Reviewed,
UniProtKB/Swiss-Prot Q13510 (ASAH1_HUMAN)
Last modified
June 16, 2009.
Version 94.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Acid ceramidase Short name=AC EC=3.5.1.23 Alternative name(s): Acylsphingosine deacylase N-acylsphingosine amidohydrolase Putative 32 kDa heart protein Short name=PHP32 Cleaved into the following 2 chains: 1- Recommended name: Acid ceramidase subunit alpha 2- Recommended name: Acid ceramidase subunit beta | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 395 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid. |
| Catalytic activity | N-acylsphingosine + H2O = a carboxylate + sphingosine. |
| Subunit structure | Heterodimer of one alpha and one beta subunit. |
| Subcellular location | |
| Tissue specificity | Broadly expressed with highest expression in heart. |
| Involvement in disease | Defects in ASAH1 are the cause of Farber disease (FD) [MIM:228000]; also known as Farber lipogranulomatosis. This sphingolipid disease is characterized by subcutaneous lipid-loaded nodules, excruciating pain in the joints and extremities, marked accumulation of ceramide in lysosomes, and death by three years of age. Ref.1 Ref.5 Ref.6 Ref.15 Ref.16 Ref.17 |
| Sequence similarities | Belongs to the acid ceramidase family. |
| Sequence caution | The sequence AAC73009.1 differs from that shown. Reason: Frameshift at positions 15 and 21. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Lysosome |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Signal |
| Molecular function | Hydrolase |
| PTM | Glycoprotein |
| Technical term | Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | ceramide metabolic process Ref.1 Traceable author statement. Source: ProtInc |
| Cellular component | lysosome Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ceramidase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13510-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13510-2) The sequence of this isoform differs from the canonical sequence as follows: 1-26: MPGRSCVALVLLAAAVSCAVAQHAPP → MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | ||||||
| Chain | 22 – 142 | 121 | Acid ceramidase subunit alpha | PRO_0000002312 | |||||
| Chain | 143 – 395 | 253 | Acid ceramidase subunit beta | PRO_0000002313 | |||||
Amino acid modifications | |||||||||
| Glycosylation | 173 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 195 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 259 | 1 | N-linked (GlcNAc...) Ref.10 Ref.11 Ref.12 | ||||||
| Glycosylation | 286 | 1 | N-linked (GlcNAc...) Ref.10 | ||||||
| Glycosylation | 342 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 348 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 26 | 26 | MPGRS…QHAPP → MNCCIGLGEKARGSHRASYP SLSALFTEASILGFGSFAVK AQ in isoform 2. | VSP_037504 | |||||
| Natural variant | 22 | 1 | Q → H in FD. Ref.5 | VAR_038166 | |||||
| Natural variant | 23 | 1 | H → D in FD. Ref.5 | VAR_038167 | |||||
| Natural variant | 36 | 1 | Y → C in FD. Ref.15 | VAR_021579 | |||||
| Natural variant | 70 | 1 | A → V: dbSNP rs10103355. | VAR_057979 | |||||
| Natural variant | 72 | 1 | V → M: dbSNP rs1071645. | VAR_008860 | |||||
| Natural variant | 88 | 1 | V → M: dbSNP rs1071645. | VAR_057980 | |||||
| Natural variant | 93 | 1 | I → V: dbSNP rs1049874. | VAR_008861 | |||||
| Natural variant | 96 | 1 | Missing in FD. Ref.16 | VAR_021580 | |||||
| Natural variant | 97 | 1 | V → E in FD. Ref.16 | VAR_021581 | |||||
| Natural variant | 124 | 1 | D → E: dbSNP rs2472205. | VAR_038168 | |||||
| Natural variant | 138 | 1 | E → V in FD. Ref.5 Ref.6 | VAR_021582 | |||||
| Natural variant | 182 | 1 | L → V in FD. Ref.17 | VAR_038169 | |||||
| Natural variant | 222 | 1 | T → K in FD. Ref.1 Ref.5 | VAR_008862 | |||||
| Natural variant | 235 | 1 | G → R in FD. Ref.16 | VAR_021583 | |||||
| Natural variant | 246 | 1 | V → A: dbSNP rs10103355. | VAR_038170 | |||||
| Natural variant | 254 | 1 | R → G in FD. Ref.6 | VAR_021584 | |||||
| Natural variant | 320 | 1 | N → D in FD. Ref.5 Ref.15 | VAR_021585 | |||||
| Natural variant | 362 | 1 | P → R in FD. Ref.6 | VAR_021586 | |||||
| Natural variant | 369 | 1 | V → I: dbSNP rs17636067. Ref.16 | VAR_021587 | |||||
Experimental info | |||||||||
| Sequence conflict | 122 | 1 | V → A in AAQ75550. Ref.4 | ||||||
| Sequence conflict | 155 | 1 | L → P in AAQ75550. Ref.4 | ||||||
| Sequence conflict | 233 | 1 | Y → N in AAQ75550. Ref.4 | ||||||
| Sequence conflict | 364 | 1 | L → P in AAQ75550. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a full-length complementary DNA encoding human acid ceramidase. Identification of the first molecular lesion causing Farber disease." Koch J., Gaertner S., Li C.M., Quintern L.E., Bernardo K., Levran O., Schnabel D., Desnick R.J., Schuchman E.H., Sandhoff K. J. Biol. Chem. 271:33110-33115(1996) [PubMed: 8955159] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, VARIANT FD LYS-222, VARIANTS MET-72; VAL-93 AND ALA-246. Tissue: Fibroblast, Pituitary and Urine. |
