SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q13491

- GPM6B_HUMAN

UniProt

Q13491 - GPM6B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Neuronal membrane glycoprotein M6-b

Gene
GPM6B, M6B
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May be involved in neural development. Involved in regulation of osteoblast function and bone formation. Involved in matrix vesicle release by osteoblasts; this function seems to involve maintenance of the actin cytoskeleton. May be involved in cellular trafficking of SERT and thereby in regulation of serotonin uptake.1 Publication

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. extracellular matrix assembly Source: UniProtKB
  3. negative regulation of protein localization to cell surface Source: UniProtKB
  4. negative regulation of serotonin uptake Source: UniProtKB
  5. nervous system development Source: UniProtKB
  6. ossification Source: UniProtKB-KW
  7. positive regulation of bone mineralization Source: UniProtKB
  8. protein transport Source: UniProtKB-KW
  9. regulation of actin cytoskeleton organization Source: UniProtKB
  10. regulation of focal adhesion assembly Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Neurogenesis, Osteogenesis, Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Neuronal membrane glycoprotein M6-b
Short name:
M6b
Gene namesi
Name:GPM6B
Synonyms:M6B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:4461. GPM6B.

Subcellular locationi

Cell membrane; Multi-pass membrane protein By similarity
Note: Colocalizes with SERT at the plasma membrane By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei31 – 5121Helical; Reviewed predictionAdd
BLAST
Transmembranei90 – 11021Helical; Reviewed predictionAdd
BLAST
Transmembranei136 – 15621Helical; Reviewed predictionAdd
BLAST
Transmembranei224 – 24421Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. membrane raft Source: UniProtKB
  3. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28844.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 265265Neuronal membrane glycoprotein M6-bPRO_0000159021Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi73 – 731N-linked (GlcNAc...) Reviewed prediction
Glycosylationi177 – 1771N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ13491.
PRIDEiQ13491.

PTM databases

PhosphoSiteiQ13491.

Expressioni

Tissue specificityi

Neurons and glia; cerebellar Bergmann glia, in glia within white matter tracts of the cerebellum and cerebrum, and in embryonic dorsal root ganglia.

Gene expression databases

ArrayExpressiQ13491.
BgeeiQ13491.
CleanExiHS_GPM6B.
GenevestigatoriQ13491.

Organism-specific databases

HPAiHPA002913.

Interactioni

Subunit structurei

Interacts with SERT.1 Publication

Protein-protein interaction databases

BioGridi109085. 4 interactions.
IntActiQ13491. 2 interactions.
STRINGi9606.ENSP00000316861.

Structurei

3D structure databases

ProteinModelPortaliQ13491.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG300631.
HOGENOMiHOG000231338.
HOVERGENiHBG000096.
OMAiPGRICGS.
OrthoDBiEOG7X3QRG.
PhylomeDBiQ13491.
TreeFamiTF315162.

Family and domain databases

InterProiIPR001614. Myelin_PLP.
IPR018237. Myelin_PLP_CS.
[Graphical view]
PANTHERiPTHR11683. PTHR11683. 1 hit.
PfamiPF01275. Myelin_PLP. 1 hit.
[Graphical view]
PRINTSiPR00214. MYELINPLP.
SMARTiSM00002. PLP. 1 hit.
[Graphical view]
PROSITEiPS00575. MYELIN_PLP_1. 1 hit.
PS01004. MYELIN_PLP_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q13491-1) [UniParc]FASTAAdd to Basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKPAMETAAE ENTEQSQERK GCFECCIKCL GGVPYASLVA TILCFSGVAL    50
FCGCGHVALA GTVAILEQHF STNASDHALL SEVIQLMQYV IYGIASFFFL 100
YGIILLAEGF YTTSAVKELH GEFKTTACGR CISGMFVFLT YVLGVAWLGV 150
FGFSAVPVFM FYNIWSTCEV IKSPQTNGTT GVEQICVDIR QYGIIPWNAF 200
PGKICGSALE NICNTNEFYM SYHLFIVACA GAGATVIALL IYMMATTYNY 250
AVLKFKSRED CCTKF 265
Length:265
Mass (Da):28,989
Last modified:April 3, 2002 - v2
Checksum:i560AB12DD2B5AE75
GO
Isoform 2 (identifier: Q13491-2) [UniParc]FASTAAdd to Basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MKPAMETAAEENTEQSQERK → M

Show »
Length:246
Mass (Da):26,830
Checksum:i9DA14EFDF2CFB81F
GO
Isoform 3 (identifier: Q13491-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     20-20: K → KVNSRAEMEIGRYHWMYPGSKNHQYHPVPTLGDRASPLSSP

Show »
Length:305
Mass (Da):33,538
Checksum:i69BE0DAA9B35C3A0
GO
Isoform 4 (identifier: Q13491-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     20-20: K → KVNSRAEMEIGRYHWMYPGSKNHQYHPVPTLGDRASPLSSP
     240-265: LIYMMATTYNYAVLKFKSREDCCTKF → IHFLMILSSNWAYLKDASKMQAYQDIKAKEEQELQDIQSRSKEQLNSYT

Note: Contains a phosphoserine at position 318.

Show »
Length:328
Mass (Da):36,220
Checksum:i58E2FC71DEA76C7A
GO

Sequence cautioni

The sequence AAB16888.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAC19165.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2020MKPAM…SQERK → M in isoform 2. VSP_003326Add
BLAST
Alternative sequencei20 – 201K → KVNSRAEMEIGRYHWMYPGS KNHQYHPVPTLGDRASPLSS P in isoform 3 and isoform 4. VSP_041121
Alternative sequencei240 – 26526LIYMM…CCTKF → IHFLMILSSNWAYLKDASKM QAYQDIKAKEEQELQDIQSR SKEQLNSYT in isoform 4. VSP_043247Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U45955 mRNA. Translation: AAB16888.1. Different initiation.
AF037347
, AF037341, AF037342, AF037343, AF037344, AF037345, AF037346 Genomic DNA. Translation: AAC19165.1. Different initiation.
AF037347
, AF037340, AF037342, AF037343, AF037344, AF037345, AF037346 Genomic DNA. Translation: AAC19166.1.
AF016004 mRNA. Translation: AAC28560.1.
AF047197
, AF047191, AF047192, AF047193, AF047194, AF047195, AF047196 Genomic DNA. Translation: AAD13718.1.
AK095657 mRNA. Translation: BAC04600.1.
AC003035 Genomic DNA. No translation available.
AC003037 Genomic DNA. No translation available.
CH471074 Genomic DNA. Translation: EAW98845.1.
CH471074 Genomic DNA. Translation: EAW98846.1.
BC008151 mRNA. Translation: AAH08151.1.
BC047295 mRNA. Translation: AAH47295.1.
CCDSiCCDS14158.1. [Q13491-1]
CCDS35206.1. [Q13491-4]
CCDS35207.1. [Q13491-3]
CCDS48084.1. [Q13491-2]
RefSeqiNP_001001994.1. NM_001001994.1. [Q13491-2]
NP_001001995.1. NM_001001995.1. [Q13491-4]
NP_001001996.1. NM_001001996.1. [Q13491-3]
NP_005269.1. NM_005278.3. [Q13491-1]
UniGeneiHs.495710.

Genome annotation databases

EnsembliENST00000316715; ENSP00000316861; ENSG00000046653. [Q13491-4]
ENST00000355135; ENSP00000347258; ENSG00000046653. [Q13491-3]
ENST00000356942; ENSP00000349420; ENSG00000046653. [Q13491-1]
ENST00000454189; ENSP00000389915; ENSG00000046653. [Q13491-2]
GeneIDi2824.
KEGGihsa:2824.
UCSCiuc004cvw.3. human. [Q13491-4]
uc004cvy.2. human. [Q13491-3]
uc004cvz.2. human. [Q13491-1]
uc004cwa.2. human. [Q13491-2]

Polymorphism databases

DMDMi20141466.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U45955 mRNA. Translation: AAB16888.1 . Different initiation.
AF037347
, AF037341 , AF037342 , AF037343 , AF037344 , AF037345 , AF037346 Genomic DNA. Translation: AAC19165.1 . Different initiation.
AF037347
, AF037340 , AF037342 , AF037343 , AF037344 , AF037345 , AF037346 Genomic DNA. Translation: AAC19166.1 .
AF016004 mRNA. Translation: AAC28560.1 .
AF047197
, AF047191 , AF047192 , AF047193 , AF047194 , AF047195 , AF047196 Genomic DNA. Translation: AAD13718.1 .
AK095657 mRNA. Translation: BAC04600.1 .
AC003035 Genomic DNA. No translation available.
AC003037 Genomic DNA. No translation available.
CH471074 Genomic DNA. Translation: EAW98845.1 .
CH471074 Genomic DNA. Translation: EAW98846.1 .
BC008151 mRNA. Translation: AAH08151.1 .
BC047295 mRNA. Translation: AAH47295.1 .
CCDSi CCDS14158.1. [Q13491-1 ]
CCDS35206.1. [Q13491-4 ]
CCDS35207.1. [Q13491-3 ]
CCDS48084.1. [Q13491-2 ]
RefSeqi NP_001001994.1. NM_001001994.1. [Q13491-2 ]
NP_001001995.1. NM_001001995.1. [Q13491-4 ]
NP_001001996.1. NM_001001996.1. [Q13491-3 ]
NP_005269.1. NM_005278.3. [Q13491-1 ]
UniGenei Hs.495710.

3D structure databases

ProteinModelPortali Q13491.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109085. 4 interactions.
IntActi Q13491. 2 interactions.
STRINGi 9606.ENSP00000316861.

PTM databases

PhosphoSitei Q13491.

Polymorphism databases

DMDMi 20141466.

Proteomic databases

PaxDbi Q13491.
PRIDEi Q13491.

Protocols and materials databases

DNASUi 2824.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000316715 ; ENSP00000316861 ; ENSG00000046653 . [Q13491-4 ]
ENST00000355135 ; ENSP00000347258 ; ENSG00000046653 . [Q13491-3 ]
ENST00000356942 ; ENSP00000349420 ; ENSG00000046653 . [Q13491-1 ]
ENST00000454189 ; ENSP00000389915 ; ENSG00000046653 . [Q13491-2 ]
GeneIDi 2824.
KEGGi hsa:2824.
UCSCi uc004cvw.3. human. [Q13491-4 ]
uc004cvy.2. human. [Q13491-3 ]
uc004cvz.2. human. [Q13491-1 ]
uc004cwa.2. human. [Q13491-2 ]

Organism-specific databases

CTDi 2824.
GeneCardsi GC0XM013698.
HGNCi HGNC:4461. GPM6B.
HPAi HPA002913.
MIMi 300051. gene.
neXtProti NX_Q13491.
PharmGKBi PA28844.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG300631.
HOGENOMi HOG000231338.
HOVERGENi HBG000096.
OMAi PGRICGS.
OrthoDBi EOG7X3QRG.
PhylomeDBi Q13491.
TreeFami TF315162.

Miscellaneous databases

ChiTaRSi GPM6B. human.
GeneWikii GPM6B.
GenomeRNAii 2824.
NextBioi 11135.
PROi Q13491.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q13491.
Bgeei Q13491.
CleanExi HS_GPM6B.
Genevestigatori Q13491.

Family and domain databases

InterProi IPR001614. Myelin_PLP.
IPR018237. Myelin_PLP_CS.
[Graphical view ]
PANTHERi PTHR11683. PTHR11683. 1 hit.
Pfami PF01275. Myelin_PLP. 1 hit.
[Graphical view ]
PRINTSi PR00214. MYELINPLP.
SMARTi SM00002. PLP. 1 hit.
[Graphical view ]
PROSITEi PS00575. MYELIN_PLP_1. 1 hit.
PS01004. MYELIN_PLP_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Spinal cord.
  2. "Mutation analysis of the M6b gene in patients with Rett syndrome."
    Narayanan V., Olinsky S.L., Dahle E., Naidu S., Zoghbi H.Y.
    Am. J. Med. Genet. 78:165-168(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2).
  3. "Cloning of human full-length m6b1 gene."
    Xia J.-H., Liu C.-Y., Ruan Q.-G., Fu J.-J., Deng H.-X.
    Submitted (JUL-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "Molecular cloning of a splicing form of M6b."
    Liu C.-Y., Cui F., Fu J.-J., Xia J.-H.
    Submitted (FEB-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Brain.
  6. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Brain.
  9. "Membrane glycoprotein M6B interacts with the human serotonin transporter."
    Fjorback A.W., Muller H.K., Wiborg O.
    J. Mol. Neurosci. 37:191-200(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SERT.
  10. "GPM6B regulates osteoblast function and induction of mineralization by controlling cytoskeleton and matrix vesicle release."
    Drabek K., van de Peppel J., Eijken M., van Leeuwen J.P.
    J. Bone Miner. Res. 26:2045-2051(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-318 (ISOFORM 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiGPM6B_HUMAN
AccessioniPrimary (citable) accession number: Q13491
Secondary accession number(s): O76077, Q86X43, Q8N956
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: April 3, 2002
Last modified: July 9, 2014
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi