SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13634

- CAD18_HUMAN

UniProt

Q13634 - CAD18_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Cadherin-18
Gene
CDH18, CDH14
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.

GO - Molecular functioni

  1. calcium ion binding Source: InterPro

GO - Biological processi

  1. adherens junction organization Source: Reactome
  2. cell junction assembly Source: Reactome
  3. cell-cell junction organization Source: Reactome
  4. homophilic cell adhesion Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_19195. Adherens junctions interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-18
Alternative name(s):
Cadherin-14
Gene namesi
Name:CDH18
Synonyms:CDH14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:1757. CDH18.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini54 – 608555Extracellular Reviewed prediction
Add
BLAST
Transmembranei609 – 63628Helical; Reviewed prediction
Add
BLAST
Topological domaini637 – 790154Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26291.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424 Reviewed prediction
Add
BLAST
Propeptidei25 – 5329 Reviewed prediction
PRO_0000003815Add
BLAST
Chaini54 – 790737Cadherin-18
PRO_0000003816Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi36 – 361N-linked (GlcNAc...) Reviewed prediction
Glycosylationi255 – 2551N-linked (GlcNAc...) Reviewed prediction
Glycosylationi455 – 4551N-linked (GlcNAc...) Reviewed prediction
Glycosylationi536 – 5361N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein

Proteomic databases

PaxDbiQ13634.
PRIDEiQ13634.

PTM databases

PhosphoSiteiQ13634.

Expressioni

Gene expression databases

ArrayExpressiQ13634.
BgeeiQ13634.
CleanExiHS_CDH18.
GenevestigatoriQ13634.

Organism-specific databases

HPAiHPA014365.

Interactioni

Protein-protein interaction databases

BioGridi107451. 5 interactions.
IntActiQ13634. 1 interaction.
STRINGi9606.ENSP00000274170.

Structurei

3D structure databases

ProteinModelPortaliQ13634.
SMRiQ13634. Positions 54-589, 688-782.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini54 – 159106Cadherin 1
Add
BLAST
Domaini160 – 268109Cadherin 2
Add
BLAST
Domaini269 – 383115Cadherin 3
Add
BLAST
Domaini384 – 486103Cadherin 4
Add
BLAST
Domaini487 – 608122Cadherin 5
Add
BLAST

Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain By similarity.

Sequence similaritiesi

Contains 5 cadherin domains.

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG287458.
HOGENOMiHOG000231252.
HOVERGENiHBG005217.
InParanoidiQ13634.
KOiK06805.
OMAiRITSTSC.
OrthoDBiEOG7GBFW7.
PhylomeDBiQ13634.
TreeFamiTF329887.

Family and domain databases

Gene3Di2.60.40.60. 5 hits.
4.10.900.10. 1 hit.
InterProiIPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
[Graphical view]
PfamiPF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
[Graphical view]
PRINTSiPR00205. CADHERIN.
SMARTiSM00112. CA. 5 hits.
[Graphical view]
SUPFAMiSSF49313. SSF49313. 5 hits.
PROSITEiPS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13634-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKITSTSCIC PVLVCLCFVQ RCYGTAHHSS IKVMRNQTKH IEGETEVHHR    50
PKRGWVWNQF FVLEEHMGPD PQYVGKLHSN SDKGDGSVKY ILTGEGAGTI 100
FIIDDTTGDI HSTKSLDREQ KTHYVLHAQA IDRRTNKPLE PESEFIIKVQ 150
DINDNAPKFT DGPYIVTVPE MSDMGTSVLQ VTATDADDPT YGNSARVVYS 200
ILQGQPYFSV DPKTGVIRTA LHNMDREARE HYSVVIQAKD MAGQVGGLSG 250
STTVNITLTD VNDNPPRFPQ KHYQLYVPES AQVGSAVGKI KANDADTGSN 300
ADMTYSIING DGMGIFSIST DKETREGILS LKKPLNYEKK KSYTLNIEGA 350
NTHLDFRFSH LGPFKDATML KIIVGDVDEP PLFSMPSYLM EVYENAKIGT 400
VVGTVLAQDP DSTNSLVRYF INYNVEDDRF FNIDANTGTI RTTKVLDREE 450
TPWYNITVTA SEIDNPDLLS HVTVGIRVLD VNDNPPELAR EYDIIVCENS 500
KPGQVIHTIS ATDKDDFANG PRFNFFLDER LPVNPNFTLK DNEDNTASIL 550
TRRRRFSRTV QDVYYLPIMI SDGGIPSLSS SSTLTIRVCA CERDGRVRTC 600
HAEAFLSSAG LSTGALIAIL LCVLILLAIV VLFITLRRSK KEPLIISEED 650
VRENVVTYDD EGGGEEDTEA FDITALRNPS AAEELKYRRD IRPEVKLTPR 700
HQTSSTLESI DVQEFIKQRL AEADLDPSVP PYDSLQTYAY EGQRSEAGSI 750
SSLDSATTQS DQDYHYLGDW GPEFKKLAEL YGEIESERTT 790
Length:790
Mass (Da):88,073
Last modified:November 1, 1996 - v1
Checksum:i5C7BDEB229B6EDCA
GO
Isoform 2 (identifier: Q13634-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     544-790: DNTASILTRR...YGEIESERTT → AAAPSPSGFVHAREMGVCGPAMQKPSCPRLV

Show »
Length:574
Mass (Da):63,677
Checksum:iF40B25D51C3DADB4
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei544 – 790247DNTAS…SERTT → AAAPSPSGFVHAREMGVCGP AMQKPSCPRLV in isoform 2.
VSP_042308Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti226 – 2261R → G in AAH31051. 1 Publication
Sequence conflicti265 – 2651P → T in AAH31051. 1 Publication
Sequence conflicti413 – 4131T → I in AAH31051. 1 Publication
Sequence conflicti669 – 6691E → G in AAH31051. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U59325 mRNA. Translation: AAB02933.1.
AK289547 mRNA. Translation: BAF82236.1.
AK295087 mRNA. Translation: BAG58128.1.
AC010490 Genomic DNA. No translation available.
AC025173 Genomic DNA. No translation available.
AC093221 Genomic DNA. No translation available.
AC093303 Genomic DNA. No translation available.
AC094103 Genomic DNA. No translation available.
AC108128 Genomic DNA. No translation available.
AC109474 Genomic DNA. No translation available.
AC113350 Genomic DNA. No translation available.
AC113397 Genomic DNA. No translation available.
AC118463 Genomic DNA. No translation available.
CH471168 Genomic DNA. Translation: EAW68851.1.
BC031051 mRNA. Translation: AAH31051.1.
CCDSiCCDS3889.1. [Q13634-1]
CCDS54835.1. [Q13634-2]
PIRiG02678.
RefSeqiNP_001161139.1. NM_001167667.1. [Q13634-2]
NP_004925.1. NM_004934.3. [Q13634-1]
XP_005248285.1. XM_005248228.1. [Q13634-1]
XP_006714498.1. XM_006714435.1. [Q13634-1]
UniGeneiHs.317632.

Genome annotation databases

EnsembliENST00000274170; ENSP00000274170; ENSG00000145526. [Q13634-1]
ENST00000382275; ENSP00000371710; ENSG00000145526. [Q13634-1]
ENST00000502796; ENSP00000422138; ENSG00000145526. [Q13634-2]
ENST00000507958; ENSP00000425093; ENSG00000145526. [Q13634-1]
GeneIDi1016.
KEGGihsa:1016.
UCSCiuc003jgc.3. human. [Q13634-1]
uc011cnm.2. human. [Q13634-2]

Polymorphism databases

DMDMi3023435.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U59325 mRNA. Translation: AAB02933.1 .
AK289547 mRNA. Translation: BAF82236.1 .
AK295087 mRNA. Translation: BAG58128.1 .
AC010490 Genomic DNA. No translation available.
AC025173 Genomic DNA. No translation available.
AC093221 Genomic DNA. No translation available.
AC093303 Genomic DNA. No translation available.
AC094103 Genomic DNA. No translation available.
AC108128 Genomic DNA. No translation available.
AC109474 Genomic DNA. No translation available.
AC113350 Genomic DNA. No translation available.
AC113397 Genomic DNA. No translation available.
AC118463 Genomic DNA. No translation available.
CH471168 Genomic DNA. Translation: EAW68851.1 .
BC031051 mRNA. Translation: AAH31051.1 .
CCDSi CCDS3889.1. [Q13634-1 ]
CCDS54835.1. [Q13634-2 ]
PIRi G02678.
RefSeqi NP_001161139.1. NM_001167667.1. [Q13634-2 ]
NP_004925.1. NM_004934.3. [Q13634-1 ]
XP_005248285.1. XM_005248228.1. [Q13634-1 ]
XP_006714498.1. XM_006714435.1. [Q13634-1 ]
UniGenei Hs.317632.

3D structure databases

ProteinModelPortali Q13634.
SMRi Q13634. Positions 54-589, 688-782.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107451. 5 interactions.
IntActi Q13634. 1 interaction.
STRINGi 9606.ENSP00000274170.

PTM databases

PhosphoSitei Q13634.

Polymorphism databases

DMDMi 3023435.

Proteomic databases

PaxDbi Q13634.
PRIDEi Q13634.

Protocols and materials databases

DNASUi 1016.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000274170 ; ENSP00000274170 ; ENSG00000145526 . [Q13634-1 ]
ENST00000382275 ; ENSP00000371710 ; ENSG00000145526 . [Q13634-1 ]
ENST00000502796 ; ENSP00000422138 ; ENSG00000145526 . [Q13634-2 ]
ENST00000507958 ; ENSP00000425093 ; ENSG00000145526 . [Q13634-1 ]
GeneIDi 1016.
KEGGi hsa:1016.
UCSCi uc003jgc.3. human. [Q13634-1 ]
uc011cnm.2. human. [Q13634-2 ]

Organism-specific databases

CTDi 1016.
GeneCardsi GC05M019508.
HGNCi HGNC:1757. CDH18.
HPAi HPA014365.
MIMi 603019. gene.
neXtProti NX_Q13634.
PharmGKBi PA26291.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG287458.
HOGENOMi HOG000231252.
HOVERGENi HBG005217.
InParanoidi Q13634.
KOi K06805.
OMAi RITSTSC.
OrthoDBi EOG7GBFW7.
PhylomeDBi Q13634.
TreeFami TF329887.

Enzyme and pathway databases

Reactomei REACT_19195. Adherens junctions interactions.

Miscellaneous databases

ChiTaRSi CDH18. human.
GenomeRNAii 1016.
NextBioi 4269.
PROi Q13634.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13634.
Bgeei Q13634.
CleanExi HS_CDH18.
Genevestigatori Q13634.

Family and domain databases

Gene3Di 2.60.40.60. 5 hits.
4.10.900.10. 1 hit.
InterProi IPR002126. Cadherin.
IPR015919. Cadherin-like.
IPR020894. Cadherin_CS.
IPR000233. Cadherin_cytoplasmic-dom.
IPR027397. Catenin_binding_dom.
[Graphical view ]
Pfami PF00028. Cadherin. 5 hits.
PF01049. Cadherin_C. 1 hit.
[Graphical view ]
PRINTSi PR00205. CADHERIN.
SMARTi SM00112. CA. 5 hits.
[Graphical view ]
SUPFAMi SSF49313. SSF49313. 5 hits.
PROSITEi PS00232. CADHERIN_1. 3 hits.
PS50268. CADHERIN_2. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of human cadherin-14, a novel neurally specific type II cadherin, by protein interaction cloning."
    Shibata T., Shimoyama Y., Gotoh M., Hirohashi S.
    J. Biol. Chem. 272:5236-5240(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain and Cerebellum.
  3. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiCAD18_HUMAN
AccessioniPrimary (citable) accession number: Q13634
Secondary accession number(s): A8K0I2, B4DHG6, Q8N5Z2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: September 3, 2014
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi