Q13469 (NFAC2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 153.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear factor of activated T-cells, cytoplasmic 2 Short name=NF-ATc2 Short name=NFATc2 Alternative name(s): NFAT pre-existing subunit Short name=NF-ATp T-cell transcription factor NFAT1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 925 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. Promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway. Ref.11 |
| Subunit structure | Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. The phosphorylated form specifically interacts with XPO1; which mediates nuclear export. NFATC proteins bind to DNA as monomers. Interacts with NFATC2IP By similarity. |
| Subcellular location | Cytoplasm. Nucleus. Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. |
| Tissue specificity | Expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Isoform 1 is highly expressed in the small intestine, heart, testis, prostate, thymus, placenta and thyroid. Isoform 3 is highly expressed in stomach, uterus, placenta, trachea and thyroid. Ref.1 |
| Induction | Inducibly expressed in T-lymphocytes upon activation of the T-cell receptor (TCR) complex. Induced after co-addition of phorbol 12-myristate 13-acetate (PMA) and ionomycin. |
| Domain | the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors. Ref.8 Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors By similarity. Ref.8 |
| Post-translational modification | In resting cells, phosphorylated by NFATC-kinase on at least 18 sites in the 99-363 region. Upon cell stimulation, all these sites except Ser-243 are dephosphorylated by calcineurin. Dephosphorylation induces a conformational change that simultaneously exposes an NLS and masks an NES, which results in nuclear localization. Simultaneously, Ser-53 or Ser-56 is phosphorylated; which is required for full transcriptional activity. |
| Sequence similarities | Contains 1 RHD (Rel-like) domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| LRRK2 | Q5S007 | 3 | EBI-716258,EBI-5323863 | |
| VRK2 | Q86Y07-1 | 3 | EBI-716258,EBI-1207633 | |
| VRK2 | Q86Y07-2 | 4 | EBI-716258,EBI-1207636 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q13469-1) Also known as: C; NFATc2_IB_IIL; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13469-2) Also known as: B; The sequence of this isoform differs from the canonical sequence as follows: 908-925: VNEIIRKEFSGPPARNQT → ELIDTHLSWIQNIL | ||||||
| Isoform 3 (identifier: Q13469-3) Also known as: NFATc2_IA_IIL; The sequence of this isoform differs from the canonical sequence as follows: 1-43: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNE → MQREAAFRLGHCHPLRIMGSVDQ 908-925: VNEIIRKEFSGPPARNQT → ELIDTHLSWIQNIL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 925 | 925 | Nuclear factor of activated T-cells, cytoplasmic 2 | PRO_0000205178 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 184 – 200 | 17 | 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 213 – 229 | 17 | 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 272 – 286 | 15 | 3; approximate | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 392 – 574 | 183 | RHD | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNA binding | 421 – 428 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 111 – 116 | 6 | Calcineurin-binding | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 119 – 199 | 81 | Trans-activation domain A (TAD-A) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 161 – 175 | 15 | Required for cytoplasmic retention of the phosphorylated form By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 184 – 286 | 103 | 3 X approximate SP repeats | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 26 – 34 | 9 | 9aaTAD | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 251 – 253 | 3 | Nuclear localization signal | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 664 – 666 | 3 | Nuclear localization signal | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 904 – 913 | 10 | Nuclear export signal | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 99 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 148 | 1 | Phosphoserine Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 213 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 217 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 221 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 236 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 243 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 268 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 274 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 276 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 280 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 326 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 330 | 1 | Phosphoserine Ref.7 Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 363 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 755 | 1 | Phosphoserine Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 757 | 1 | Phosphoserine Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 759 | 1 | Phosphoserine Ref.9 Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 859 | 1 | Phosphoserine Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 43 | 43 | MNAPE…LNPNE → MQREAAFRLGHCHPLRIMGS VDQ in isoform 3. | VSP_042757 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 908 – 925 | 18 | VNEII…ARNQT → ELIDTHLSWIQNIL in isoform 2 and isoform 3. | VSP_005595 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 446 | 1 | H → R. Corresponds to variant rs12479626 [ dbSNP | Ensembl ]. | VAR_051783 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 65 | 1 | L → M in AAC50886. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 65 | 1 | L → M in AAC50887. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 397 – 399 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 402 – 405 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 408 – 414 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 436 – 439 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 442 – 445 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 450 – 452 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 454 – 461 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 464 – 466 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 474 – 478 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 481 – 483 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 490 – 492 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 494 – 496 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 498 – 503 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 505 – 507 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 510 – 512 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 515 – 520 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 523 – 526 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 529 – 531 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 541 – 552 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 553 – 555 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 556 – 563 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 571 – 576 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 579 – 584 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 586 – 589 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 595 – 602 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 608 – 614 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 616 – 618 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 620 – 626 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 630 – 632 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 637 – 641 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 646 – 648 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 654 – 662 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 663 – 665 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 671 – 676 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Recombinant NFAT1 (NFATp) is regulated by calcineurin in T cells and mediates transcription of several cytokine genes." Luo C., Burgeon E., Carew J.A., McCaffrey P.G., Badalian T.M., Lane W.S., Hogan P.G., Rao A. Mol. Cell. Biol. 16:3955-3966(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [2] | "Alternative splicing and expression of human and mouse NFAT genes." Vihma H., Pruunsild P., Timmusk T. Genomics 92:279-291(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), ALTERNATIVE SPLICING. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT." Crabtree G.R. Cell 96:611-614(1999) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [7] | "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry." Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C. Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-330, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [8] | "Nine-amino-acid transactivation domain: establishment and prediction utilities." Piskacek S., Gregor M., Nemethova M., Grabner M., Kovarik P., Piskacek M. Genomics 89:756-768(2007) [PubMed] [Europe PMC] [Abstract] Cited for: DOMAIN. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-148; SER-330; SER-755; SER-759 AND SER-859, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-757 AND SER-759, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "NFAT promotes carcinoma invasive migration through glypican-6." Yiu G.K., Kaunisto A., Chin Y.R., Toker A. Biochem. J. 440:157-166(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U43341 mRNA. Translation: AAC50886.1. U43342 mRNA. Translation: AAC50887.1. EU887573 mRNA. Translation: ACG55593.1. EU887574 mRNA. Translation: ACG55594.1. AL132866 Genomic DNA. Translation: CAC00528.2. AL035682, AL035684, AL132866 Genomic DNA. Translation: CAI18852.1. AL035682, AL035684, AL132866 Genomic DNA. Translation: CAI18853.1. AL035684, AL035682, AL132866 Genomic DNA. Translation: CAI19205.1. AL035684, AL035682, AL132866 Genomic DNA. Translation: CAI19206.1. AL132866, AL035682, AL035684 Genomic DNA. Translation: CAI23549.1. CH471077 Genomic DNA. Translation: EAW75602.1. BC144074 mRNA. Translation: AAI44075.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00247309. IPI00297845. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | G02326. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001129493.1. NM_001136021.2. NP_036472.2. NM_012340.4. NP_775114.1. NM_173091.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.599855. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-27630N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q13469. 10 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1398456. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000379330. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 68846905. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000371564; ENSP00000360619; ENSG00000101096. ENST00000396009; ENSP00000379330; ENSG00000101096. ENST00000414705; ENSP00000396471; ENSG00000101096. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 4773. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:4773. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002xwd.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 4773. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC20M050003. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:7776. NFATC2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB018567. HPA008789. HPA024369. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 600490. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA31583. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG84065. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000231780. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG069754. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K04446. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | FEGYREP. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | nfat_tfpathway. Calcineurin-regulated NFAT-dependent transcription in lymphocytes. tcrcalciumpathway. Calcium signaling in the CD4+ TCR pathway. cd8tcrdownstreampathway. Downstream signaling in naive CD8+ T cells. fcer1pathway. Fc-epsilon receptor I signaling in mast cells. wnt_calcium_pathway. Noncanonical Wnt signaling pathway. nfat_3pathway. Role of Calcineurin-dependent NFAT signaling in lymphocytes. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_118664. Calcineurin Dephosphorylates NFATC1/2/3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_NFATC2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000101096. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 2.60.40.10. 1 hit. 2.60.40.340. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR008366. NFAT. IPR008967. p53-like_TF_DNA-bd. IPR011539. RHD. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR12533. PTHR12533. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00554. RHD. 1 hit. PF01833. TIG. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01789. NUCFACTORATC. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00429. IPT. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF81296. Ig_E-set. 1 hit. SSF49417. P53_like_DNA_bnd. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS01204. REL_1. False negative. PS50254. REL_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| BindingDB | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL4120. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q13469. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 4773. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 18400. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | NFAC2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13469 Secondary accession number(s): B5B2N8 Q9UJR2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
