Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13634

- CAD18_HUMAN

UniProt

Q13634 - CAD18_HUMAN

Protein

Cadherin-18

Gene

CDH18

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 122 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro

    GO - Biological processi

    1. adherens junction organization Source: Reactome
    2. cell-cell junction organization Source: Reactome
    3. cell junction assembly Source: Reactome
    4. homophilic cell adhesion Source: InterPro

    Keywords - Biological processi

    Cell adhesion

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_19195. Adherens junctions interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cadherin-18
    Alternative name(s):
    Cadherin-14
    Gene namesi
    Name:CDH18
    Synonyms:CDH14
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:1757. CDH18.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26291.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Propeptidei25 – 5329Sequence AnalysisPRO_0000003815Add
    BLAST
    Chaini54 – 790737Cadherin-18PRO_0000003816Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi36 – 361N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi255 – 2551N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi455 – 4551N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi536 – 5361N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Cleavage on pair of basic residues, Glycoprotein

    Proteomic databases

    PaxDbiQ13634.
    PRIDEiQ13634.

    PTM databases

    PhosphoSiteiQ13634.

    Expressioni

    Gene expression databases

    ArrayExpressiQ13634.
    BgeeiQ13634.
    CleanExiHS_CDH18.
    GenevestigatoriQ13634.

    Organism-specific databases

    HPAiHPA014365.

    Interactioni

    Protein-protein interaction databases

    BioGridi107451. 5 interactions.
    IntActiQ13634. 1 interaction.
    STRINGi9606.ENSP00000274170.

    Structurei

    3D structure databases

    ProteinModelPortaliQ13634.
    SMRiQ13634. Positions 54-589, 688-782.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini54 – 608555ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini637 – 790154CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei609 – 63628HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini54 – 159106Cadherin 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini160 – 268109Cadherin 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini269 – 383115Cadherin 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini384 – 486103Cadherin 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini487 – 608122Cadherin 5PROSITE-ProRule annotationAdd
    BLAST

    Domaini

    Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

    Sequence similaritiesi

    Contains 5 cadherin domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG287458.
    HOGENOMiHOG000231252.
    HOVERGENiHBG005217.
    InParanoidiQ13634.
    KOiK06805.
    OMAiRITSTSC.
    OrthoDBiEOG7GBFW7.
    PhylomeDBiQ13634.
    TreeFamiTF329887.

    Family and domain databases

    Gene3Di2.60.40.60. 5 hits.
    4.10.900.10. 1 hit.
    InterProiIPR002126. Cadherin.
    IPR015919. Cadherin-like.
    IPR020894. Cadherin_CS.
    IPR000233. Cadherin_cytoplasmic-dom.
    IPR027397. Catenin_binding_dom.
    [Graphical view]
    PfamiPF00028. Cadherin. 5 hits.
    PF01049. Cadherin_C. 1 hit.
    [Graphical view]
    PRINTSiPR00205. CADHERIN.
    SMARTiSM00112. CA. 5 hits.
    [Graphical view]
    SUPFAMiSSF49313. SSF49313. 5 hits.
    PROSITEiPS00232. CADHERIN_1. 3 hits.
    PS50268. CADHERIN_2. 5 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q13634-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKITSTSCIC PVLVCLCFVQ RCYGTAHHSS IKVMRNQTKH IEGETEVHHR    50
    PKRGWVWNQF FVLEEHMGPD PQYVGKLHSN SDKGDGSVKY ILTGEGAGTI 100
    FIIDDTTGDI HSTKSLDREQ KTHYVLHAQA IDRRTNKPLE PESEFIIKVQ 150
    DINDNAPKFT DGPYIVTVPE MSDMGTSVLQ VTATDADDPT YGNSARVVYS 200
    ILQGQPYFSV DPKTGVIRTA LHNMDREARE HYSVVIQAKD MAGQVGGLSG 250
    STTVNITLTD VNDNPPRFPQ KHYQLYVPES AQVGSAVGKI KANDADTGSN 300
    ADMTYSIING DGMGIFSIST DKETREGILS LKKPLNYEKK KSYTLNIEGA 350
    NTHLDFRFSH LGPFKDATML KIIVGDVDEP PLFSMPSYLM EVYENAKIGT 400
    VVGTVLAQDP DSTNSLVRYF INYNVEDDRF FNIDANTGTI RTTKVLDREE 450
    TPWYNITVTA SEIDNPDLLS HVTVGIRVLD VNDNPPELAR EYDIIVCENS 500
    KPGQVIHTIS ATDKDDFANG PRFNFFLDER LPVNPNFTLK DNEDNTASIL 550
    TRRRRFSRTV QDVYYLPIMI SDGGIPSLSS SSTLTIRVCA CERDGRVRTC 600
    HAEAFLSSAG LSTGALIAIL LCVLILLAIV VLFITLRRSK KEPLIISEED 650
    VRENVVTYDD EGGGEEDTEA FDITALRNPS AAEELKYRRD IRPEVKLTPR 700
    HQTSSTLESI DVQEFIKQRL AEADLDPSVP PYDSLQTYAY EGQRSEAGSI 750
    SSLDSATTQS DQDYHYLGDW GPEFKKLAEL YGEIESERTT 790
    Length:790
    Mass (Da):88,073
    Last modified:November 1, 1996 - v1
    Checksum:i5C7BDEB229B6EDCA
    GO
    Isoform 2 (identifier: Q13634-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         544-790: DNTASILTRR...YGEIESERTT → AAAPSPSGFVHAREMGVCGPAMQKPSCPRLV

    Show »
    Length:574
    Mass (Da):63,677
    Checksum:iF40B25D51C3DADB4
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti226 – 2261R → G in AAH31051. (PubMed:15489334)Curated
    Sequence conflicti265 – 2651P → T in AAH31051. (PubMed:15489334)Curated
    Sequence conflicti413 – 4131T → I in AAH31051. (PubMed:15489334)Curated
    Sequence conflicti669 – 6691E → G in AAH31051. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei544 – 790247DNTAS…SERTT → AAAPSPSGFVHAREMGVCGP AMQKPSCPRLV in isoform 2. 1 PublicationVSP_042308Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U59325 mRNA. Translation: AAB02933.1.
    AK289547 mRNA. Translation: BAF82236.1.
    AK295087 mRNA. Translation: BAG58128.1.
    AC010490 Genomic DNA. No translation available.
    AC025173 Genomic DNA. No translation available.
    AC093221 Genomic DNA. No translation available.
    AC093303 Genomic DNA. No translation available.
    AC094103 Genomic DNA. No translation available.
    AC108128 Genomic DNA. No translation available.
    AC109474 Genomic DNA. No translation available.
    AC113350 Genomic DNA. No translation available.
    AC113397 Genomic DNA. No translation available.
    AC118463 Genomic DNA. No translation available.
    CH471168 Genomic DNA. Translation: EAW68851.1.
    BC031051 mRNA. Translation: AAH31051.1.
    CCDSiCCDS3889.1. [Q13634-1]
    CCDS54835.1. [Q13634-2]
    PIRiG02678.
    RefSeqiNP_001161139.1. NM_001167667.1. [Q13634-2]
    NP_004925.1. NM_004934.3. [Q13634-1]
    XP_005248285.1. XM_005248228.1. [Q13634-1]
    XP_006714498.1. XM_006714435.1. [Q13634-1]
    UniGeneiHs.317632.

    Genome annotation databases

    EnsembliENST00000274170; ENSP00000274170; ENSG00000145526. [Q13634-1]
    ENST00000382275; ENSP00000371710; ENSG00000145526. [Q13634-1]
    ENST00000502796; ENSP00000422138; ENSG00000145526. [Q13634-2]
    ENST00000507958; ENSP00000425093; ENSG00000145526. [Q13634-1]
    GeneIDi1016.
    KEGGihsa:1016.
    UCSCiuc003jgc.3. human. [Q13634-1]
    uc011cnm.2. human. [Q13634-2]

    Polymorphism databases

    DMDMi3023435.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U59325 mRNA. Translation: AAB02933.1 .
    AK289547 mRNA. Translation: BAF82236.1 .
    AK295087 mRNA. Translation: BAG58128.1 .
    AC010490 Genomic DNA. No translation available.
    AC025173 Genomic DNA. No translation available.
    AC093221 Genomic DNA. No translation available.
    AC093303 Genomic DNA. No translation available.
    AC094103 Genomic DNA. No translation available.
    AC108128 Genomic DNA. No translation available.
    AC109474 Genomic DNA. No translation available.
    AC113350 Genomic DNA. No translation available.
    AC113397 Genomic DNA. No translation available.
    AC118463 Genomic DNA. No translation available.
    CH471168 Genomic DNA. Translation: EAW68851.1 .
    BC031051 mRNA. Translation: AAH31051.1 .
    CCDSi CCDS3889.1. [Q13634-1 ]
    CCDS54835.1. [Q13634-2 ]
    PIRi G02678.
    RefSeqi NP_001161139.1. NM_001167667.1. [Q13634-2 ]
    NP_004925.1. NM_004934.3. [Q13634-1 ]
    XP_005248285.1. XM_005248228.1. [Q13634-1 ]
    XP_006714498.1. XM_006714435.1. [Q13634-1 ]
    UniGenei Hs.317632.

    3D structure databases

    ProteinModelPortali Q13634.
    SMRi Q13634. Positions 54-589, 688-782.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107451. 5 interactions.
    IntActi Q13634. 1 interaction.
    STRINGi 9606.ENSP00000274170.

    PTM databases

    PhosphoSitei Q13634.

    Polymorphism databases

    DMDMi 3023435.

    Proteomic databases

    PaxDbi Q13634.
    PRIDEi Q13634.

    Protocols and materials databases

    DNASUi 1016.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000274170 ; ENSP00000274170 ; ENSG00000145526 . [Q13634-1 ]
    ENST00000382275 ; ENSP00000371710 ; ENSG00000145526 . [Q13634-1 ]
    ENST00000502796 ; ENSP00000422138 ; ENSG00000145526 . [Q13634-2 ]
    ENST00000507958 ; ENSP00000425093 ; ENSG00000145526 . [Q13634-1 ]
    GeneIDi 1016.
    KEGGi hsa:1016.
    UCSCi uc003jgc.3. human. [Q13634-1 ]
    uc011cnm.2. human. [Q13634-2 ]

    Organism-specific databases

    CTDi 1016.
    GeneCardsi GC05M019508.
    HGNCi HGNC:1757. CDH18.
    HPAi HPA014365.
    MIMi 603019. gene.
    neXtProti NX_Q13634.
    PharmGKBi PA26291.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG287458.
    HOGENOMi HOG000231252.
    HOVERGENi HBG005217.
    InParanoidi Q13634.
    KOi K06805.
    OMAi RITSTSC.
    OrthoDBi EOG7GBFW7.
    PhylomeDBi Q13634.
    TreeFami TF329887.

    Enzyme and pathway databases

    Reactomei REACT_19195. Adherens junctions interactions.

    Miscellaneous databases

    ChiTaRSi CDH18. human.
    GenomeRNAii 1016.
    NextBioi 4269.
    PROi Q13634.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13634.
    Bgeei Q13634.
    CleanExi HS_CDH18.
    Genevestigatori Q13634.

    Family and domain databases

    Gene3Di 2.60.40.60. 5 hits.
    4.10.900.10. 1 hit.
    InterProi IPR002126. Cadherin.
    IPR015919. Cadherin-like.
    IPR020894. Cadherin_CS.
    IPR000233. Cadherin_cytoplasmic-dom.
    IPR027397. Catenin_binding_dom.
    [Graphical view ]
    Pfami PF00028. Cadherin. 5 hits.
    PF01049. Cadherin_C. 1 hit.
    [Graphical view ]
    PRINTSi PR00205. CADHERIN.
    SMARTi SM00112. CA. 5 hits.
    [Graphical view ]
    SUPFAMi SSF49313. SSF49313. 5 hits.
    PROSITEi PS00232. CADHERIN_1. 3 hits.
    PS50268. CADHERIN_2. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of human cadherin-14, a novel neurally specific type II cadherin, by protein interaction cloning."
      Shibata T., Shimoyama Y., Gotoh M., Hirohashi S.
      J. Biol. Chem. 272:5236-5240(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain and Cerebellum.
    3. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiCAD18_HUMAN
    AccessioniPrimary (citable) accession number: Q13634
    Secondary accession number(s): A8K0I2, B4DHG6, Q8N5Z2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 122 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3