Q13510 (ASAH1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 132.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Acid ceramidase Short name=AC Short name=ACDase Short name=Acid CDase EC=3.5.1.23 Alternative name(s): Acylsphingosine deacylase N-acylsphingosine amidohydrolase Putative 32 kDa heart protein Short name=PHP32 Cleaved into the following 2 chains: | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 395 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid. |
| Catalytic activity | N-acylsphingosine + H2O = a carboxylate + sphingosine. |
| Subunit structure | Heterodimer of one alpha and one beta subunit. |
| Subcellular location | |
| Tissue specificity | Broadly expressed with highest expression in heart. |
| Involvement in disease | Farber lipogranulomatosis (FL) [MIM:228000]: Sphingolipid disease characterized by subcutaneous lipid-loaded nodules, excruciating pain in the joints and extremities, marked accumulation of ceramide in lysosomes, and death by three years of age. Spinal muscular atrophy with progressive myoclonic epilepsy (SMAPME) [MIM:159950]: An autosomal recessive neuromuscular disorder characterized by childhood onset of motor deficits and progressive myoclonic seizures, after normal developmental milestones. Proximal muscle weakness and generalized muscular atrophy are due to degeneration of spinal motor neurons. Myoclonic epilepsy is generally resistant to conventional therapy. The disease course is progressive and leads to respiratory muscle involvement and severe handicap or early death from respiratory insufficiency. |
| Sequence similarities | Belongs to the acid ceramidase family. |
| Sequence caution | The sequence AAC73009.1 differs from that shown. Reason: Frameshift at positions 15 and 21. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13510-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13510-2) The sequence of this isoform differs from the canonical sequence as follows: 1-26: MPGRSCVALVLLAAAVSCAVAQHAPP → MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQ | ||||||
| Isoform 3 (identifier: Q13510-3) The sequence of this isoform differs from the canonical sequence as follows: 1-26: MPGRSCVALVLLAAAVSCAVAQHAPP → MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQ 42-42: T → TVFPAVIR 73-101: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 21 | 21 | Potential | ||||||
| Chain | 22 – 142 | 121 | Acid ceramidase subunit alpha | PRO_0000002312 | |||||
| Chain | 143 – 395 | 253 | Acid ceramidase subunit beta | PRO_0000002313 | |||||
Amino acid modifications | |||||||||
| Glycosylation | 173 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 195 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 259 | 1 | N-linked (GlcNAc...) Ref.10 Ref.11 Ref.12 Ref.13 | ||||||
| Glycosylation | 286 | 1 | N-linked (GlcNAc...) Ref.10 Ref.13 | ||||||
| Glycosylation | 342 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 348 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 26 | 26 | MPGRS…QHAPP → MNCCIGLGEKARGSHRASYP SLSALFTEASILGFGSFAVK AQ in isoform 2 and isoform 3. | VSP_037504 | |||||
| Alternative sequence | 42 | 1 | T → TVFPAVIR in isoform 3. | VSP_046284 | |||||
| Alternative sequence | 73 – 101 | 29 | Missing in isoform 3. | VSP_046285 | |||||
| Natural variant | 22 | 1 | Q → H in FL. Ref.5 | VAR_038166 | |||||
| Natural variant | 23 | 1 | H → D in FL. Ref.5 | VAR_038167 | |||||
| Natural variant | 36 | 1 | Y → C in FL. Ref.15 | VAR_021579 | |||||
| Natural variant | 42 | 1 | T → M in SMAPME; results in reduced activity. Ref.18 | VAR_068722 | |||||
| Natural variant | 70 | 1 | A → V. Corresponds to variant rs10103355 [ dbSNP | Ensembl ]. | VAR_057979 | |||||
| Natural variant | 72 | 1 | V → M. Ref.1 Ref.2 Ref.5 Ref.8 Corresponds to variant rs1071645 [ dbSNP | Ensembl ]. | VAR_008860 | |||||
| Natural variant | 88 | 1 | V → M. Corresponds to variant rs1071645 [ dbSNP | Ensembl ]. | VAR_057980 | |||||
| Natural variant | 93 | 1 | I → V. Ref.1 Ref.2 Ref.5 Ref.8 Corresponds to variant rs1049874 [ dbSNP | Ensembl ]. | VAR_008861 | |||||
| Natural variant | 96 | 1 | Missing in FL. Ref.16 | VAR_021580 | |||||
| Natural variant | 97 | 1 | V → E in FL. Ref.16 | VAR_021581 | |||||
| Natural variant | 124 | 1 | D → E. Corresponds to variant rs2472205 [ dbSNP | Ensembl ]. | VAR_038168 | |||||
| Natural variant | 138 | 1 | E → V in FL. Ref.5 Ref.6 Corresponds to variant rs28934273 [ dbSNP | Ensembl ]. | VAR_021582 | |||||
| Natural variant | 182 | 1 | L → V in FL. Ref.17 | VAR_038169 | |||||
| Natural variant | 222 | 1 | T → K in FL. Ref.1 Ref.5 | VAR_008862 | |||||
| Natural variant | 235 | 1 | G → R in FL. Ref.16 | VAR_021583 | |||||
| Natural variant | 246 | 1 | V → A. Ref.1 Ref.2 Ref.5 Ref.8 Corresponds to variant rs10103355 [ dbSNP | Ensembl ]. | VAR_038170 | |||||
| Natural variant | 254 | 1 | R → G in FL. Ref.6 | VAR_021584 | |||||
| Natural variant | 320 | 1 | N → D in FL. Ref.5 Ref.15 | VAR_021585 | |||||
| Natural variant | 362 | 1 | P → R in FL. Ref.6 | VAR_021586 | |||||
| Natural variant | 369 | 1 | V → I. Ref.16 Corresponds to variant rs17636067 [ dbSNP | Ensembl ]. | VAR_021587 | |||||
Experimental info | |||||||||
| Sequence conflict | 122 | 1 | V → A in AAQ75550. Ref.4 | ||||||
| Sequence conflict | 142 | 1 | I → V in AAH16828. Ref.8 | ||||||
| Sequence conflict | 155 | 1 | L → P in AAQ75550. Ref.4 | ||||||
| Sequence conflict | 233 | 1 | Y → N in AAQ75550. Ref.4 | ||||||
| Sequence conflict | 364 | 1 | L → P in AAQ75550. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a full-length complementary DNA encoding human acid ceramidase. Identification of the first molecular lesion causing Farber disease." Koch J., Gaertner S., Li C.M., Quintern L.E., Bernardo K., Levran O., Schnabel D., Desnick R.J., Schuchman E.H., Sandhoff K. J. Biol. Chem. 271:33110-33115(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, VARIANT FL LYS-222, VARIANTS MET-72; VAL-93 AND ALA-246. Tissue: Fibroblast, Pituitary and Urine. |
| [2] | "A new gene family predicted by a novel human heart cDNA." Churchill J.R., Wieland S.J., Hoffman S., Gallin E.K., Murphy P.M. Mol. Biol. Cell 6:418-418(1995) Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS MET-72; VAL-93 AND ALA-246. |
| [3] | Wieland S.J., Hoffman S., Churchill J.R., Gallin E.K., Murphy P.M. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [4] | "A new spermatogenesis related gene." Fan M.M., Miao S.Y., Zhang X.D., Qiao Y., Liang G., Wang L.F. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [5] | "Human acid ceramidase gene: novel mutations in Farber disease." Zhang Z., Mandal A.K., Mital A., Popescu N., Zimonjic D., Moser A., Moser H., Mukherjee A.B. Mol. Genet. Metab. 70:301-309(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS FL HIS-22; ASP-23; VAL-138; LYS-222 AND ASP-320, VARIANTS MET-72; VAL-93 AND ALA-246. |
| [6] | "The human acid ceramidase gene (ASAH): structure, chromosomal location, mutation analysis, and expression." Li C.M., Park J.H., He X., Levy B., Chen F., Arai K., Adler D.A., Disteche C.M., Koch J., Sandhoff K., Schuchman E.H. Genomics 62:223-231(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS FL VAL-138; GLY-254 AND ARG-362. |
| [7] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS MET-72; VAL-93 AND ALA-246. Tissue: Bone marrow and Skin. |
| [9] | "Purification, characterization, and biosynthesis of human acid ceramidase." Bernardo K., Hurwitz R., Zenk T., Desnick R.J., Ferlinz K., Schuchman E.H., Sandhoff K. J. Biol. Chem. 270:11098-11102(1995) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION. |
| [10] | "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry." Zhang H., Li X.-J., Martin D.B., Aebersold R. Nat. Biotechnol. 21:660-666(2003) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-259 AND ASN-286. |
| [11] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-259, MASS SPECTROMETRY. Tissue: Plasma. |
| [12] | "Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach." Lewandrowski U., Moebius J., Walter U., Sickmann A. Mol. Cell. Proteomics 5:226-233(2006) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-259, MASS SPECTROMETRY. Tissue: Platelet. |
| [13] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-259 AND ASN-286, MASS SPECTROMETRY. Tissue: Liver. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "Molecular analysis of acid ceramidase deficiency in patients with Farber disease." Bar J., Linke T., Ferlinz K., Neumann U., Schuchman E.H., Sandhoff K. Hum. Mutat. 17:199-209(2001) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS FL CYS-36 AND ASP-320. |
| [16] | "Mutation analysis of the acid ceramidase gene in Japanese patients with Farber disease." Muramatsu T., Sakai N., Yanagihara L., Yamada M., Nishigaki T., Kokubu C., Tsukamoto H., Ito M., Inui K. J. Inherit. Metab. Dis. 25:585-592(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS FL VAL-96 DEL; GLU-97 AND ARG-235, VARIANT ILE-369. |
| [17] | "Farber lipogranulomatosis: clinical and molecular genetic analysis reveals a novel mutation in an Indian family." Devi A.R.R., Gopikrishna M., Ratheesh R., Savithri G., Swarnalata G., Bashyam M. J. Hum. Genet. 51:811-814(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT FL VAL-182. |
| [18] | "Spinal muscular atrophy associated with progressive myoclonic epilepsy is caused by mutations in ASAH1." Zhou J., Tawk M., Tiziano F.D., Veillet J., Bayes M., Nolent F., Garcia V., Servidei S., Bertini E., Castro-Giner F., Renda Y., Carpentier S., Andrieu-Abadie N., Gut I., Levade T., Topaloglu H., Melki J. Am. J. Hum. Genet. 91:5-14(2012) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT SMAPME MET-42, CHARACTERIZATION OF VARIANT SMAPME MET-42. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U70063 mRNA. Translation: AAC50907.1. U47674 mRNA. Translation: AAC73009.1. Frameshift. AY305384 mRNA. Translation: AAQ75550.1. AF220175, AF220172, AF220173 Genomic DNA. Translation: AAF91230.1. AC124242 Genomic DNA. No translation available. BC016481 mRNA. Translation: AAH16481.1. BC016828 mRNA. Translation: AAH16828.1. |
| IPI | IPI00013698. IPI00059685. IPI00418446. |
| RefSeq | NP_001120977.1. NM_001127505.1. NP_004306.3. NM_004315.4. NP_808592.2. NM_177924.3. |
| UniGene | Hs.527412. Hs.633993. |
3D structure databases | |
| ProteinModelPortal | Q13510. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13510. 5 interactions. |
| MINT | MINT-1368026. |
| STRING | 9606.ENSP00000371152. |
Protein family/group databases | |
| MEROPS | C89.001. |
PTM databases | |
| PhosphoSite | Q13510. |
Polymorphism databases | |
| DMDM | 239938949. |
Proteomic databases | |
| PaxDb | Q13510. |
| PRIDE | Q13510. |
Protocols and materials databases | |
| DNASU | 427. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262097; ENSP00000262097; ENSG00000104763. ENST00000314146; ENSP00000326970; ENSG00000104763. ENST00000381733; ENSP00000371152; ENSG00000104763. |
| GeneID | 427. |
| KEGG | hsa:427. |
| UCSC | uc003wyl.2. human. uc003wyn.2. human. |
Organism-specific databases | |
| CTD | 427. |
| GeneCards | GC08M017958. |
| HGNC | HGNC:735. ASAH1. |
| HPA | HPA005468. |
| MIM | 159950. phenotype. 228000. phenotype. 613468. gene. |
| neXtProt | NX_Q13510. |
| Orphanet | 333. Farber lipogranulomatosis. 2590. Hereditary myoclonus - progressive distal muscular atrophy. |
| PharmGKB | PA35025. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG84249. |
| HOVERGEN | HBG050586. |
| KO | K12348. |
| OMA | GMLTGFK. |
| OrthoDB | EOG46WZ8M. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | ceramidepathway. Ceramide signaling pathway. |
| Reactome | REACT_111217. Metabolism. |
| SABIO-RK | Q13510. |
Gene expression databases | |
| ArrayExpress | Q13510. |
| Bgee | Q13510. |
| CleanEx | HS_ASAH1. |
| Genevestigator | Q13510. |
| GermOnline | ENSG00000104763. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR016699. Acid_ceramidase-like. IPR003199. Chologlycine_hydro. [Graphical view] |
| Pfam | PF02275. CBAH. 1 hit. [Graphical view] |
| PIRSF | PIRSF017632. Acid_ceramidase-like. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL5463. |
| ChiTaRS | ASAH1. human. |
| GenomeRNAi | 427. |
| NextBio | 1787. |
| SOURCE | Search... |
Entry information
| Entry name | ASAH1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13510 Secondary accession number(s): E9PDS0, Q6W898, Q96AS2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
