Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q13491

- GPM6B_HUMAN

UniProt

Q13491 - GPM6B_HUMAN

Protein

Neuronal membrane glycoprotein M6-b

Gene

GPM6B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 2 (03 Apr 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in neural development. Involved in regulation of osteoblast function and bone formation. Involved in matrix vesicle release by osteoblasts; this function seems to involve maintenance of the actin cytoskeleton. May be involved in cellular trafficking of SERT and thereby in regulation of serotonin uptake.1 Publication

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. extracellular matrix assembly Source: UniProtKB
    3. negative regulation of protein localization to cell surface Source: UniProtKB
    4. negative regulation of serotonin uptake Source: UniProtKB
    5. nervous system development Source: UniProtKB
    6. ossification Source: UniProtKB-KW
    7. positive regulation of bone mineralization Source: UniProtKB
    8. protein transport Source: UniProtKB-KW
    9. regulation of actin cytoskeleton organization Source: UniProtKB
    10. regulation of focal adhesion assembly Source: UniProtKB

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Neurogenesis, Osteogenesis, Protein transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Neuronal membrane glycoprotein M6-b
    Short name:
    M6b
    Gene namesi
    Name:GPM6B
    Synonyms:M6B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:4461. GPM6B.

    Subcellular locationi

    Cell membrane By similarity; Multi-pass membrane protein By similarity
    Note: Colocalizes with SERT at the plasma membrane.By similarity

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. membrane raft Source: UniProtKB
    3. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28844.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 265265Neuronal membrane glycoprotein M6-bPRO_0000159021Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi73 – 731N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi177 – 1771N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ13491.
    PRIDEiQ13491.

    PTM databases

    PhosphoSiteiQ13491.

    Expressioni

    Tissue specificityi

    Neurons and glia; cerebellar Bergmann glia, in glia within white matter tracts of the cerebellum and cerebrum, and in embryonic dorsal root ganglia.

    Gene expression databases

    ArrayExpressiQ13491.
    BgeeiQ13491.
    CleanExiHS_GPM6B.
    GenevestigatoriQ13491.

    Organism-specific databases

    HPAiHPA002913.

    Interactioni

    Subunit structurei

    Interacts with SERT.1 Publication

    Protein-protein interaction databases

    BioGridi109085. 4 interactions.
    IntActiQ13491. 2 interactions.
    STRINGi9606.ENSP00000316861.

    Structurei

    3D structure databases

    ProteinModelPortaliQ13491.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei31 – 5121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei90 – 11021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei136 – 15621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei224 – 24421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the myelin proteolipid protein family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG300631.
    HOGENOMiHOG000231338.
    HOVERGENiHBG000096.
    OMAiPGRICGS.
    OrthoDBiEOG7X3QRG.
    PhylomeDBiQ13491.
    TreeFamiTF315162.

    Family and domain databases

    InterProiIPR001614. Myelin_PLP.
    IPR018237. Myelin_PLP_CS.
    [Graphical view]
    PANTHERiPTHR11683. PTHR11683. 1 hit.
    PfamiPF01275. Myelin_PLP. 1 hit.
    [Graphical view]
    PRINTSiPR00214. MYELINPLP.
    SMARTiSM00002. PLP. 1 hit.
    [Graphical view]
    PROSITEiPS00575. MYELIN_PLP_1. 1 hit.
    PS01004. MYELIN_PLP_2. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q13491-1) [UniParc]FASTAAdd to Basket

    Also known as: A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKPAMETAAE ENTEQSQERK GCFECCIKCL GGVPYASLVA TILCFSGVAL    50
    FCGCGHVALA GTVAILEQHF STNASDHALL SEVIQLMQYV IYGIASFFFL 100
    YGIILLAEGF YTTSAVKELH GEFKTTACGR CISGMFVFLT YVLGVAWLGV 150
    FGFSAVPVFM FYNIWSTCEV IKSPQTNGTT GVEQICVDIR QYGIIPWNAF 200
    PGKICGSALE NICNTNEFYM SYHLFIVACA GAGATVIALL IYMMATTYNY 250
    AVLKFKSRED CCTKF 265
    Length:265
    Mass (Da):28,989
    Last modified:April 3, 2002 - v2
    Checksum:i560AB12DD2B5AE75
    GO
    Isoform 2 (identifier: Q13491-2) [UniParc]FASTAAdd to Basket

    Also known as: B

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MKPAMETAAEENTEQSQERK → M

    Show »
    Length:246
    Mass (Da):26,830
    Checksum:i9DA14EFDF2CFB81F
    GO
    Isoform 3 (identifier: Q13491-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         20-20: K → KVNSRAEMEIGRYHWMYPGSKNHQYHPVPTLGDRASPLSSP

    Show »
    Length:305
    Mass (Da):33,538
    Checksum:i69BE0DAA9B35C3A0
    GO
    Isoform 4 (identifier: Q13491-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         20-20: K → KVNSRAEMEIGRYHWMYPGSKNHQYHPVPTLGDRASPLSSP
         240-265: LIYMMATTYNYAVLKFKSREDCCTKF → IHFLMILSSNWAYLKDASKMQAYQDIKAKEEQELQDIQSRSKEQLNSYT

    Note: Contains a phosphoserine at position 318.

    Show »
    Length:328
    Mass (Da):36,220
    Checksum:i58E2FC71DEA76C7A
    GO

    Sequence cautioni

    The sequence AAB16888.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAC19165.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2020MKPAM…SQERK → M in isoform 2. 1 PublicationVSP_003326Add
    BLAST
    Alternative sequencei20 – 201K → KVNSRAEMEIGRYHWMYPGS KNHQYHPVPTLGDRASPLSS P in isoform 3 and isoform 4. 2 PublicationsVSP_041121
    Alternative sequencei240 – 26526LIYMM…CCTKF → IHFLMILSSNWAYLKDASKM QAYQDIKAKEEQELQDIQSR SKEQLNSYT in isoform 4. 1 PublicationVSP_043247Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U45955 mRNA. Translation: AAB16888.1. Different initiation.
    AF037347
    , AF037341, AF037342, AF037343, AF037344, AF037345, AF037346 Genomic DNA. Translation: AAC19165.1. Different initiation.
    AF037347
    , AF037340, AF037342, AF037343, AF037344, AF037345, AF037346 Genomic DNA. Translation: AAC19166.1.
    AF016004 mRNA. Translation: AAC28560.1.
    AF047197
    , AF047191, AF047192, AF047193, AF047194, AF047195, AF047196 Genomic DNA. Translation: AAD13718.1.
    AK095657 mRNA. Translation: BAC04600.1.
    AC003035 Genomic DNA. No translation available.
    AC003037 Genomic DNA. No translation available.
    CH471074 Genomic DNA. Translation: EAW98845.1.
    CH471074 Genomic DNA. Translation: EAW98846.1.
    BC008151 mRNA. Translation: AAH08151.1.
    BC047295 mRNA. Translation: AAH47295.1.
    CCDSiCCDS14158.1. [Q13491-1]
    CCDS35206.1. [Q13491-4]
    CCDS35207.1. [Q13491-3]
    CCDS48084.1. [Q13491-2]
    RefSeqiNP_001001994.1. NM_001001994.1. [Q13491-2]
    NP_001001995.1. NM_001001995.1. [Q13491-4]
    NP_001001996.1. NM_001001996.1. [Q13491-3]
    NP_005269.1. NM_005278.3. [Q13491-1]
    UniGeneiHs.495710.

    Genome annotation databases

    EnsembliENST00000316715; ENSP00000316861; ENSG00000046653. [Q13491-4]
    ENST00000355135; ENSP00000347258; ENSG00000046653. [Q13491-3]
    ENST00000356942; ENSP00000349420; ENSG00000046653. [Q13491-1]
    ENST00000454189; ENSP00000389915; ENSG00000046653. [Q13491-2]
    GeneIDi2824.
    KEGGihsa:2824.
    UCSCiuc004cvw.3. human. [Q13491-4]
    uc004cvy.2. human. [Q13491-3]
    uc004cvz.2. human. [Q13491-1]
    uc004cwa.2. human. [Q13491-2]

    Polymorphism databases

    DMDMi20141466.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U45955 mRNA. Translation: AAB16888.1 . Different initiation.
    AF037347
    , AF037341 , AF037342 , AF037343 , AF037344 , AF037345 , AF037346 Genomic DNA. Translation: AAC19165.1 . Different initiation.
    AF037347
    , AF037340 , AF037342 , AF037343 , AF037344 , AF037345 , AF037346 Genomic DNA. Translation: AAC19166.1 .
    AF016004 mRNA. Translation: AAC28560.1 .
    AF047197
    , AF047191 , AF047192 , AF047193 , AF047194 , AF047195 , AF047196 Genomic DNA. Translation: AAD13718.1 .
    AK095657 mRNA. Translation: BAC04600.1 .
    AC003035 Genomic DNA. No translation available.
    AC003037 Genomic DNA. No translation available.
    CH471074 Genomic DNA. Translation: EAW98845.1 .
    CH471074 Genomic DNA. Translation: EAW98846.1 .
    BC008151 mRNA. Translation: AAH08151.1 .
    BC047295 mRNA. Translation: AAH47295.1 .
    CCDSi CCDS14158.1. [Q13491-1 ]
    CCDS35206.1. [Q13491-4 ]
    CCDS35207.1. [Q13491-3 ]
    CCDS48084.1. [Q13491-2 ]
    RefSeqi NP_001001994.1. NM_001001994.1. [Q13491-2 ]
    NP_001001995.1. NM_001001995.1. [Q13491-4 ]
    NP_001001996.1. NM_001001996.1. [Q13491-3 ]
    NP_005269.1. NM_005278.3. [Q13491-1 ]
    UniGenei Hs.495710.

    3D structure databases

    ProteinModelPortali Q13491.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109085. 4 interactions.
    IntActi Q13491. 2 interactions.
    STRINGi 9606.ENSP00000316861.

    PTM databases

    PhosphoSitei Q13491.

    Polymorphism databases

    DMDMi 20141466.

    Proteomic databases

    PaxDbi Q13491.
    PRIDEi Q13491.

    Protocols and materials databases

    DNASUi 2824.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000316715 ; ENSP00000316861 ; ENSG00000046653 . [Q13491-4 ]
    ENST00000355135 ; ENSP00000347258 ; ENSG00000046653 . [Q13491-3 ]
    ENST00000356942 ; ENSP00000349420 ; ENSG00000046653 . [Q13491-1 ]
    ENST00000454189 ; ENSP00000389915 ; ENSG00000046653 . [Q13491-2 ]
    GeneIDi 2824.
    KEGGi hsa:2824.
    UCSCi uc004cvw.3. human. [Q13491-4 ]
    uc004cvy.2. human. [Q13491-3 ]
    uc004cvz.2. human. [Q13491-1 ]
    uc004cwa.2. human. [Q13491-2 ]

    Organism-specific databases

    CTDi 2824.
    GeneCardsi GC0XM013698.
    HGNCi HGNC:4461. GPM6B.
    HPAi HPA002913.
    MIMi 300051. gene.
    neXtProti NX_Q13491.
    PharmGKBi PA28844.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG300631.
    HOGENOMi HOG000231338.
    HOVERGENi HBG000096.
    OMAi PGRICGS.
    OrthoDBi EOG7X3QRG.
    PhylomeDBi Q13491.
    TreeFami TF315162.

    Miscellaneous databases

    ChiTaRSi GPM6B. human.
    GeneWikii GPM6B.
    GenomeRNAii 2824.
    NextBioi 11135.
    PROi Q13491.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q13491.
    Bgeei Q13491.
    CleanExi HS_GPM6B.
    Genevestigatori Q13491.

    Family and domain databases

    InterProi IPR001614. Myelin_PLP.
    IPR018237. Myelin_PLP_CS.
    [Graphical view ]
    PANTHERi PTHR11683. PTHR11683. 1 hit.
    Pfami PF01275. Myelin_PLP. 1 hit.
    [Graphical view ]
    PRINTSi PR00214. MYELINPLP.
    SMARTi SM00002. PLP. 1 hit.
    [Graphical view ]
    PROSITEi PS00575. MYELIN_PLP_1. 1 hit.
    PS01004. MYELIN_PLP_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Spinal cord.
    2. "Mutation analysis of the M6b gene in patients with Rett syndrome."
      Narayanan V., Olinsky S.L., Dahle E., Naidu S., Zoghbi H.Y.
      Am. J. Med. Genet. 78:165-168(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
    3. "Cloning of human full-length m6b1 gene."
      Xia J.-H., Liu C.-Y., Ruan Q.-G., Fu J.-J., Deng H.-X.
      Submitted (JUL-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "Molecular cloning of a splicing form of M6b."
      Liu C.-Y., Cui F., Fu J.-J., Xia J.-H.
      Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Brain.
    6. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Brain.
    9. "Membrane glycoprotein M6B interacts with the human serotonin transporter."
      Fjorback A.W., Muller H.K., Wiborg O.
      J. Mol. Neurosci. 37:191-200(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SERT.
    10. "GPM6B regulates osteoblast function and induction of mineralization by controlling cytoskeleton and matrix vesicle release."
      Drabek K., van de Peppel J., Eijken M., van Leeuwen J.P.
      J. Bone Miner. Res. 26:2045-2051(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-318 (ISOFORM 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiGPM6B_HUMAN
    AccessioniPrimary (citable) accession number: Q13491
    Secondary accession number(s): O76077, Q86X43, Q8N956
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: April 3, 2002
    Last modified: October 1, 2014
    This is version 120 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3