| [2] | "A new gene family predicted by a novel human heart cDNA." Churchill J.R., Wieland S.J., Hoffman S., Gallin E.K., Murphy P.M. Mol. Biol. Cell 6:418-418(1995) Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS MET-72; VAL-93 AND ALA-246. |
| [3] | Wieland S.J., Hoffman S., Churchill J.R., Gallin E.K., Murphy P.M. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [4] | "A new spermatogenesis related gene." Fan M.M., Miao S.Y., Zhang X.D., Qiao Y., Liang G., Wang L.F. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [5] | "Human acid ceramidase gene: novel mutations in Farber disease." Zhang Z., Mandal A.K., Mital A., Popescu N., Zimonjic D., Moser A., Moser H., Mukherjee A.B. Mol. Genet. Metab. 70:301-309(2000) [PubMed: 10993717] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS FD HIS-22; ASP-23; VAL-138; LYS-222 AND ASP-320, VARIANTS MET-72; VAL-93 AND ALA-246. |
| [6] | "The human acid ceramidase gene (ASAH): structure, chromosomal location, mutation analysis, and expression." Li C.M., Park J.H., He X., Levy B., Chen F., Arai K., Adler D.A., Disteche C.M., Koch J., Sandhoff K., Schuchman E.H. Genomics 62:223-231(1999) [PubMed: 10610716] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS FD VAL-138; GLY-254 AND ARG-362. |
| [7] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS MET-72; VAL-93 AND ALA-246. Tissue: Skin. |
| [9] | "Purification, characterization, and biosynthesis of human acid ceramidase." Bernardo K., Hurwitz R., Zenk T., Desnick R.J., Ferlinz K., Schuchman E.H., Sandhoff K. J. Biol. Chem. 270:11098-11102(1995) [PubMed: 7744740] [Abstract] Cited for: CHARACTERIZATION. |
| [10] | "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry." Zhang H., Li X.-J., Martin D.B., Aebersold R. Nat. Biotechnol. 21:660-666(2003) [PubMed: 12754519] [Abstract] Cited for: GLYCOSYLATION AT ASN-259 AND ASN-286. |
| [11] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-259, MASS SPECTROMETRY. Tissue: Plasma. |
| [12] | "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach." Lewandrowski U., Moebius J., Walter U., Sickmann A. Mol. Cell. Proteomics 5:226-233(2006) [PubMed: 16263699] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-259, MASS SPECTROMETRY. Tissue: Platelet. |
| [13] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [14] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-259 AND ASN-286, MASS SPECTROMETRY. Tissue: Liver. |
| [15] | "Molecular analysis of acid ceramidase deficiency in patients with Farber disease." Bar J., Linke T., Ferlinz K., Neumann U., Schuchman E.H., Sandhoff K. Hum. Mutat. 17:199-209(2001) [PubMed: 11241842] [Abstract] Cited for: VARIANTS FD CYS-36 AND ASP-320. |
| [16] | "Mutation analysis of the acid ceramidase gene in Japanese patients with Farber disease." Muramatsu T., Sakai N., Yanagihara L., Yamada M., Nishigaki T., Kokubu C., Tsukamoto H., Ito M., Inui K. J. Inherit. Metab. Dis. 25:585-592(2002) [PubMed: 12638942] [Abstract] Cited for: VARIANTS FD VAL-96 DEL; GLU-97 AND ARG-235, VARIANT ILE-369. |
| [17] | "Farber lipogranulomatosis: clinical and molecular genetic analysis reveals a novel mutation in an Indian family." Devi A.R.R., Gopikrishna M., Ratheesh R., Savithri G., Swarnalata G., Bashyam M. J. Hum. Genet. 51:811-814(2006) [PubMed: 16951918] [Abstract] Cited for: VARIANT FD VAL-182. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U70063 mRNA. Translation: AAC50907.1. U47674 mRNA. Translation: AAC73009.1. Frameshift. AY305384 mRNA. Translation: AAQ75550.1. AF220175, AF220172, AF220173 Genomic DNA. Translation: AAF91230.1. AC124242 Genomic DNA. No translation available. BC016481 mRNA. Translation: AAH16481.1. | |
| IPI | IPI00013698. IPI00418446. |
| UniGene | Hs.527412 Hs.633993 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13510. 2 interactions. |
Protein family/group databases | |
| MEROPS | C89.001. |
Proteomic databases | |
| PRIDE | Q13510. |
Genome annotation databases | |
| Ensembl | ENSG00000104763. Homo sapiens. [Contig view] |
Organism-specific databases | |
| GeneCards | GC08M017958. |
| HGNC | HGNC:735. ASAH1. |
| HPA | HPA005468. |
| MIM | 228000. gene+phenotype. |
| Orphanet | 333. Farber lipogranulomatosis. |
| PharmGKB | PA35025. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q13510. |
Enzyme and pathway databases | |
| BRENDA | 3.5.1.23. 247. |
| Pathway_Interaction_DB | ceramidepathway. Ceramide signaling pathway. |
Gene expression databases | |
| ArrayExpress | Q13510. |
| Bgee | Q13510. Q6W898. |
| CleanEx | HS_ASAH1. |
| GermOnline | ENSG00000104763. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR016699. Acid_ceramidase-like. IPR003199. Chologlycine_hydro. [Graphical view] |
| Pfam | PF02275. CBAH. 1 hit. [Graphical view] |
| PIRSF | PIRSF017632. Acid_ceramidase-like. 1 hit. |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | ASAH1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13510 Secondary accession number(s): Q6W898 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


