Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q13634 (CAD18_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 120. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cadherin-18
Alternative name(s):
Cadherin-14
Gene names
Name:CDH18
Synonyms:CDH14
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length790 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

Subcellular location

Cell membrane; Single-pass type I membrane protein.

Domain

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain By similarity.

Sequence similarities

Contains 5 cadherin domains.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q13634-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q13634-2)

The sequence of this isoform differs from the canonical sequence as follows:
     544-790: DNTASILTRR...YGEIESERTT → AAAPSPSGFVHAREMGVCGPAMQKPSCPRLV

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Potential
Propeptide25 – 5329 Potential
PRO_0000003815
Chain54 – 790737Cadherin-18
PRO_0000003816

Regions

Topological domain54 – 608555Extracellular Potential
Transmembrane609 – 63628Helical; Potential
Topological domain637 – 790154Cytoplasmic Potential
Domain54 – 159106Cadherin 1
Domain160 – 268109Cadherin 2
Domain269 – 383115Cadherin 3
Domain384 – 486103Cadherin 4
Domain487 – 608122Cadherin 5

Amino acid modifications

Glycosylation361N-linked (GlcNAc...) Potential
Glycosylation2551N-linked (GlcNAc...) Potential
Glycosylation4551N-linked (GlcNAc...) Potential
Glycosylation5361N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence544 – 790247DNTAS…SERTT → AAAPSPSGFVHAREMGVCGP AMQKPSCPRLV in isoform 2.
VSP_042308

Experimental info

Sequence conflict2261R → G in AAH31051. Ref.5
Sequence conflict2651P → T in AAH31051. Ref.5
Sequence conflict4131T → I in AAH31051. Ref.5
Sequence conflict6691E → G in AAH31051. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 5C7BDEB229B6EDCA

FASTA79088,073
        10         20         30         40         50         60 
MKITSTSCIC PVLVCLCFVQ RCYGTAHHSS IKVMRNQTKH IEGETEVHHR PKRGWVWNQF 

        70         80         90        100        110        120 
FVLEEHMGPD PQYVGKLHSN SDKGDGSVKY ILTGEGAGTI FIIDDTTGDI HSTKSLDREQ 

       130        140        150        160        170        180 
KTHYVLHAQA IDRRTNKPLE PESEFIIKVQ DINDNAPKFT DGPYIVTVPE MSDMGTSVLQ 

       190        200        210        220        230        240 
VTATDADDPT YGNSARVVYS ILQGQPYFSV DPKTGVIRTA LHNMDREARE HYSVVIQAKD 

       250        260        270        280        290        300 
MAGQVGGLSG STTVNITLTD VNDNPPRFPQ KHYQLYVPES AQVGSAVGKI KANDADTGSN 

       310        320        330        340        350        360 
ADMTYSIING DGMGIFSIST DKETREGILS LKKPLNYEKK KSYTLNIEGA NTHLDFRFSH 

       370        380        390        400        410        420 
LGPFKDATML KIIVGDVDEP PLFSMPSYLM EVYENAKIGT VVGTVLAQDP DSTNSLVRYF 

       430        440        450        460        470        480 
INYNVEDDRF FNIDANTGTI RTTKVLDREE TPWYNITVTA SEIDNPDLLS HVTVGIRVLD 

       490        500        510        520        530        540 
VNDNPPELAR EYDIIVCENS KPGQVIHTIS ATDKDDFANG PRFNFFLDER LPVNPNFTLK 

       550        560        570        580        590        600 
DNEDNTASIL TRRRRFSRTV QDVYYLPIMI SDGGIPSLSS SSTLTIRVCA CERDGRVRTC 

       610        620        630        640        650        660 
HAEAFLSSAG LSTGALIAIL LCVLILLAIV VLFITLRRSK KEPLIISEED VRENVVTYDD 

       670        680        690        700        710        720 
EGGGEEDTEA FDITALRNPS AAEELKYRRD IRPEVKLTPR HQTSSTLESI DVQEFIKQRL 

       730        740        750        760        770        780 
AEADLDPSVP PYDSLQTYAY EGQRSEAGSI SSLDSATTQS DQDYHYLGDW GPEFKKLAEL 

       790 
YGEIESERTT 

« Hide

Isoform 2 [UniParc].

Checksum: F40B25D51C3DADB4
Show »

FASTA57463,677

References

« Hide 'large scale' references
[1]"Identification of human cadherin-14, a novel neurally specific type II cadherin, by protein interaction cloning."
Shibata T., Shimoyama Y., Gotoh M., Hirohashi S.
J. Biol. Chem. 272:5236-5240(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain and Cerebellum.
[3]"The DNA sequence and comparative analysis of human chromosome 5."
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. expand/collapse author list , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U59325 mRNA. Translation: AAB02933.1.
AK289547 mRNA. Translation: BAF82236.1.
AK295087 mRNA. Translation: BAG58128.1.
AC010490 Genomic DNA. No translation available.
AC025173 Genomic DNA. No translation available.
AC093221 Genomic DNA. No translation available.
AC093303 Genomic DNA. No translation available.
AC094103 Genomic DNA. No translation available.
AC108128 Genomic DNA. No translation available.
AC109474 Genomic DNA. No translation available.
AC113350 Genomic DNA. No translation available.
AC113397 Genomic DNA. No translation available.
AC118463 Genomic DNA. No translation available.
CH471168 Genomic DNA. Translation: EAW68851.1.
BC031051 mRNA. Translation: AAH31051.1.
CCDSCCDS3889.1. [Q13634-1]
CCDS54835.1. [Q13634-2]
PIRG02678.
RefSeqNP_001161139.1. NM_001167667.1. [Q13634-2]
NP_004925.1. NM_004934.3. [Q13634-1]
XP_005248285.1. XM_005248228.1. [Q13634-1]
XP_006714498.1. XM_006714435.1. [Q13634-1]
UniGeneHs.317632.

3D structure databases

ProteinModelPortalQ13634.
SMRQ13634. Positions 54-589, 688-782.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107451. 5 interactions.
IntActQ13634. 1 interaction.
STRING9606.ENSP00000274170.

PTM databases

PhosphoSiteQ13634.

Polymorphism databases

DMDM3023435.

Proteomic databases

PaxDbQ13634.
PRIDEQ13634.

Protocols and materials databases

DNASU1016.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000274170; ENSP00000274170; ENSG00000145526. [Q13634-1]
ENST00000382275; ENSP00000371710; ENSG00000145526. [Q13634-1]
ENST00000502796; ENSP00000422138; ENSG00000145526. [Q13634-2]
ENST00000507958; ENSP00000425093; ENSG00000145526. [Q13634-1]
GeneID1016.
KEGGhsa:1016.
UCSCuc003jgc.3. human. [Q13634-1]
uc011cnm.2. human. [Q13634-2]

Organism-specific databases

CTD1016.
GeneCardsGC05M019508.
HGNCHGNC:1757. CDH18.
HPAHPA014365.
MIM603019. gene.
neXtProtNX_Q13634.
PharmGKBPA26291.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG287458.
HOGENOMHOG000231252.
HOVERGENHBG005217.
InParanoidQ13634.
KOK06805.
OMARITSTSC.
OrthoDBEOG7GBFW7.
PhylomeDBQ13634.
TreeFamTF329887.

Enzyme and pathway databases

ReactomeREACT_111155. Cell-Cell communication.

Gene expression databases

ArrayExpressQ13634.
BgeeQ13634.
CleanExHS_CDH18.
GenevestigatorQ13634.

Family and domain databases

Gene3D2.60.40.60. 5 hits.
4.10.900.10. 1 hit.
InterProIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
[Graphical view]
PfamPF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
[Graphical view]
PRINTSPR00205. CADHERIN.
SMARTSM00112. CA. 5 hits.
[Graphical view]
SUPFAMSSF49313. SSF49313. 5 hits.
PROSITEPS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCDH18. human.
GenomeRNAi1016.
NextBio4269.
PROQ13634.
SOURCESearch...

Entry information

Entry nameCAD18_HUMAN
AccessionPrimary (citable) accession number: Q13634
Secondary accession number(s): A8K0I2, B4DHG6, Q8N5Z2
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: July 9, 2014
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM