Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cadherin-18

Gene

CDH18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-418990 Adherens junctions interactions

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-18
Alternative name(s):
Cadherin-14
Gene namesi
Name:CDH18
Synonyms:CDH14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000145526.11
HGNCiHGNC:1757 CDH18
MIMi603019 gene
neXtProtiNX_Q13634

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini54 – 608ExtracellularSequence analysisAdd BLAST555
Transmembranei609 – 636HelicalSequence analysisAdd BLAST28
Topological domaini637 – 790CytoplasmicSequence analysisAdd BLAST154

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi1016
OpenTargetsiENSG00000145526
PharmGKBiPA26291

Polymorphism and mutation databases

BioMutaiCDH18
DMDMi3023435

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
PropeptideiPRO_000000381525 – 53Sequence analysisAdd BLAST29
ChainiPRO_000000381654 – 790Cadherin-18Add BLAST737

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi36N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi255N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi455N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi536N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei786PhosphoserineBy similarity1

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ13634
PeptideAtlasiQ13634
PRIDEiQ13634
ProteomicsDBi59625
59626 [Q13634-2]
TopDownProteomicsiQ13634-1 [Q13634-1]

PTM databases

iPTMnetiQ13634
PhosphoSitePlusiQ13634

Expressioni

Gene expression databases

BgeeiENSG00000145526
CleanExiHS_CDH18
ExpressionAtlasiQ13634 baseline and differential
GenevisibleiQ13634 HS

Organism-specific databases

HPAiHPA014416

Interactioni

Protein-protein interaction databases

BioGridi107451, 4 interactors
IntActiQ13634, 1 interactor
STRINGi9606.ENSP00000274170

Structurei

3D structure databases

ProteinModelPortaliQ13634
SMRiQ13634
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini54 – 159Cadherin 1PROSITE-ProRule annotationAdd BLAST106
Domaini160 – 268Cadherin 2PROSITE-ProRule annotationAdd BLAST109
Domaini269 – 383Cadherin 3PROSITE-ProRule annotationAdd BLAST115
Domaini384 – 486Cadherin 4PROSITE-ProRule annotationAdd BLAST103
Domaini487 – 608Cadherin 5PROSITE-ProRule annotationAdd BLAST122

Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3594 Eukaryota
ENOG410XQHI LUCA
GeneTreeiENSGT00760000118954
HOGENOMiHOG000231252
HOVERGENiHBG005217
InParanoidiQ13634
KOiK06805
OMAiNGPRFNF
OrthoDBiEOG091G0212
PhylomeDBiQ13634
TreeFamiTF329887

Family and domain databases

Gene3Di4.10.900.10, 1 hit
InterProiView protein in InterPro
IPR002126 Cadherin
IPR015919 Cadherin-like
IPR020894 Cadherin_CS
IPR000233 Cadherin_cytoplasmic-dom
IPR027397 Catenin_binding_dom_sf
PfamiView protein in Pfam
PF00028 Cadherin, 5 hits
PF01049 Cadherin_C, 1 hit
PRINTSiPR00205 CADHERIN
SMARTiView protein in SMART
SM00112 CA, 5 hits
SUPFAMiSSF49313 SSF49313, 5 hits
PROSITEiView protein in PROSITE
PS00232 CADHERIN_1, 3 hits
PS50268 CADHERIN_2, 5 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q13634-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKITSTSCIC PVLVCLCFVQ RCYGTAHHSS IKVMRNQTKH IEGETEVHHR
60 70 80 90 100
PKRGWVWNQF FVLEEHMGPD PQYVGKLHSN SDKGDGSVKY ILTGEGAGTI
110 120 130 140 150
FIIDDTTGDI HSTKSLDREQ KTHYVLHAQA IDRRTNKPLE PESEFIIKVQ
160 170 180 190 200
DINDNAPKFT DGPYIVTVPE MSDMGTSVLQ VTATDADDPT YGNSARVVYS
210 220 230 240 250
ILQGQPYFSV DPKTGVIRTA LHNMDREARE HYSVVIQAKD MAGQVGGLSG
260 270 280 290 300
STTVNITLTD VNDNPPRFPQ KHYQLYVPES AQVGSAVGKI KANDADTGSN
310 320 330 340 350
ADMTYSIING DGMGIFSIST DKETREGILS LKKPLNYEKK KSYTLNIEGA
360 370 380 390 400
NTHLDFRFSH LGPFKDATML KIIVGDVDEP PLFSMPSYLM EVYENAKIGT
410 420 430 440 450
VVGTVLAQDP DSTNSLVRYF INYNVEDDRF FNIDANTGTI RTTKVLDREE
460 470 480 490 500
TPWYNITVTA SEIDNPDLLS HVTVGIRVLD VNDNPPELAR EYDIIVCENS
510 520 530 540 550
KPGQVIHTIS ATDKDDFANG PRFNFFLDER LPVNPNFTLK DNEDNTASIL
560 570 580 590 600
TRRRRFSRTV QDVYYLPIMI SDGGIPSLSS SSTLTIRVCA CERDGRVRTC
610 620 630 640 650
HAEAFLSSAG LSTGALIAIL LCVLILLAIV VLFITLRRSK KEPLIISEED
660 670 680 690 700
VRENVVTYDD EGGGEEDTEA FDITALRNPS AAEELKYRRD IRPEVKLTPR
710 720 730 740 750
HQTSSTLESI DVQEFIKQRL AEADLDPSVP PYDSLQTYAY EGQRSEAGSI
760 770 780 790
SSLDSATTQS DQDYHYLGDW GPEFKKLAEL YGEIESERTT
Length:790
Mass (Da):88,073
Last modified:November 1, 1996 - v1
Checksum:i5C7BDEB229B6EDCA
GO
Isoform 2 (identifier: Q13634-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     544-790: DNTASILTRR...YGEIESERTT → AAAPSPSGFVHAREMGVCGPAMQKPSCPRLV

Show »
Length:574
Mass (Da):63,677
Checksum:iF40B25D51C3DADB4
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti226R → G in AAH31051 (PubMed:15489334).Curated1
Sequence conflicti265P → T in AAH31051 (PubMed:15489334).Curated1
Sequence conflicti413T → I in AAH31051 (PubMed:15489334).Curated1
Sequence conflicti669E → G in AAH31051 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042308544 – 790DNTAS…SERTT → AAAPSPSGFVHAREMGVCGP AMQKPSCPRLV in isoform 2. 1 PublicationAdd BLAST247

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59325 mRNA Translation: AAB02933.1
AK289547 mRNA Translation: BAF82236.1
AK295087 mRNA Translation: BAG58128.1
AC010490 Genomic DNA No translation available.
AC025173 Genomic DNA No translation available.
AC093221 Genomic DNA No translation available.
AC093303 Genomic DNA No translation available.
AC094103 Genomic DNA No translation available.
AC108128 Genomic DNA No translation available.
AC109474 Genomic DNA No translation available.
AC113350 Genomic DNA No translation available.
AC113397 Genomic DNA No translation available.
AC118463 Genomic DNA No translation available.
CH471168 Genomic DNA Translation: EAW68851.1
BC031051 mRNA Translation: AAH31051.1
CCDSiCCDS3889.1 [Q13634-1]
CCDS54835.1 [Q13634-2]
PIRiG02678
RefSeqiNP_001161139.1, NM_001167667.1 [Q13634-2]
NP_001278885.1, NM_001291956.1 [Q13634-1]
NP_004925.1, NM_004934.3 [Q13634-1]
XP_005248285.1, XM_005248228.3 [Q13634-1]
XP_006714498.1, XM_006714435.3 [Q13634-1]
XP_016864413.1, XM_017008924.1 [Q13634-1]
XP_016864414.1, XM_017008925.1
XP_016864415.1, XM_017008926.1 [Q13634-1]
XP_016864416.1, XM_017008927.1 [Q13634-1]
XP_016864417.1, XM_017008928.1 [Q13634-1]
XP_016864418.1, XM_017008929.1 [Q13634-1]
XP_016864419.1, XM_017008930.1 [Q13634-1]
XP_016864420.1, XM_017008931.1
XP_016864421.1, XM_017008932.1
XP_016864428.1, XM_017008939.1 [Q13634-2]
XP_016864429.1, XM_017008940.1 [Q13634-2]
XP_016864430.1, XM_017008941.1
UniGeneiHs.317632
Hs.590304

Genome annotation databases

EnsembliENST00000274170; ENSP00000274170; ENSG00000145526 [Q13634-1]
ENST00000382275; ENSP00000371710; ENSG00000145526 [Q13634-1]
ENST00000502796; ENSP00000422138; ENSG00000145526 [Q13634-2]
ENST00000507958; ENSP00000425093; ENSG00000145526 [Q13634-1]
GeneIDi1016
KEGGihsa:1016
UCSCiuc003jgc.4 human [Q13634-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCAD18_HUMAN
AccessioniPrimary (citable) accession number: Q13634
Secondary accession number(s): A8K0I2, B4DHG6, Q8N5Z2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: June 20, 2018
This is version 147 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health