELAR EYDIIVCENS
510 520 530 540 550
KPGQVIHTIS ATDKDDFANG PRFNFFLDER LPVNPNFTLK DNEDNTASIL
560 570 580 590 600
TRRRRFSRTV QDVYYLPIMI SDGGIPSLSS SSTLTIRVCA CERDGRVRTC
610 620 630 640 650
HAEAFLSSAG LSTGALIAIL LCVLILLAIV VLFITLRRSK KEPLIISEED
660 670 680 690 700
VRENVVTYDD EGGGEEDTEA FDITALRNPS AAEELKYRRD IRPEVKLTPR
710 720 730 740 750
HQTSSTLESI DVQEFIKQRL AEADLDPSVP PYDSLQTYAY EGQRSEAGSI
760 770 780 790
SSLDSATTQS DQDYHYLGDW GPEFKKLAEL YGEIESERTT
Length:790
Mass (Da):88,073
Last modified:November 1, 1996 - v1
Checksum:i5C7BDEB229B6EDCA
GO
Isoform 2 (identifier: Q13634-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     544-790: DNTASILTRR...YGEIESERTT → AAAPSPSGFVHAREMGVCGPAMQKPSCPRLV

Show »
Length:574
Mass (Da):63,677
Checksum:iF40B25D51C3DADB4
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti226 – 2261R → G in AAH31051 (PubMed:15489334).Curated
Sequence conflicti265 – 2651P → T in AAH31051 (PubMed:15489334).Curated
Sequence conflicti413 – 4131T → I in AAH31051 (PubMed:15489334).Curated
Sequence conflicti669 – 6691E → G in AAH31051 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei544 – 790247DNTAS…SERTT → AAAPSPSGFVHAREMGVCGP AMQKPSCPRLV in isoform 2. 1 PublicationVSP_042308Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59325 mRNA. Translation: AAB02933.1.
AK289547 mRNA. Translation: BAF82236.1.
AK295087 mRNA. Translation: BAG58128.1.
AC010490 Genomic DNA. No translation available.
AC025173 Genomic DNA. No translation available.
AC093221 Genomic DNA. No translation available.
AC093303 Genomic DNA. No translation available.
AC094103 Genomic DNA. No translation available.
AC108128 Genomic DNA. No translation available.
AC109474 Genomic DNA. No translation available.
AC113350 Genomic DNA. No translation available.
AC113397 Genomic DNA. No translation available.
AC118463 Genomic DNA. No translation available.
CH471168 Genomic DNA. Translation: EAW68851.1.
BC031051 mRNA. Translation: AAH31051.1.
CCDSiCCDS3889.1. [Q13634-1]
CCDS54835.1. [Q13634-2]
PIRiG02678.
RefSeqiNP_001161139.1. NM_001167667.1. [Q13634-2]
NP_001278885.1. NM_001291956.1. [Q13634-1]
NP_001278886.1. NM_001291957.1.
NP_004925.1. NM_004934.3. [Q13634-1]
XP_005248285.1. XM_005248228.1. [Q13634-1]
XP_006714498.1. XM_006714435.1. [Q13634-1]
UniGeneiHs.317632.

Genome annotation databases

EnsembliENST00000274170; ENSP00000274170; ENSG00000145526. [Q13634-1]
ENST00000382275; ENSP00000371710; ENSG00000145526. [Q13634-1]
ENST00000502796; ENSP00000422138; ENSG00000145526. [Q13634-2]
ENST00000507958; ENSP00000425093; ENSG00000145526. [Q13634-1]
GeneIDi1016.
KEGGihsa:1016.
UCSCiuc003jgc.3. human. [Q13634-1]
uc011cnm.2. human. [Q13634-2]

Polymorphism databases

DMDMi3023435.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59325 mRNA. Translation: AAB02933.1.
AK289547 mRNA. Translation: BAF82236.1.
AK295087 mRNA. Translation: BAG58128.1.
AC010490 Genomic DNA. No translation available.
AC025173 Genomic DNA. No translation available.
AC093221 Genomic DNA. No translation available.
AC093303 Genomic DNA. No translation available.
AC094103 Genomic DNA. No translation available.
AC108128 Genomic DNA. No translation available.
AC109474 Genomic DNA. No translation available.
AC113350 Genomic DNA. No translation available.
AC113397 Genomic DNA. No translation available.
AC118463 Genomic DNA. No translation available.
CH471168 Genomic DNA. Translation: EAW68851.1.
BC031051 mRNA. Translation: AAH31051.1.
CCDSiCCDS3889.1. [Q13634-1]
CCDS54835.1. [Q13634-2]
PIRiG02678.
RefSeqiNP_001161139.1. NM_001167667.1. [Q13634-2]
NP_001278885.1. NM_001291956.1. [Q13634-1]
NP_001278886.1. NM_001291957.1.
NP_004925.1. NM_004934.3. [Q13634-1]
XP_005248285.1. XM_005248228.1. [Q13634-1]
XP_006714498.1. XM_006714435.1. [Q13634-1]
UniGeneiHs.317632.

3D structure databases

ProteinModelPortaliQ13634.
SMRiQ13634. Positions 54-589, 688-782.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107451. 5 interactions.
IntActiQ13634. 1 interaction.
STRINGi9606.ENSP00000274170.

PTM databases

PhosphoSiteiQ13634.

Polymorphism databases

DMDMi3023435.

Proteomic databases

PaxDbiQ13634.
PRIDEiQ13634.

Protocols and materials databases

DNASUi1016.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000274170; ENSP00000274170; ENSG00000145526. [Q13634-1]
ENST00000382275; ENSP00000371710; ENSG00000145526. [Q13634-1]
ENST00000502796; ENSP00000422138; ENSG00000145526. [Q13634-2]
ENST00000507958; ENSP00000425093; ENSG00000145526. [Q13634-1]
GeneIDi1016.
KEGGihsa:1016.
UCSCiuc003jgc.3. human. [Q13634-1]
uc011cnm.2. human. [Q13634-2]

Organism-specific databases

CTDi1016.
GeneCardsiGC05M019508.
HGNCiHGNC:1757. CDH18.
HPAiHPA014365.
MIMi603019. gene.
neXtProtiNX_Q13634.
PharmGKBiPA26291.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG287458.
GeneTreeiENSGT00760000118954.
HOGENOMiHOG000231252.
HOVERGENiHBG005217.
InParanoidiQ13634.
KOiK06805.
OMAiDDFANGQ.
OrthoDBiEOG7GBFW7.
PhylomeDBiQ13634.
TreeFamiTF329887.

Enzyme and pathway databases

ReactomeiREACT_19195. Adherens junctions interactions.

Miscellaneous databases

ChiTaRSiCDH18. human.
GenomeRNAii1016.
NextBioi4269.
PROiQ13634.
SOURCEiSearch...

Gene expression databases

BgeeiQ13634.
CleanExiHS_CDH18.
ExpressionAtlasiQ13634. baseline and differential.
GenevestigatoriQ13634.

Family and domain databases

Gene3Di2.60.40.60. 5 hits.
4.10.900.10. 1 hit.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
[Graphical view]
PfamiPF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 5 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 5 hits.
PROSITEiPS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of human cadherin-14, a novel neurally specific type II cadherin, by protein interaction cloning."
    Shibata T., Shimoyama Y., Gotoh M., Hirohashi S.
    J. Biol. Chem. 272:5236-5240(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Cerebellum.
  3. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiCAD18_HUMAN
AccessioniPrimary (citable) accession number: Q13634
Secondary accession number(s): A8K0I2, B4DHG6, Q8N5Z2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: March 4, 2015
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.