Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor of activated T-cells, cytoplasmic 2

Gene

NFATC2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2, IL-3, IL-4, TNF-alpha or GM-CSF. Promotes invasive migration through the activation of GPC6 expression and WNT5A signaling pathway.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi421 – 4288

GO - Molecular functioni

GO - Biological processi

  • B cell receptor signaling pathway Source: UniProtKB
  • calcineurin-NFAT signaling cascade Source: Ensembl
  • cell migration Source: UniProtKB
  • cellular response to DNA damage stimulus Source: UniProtKB
  • cytokine production Source: Ensembl
  • Fc-epsilon receptor signaling pathway Source: Reactome
  • myotube cell development Source: Ensembl
  • positive regulation of B cell proliferation Source: UniProtKB
  • positive regulation of myoblast fusion Source: Ensembl
  • positive regulation of transcription, DNA-templated Source: MGI
  • regulation of transcription, DNA-templated Source: UniProtKB
  • response to drug Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000101096-MONOMER.
ReactomeiR-HSA-2871809. FCERI mediated Ca+2 mobilization.
R-HSA-5607763. CLEC7A (Dectin-1) induces NFAT activation.
SIGNORiQ13469.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 2
Short name:
NF-ATc2
Short name:
NFATc2
Alternative name(s):
NFAT pre-existing subunit
Short name:
NF-ATp
T-cell transcription factor NFAT1
Gene namesi
Name:NFATC2
Synonyms:NFAT1, NFATP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:7776. NFATC2.

Subcellular locationi

  • Cytoplasm
  • Nucleus

  • Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.

GO - Cellular componenti

  • actin cytoskeleton Source: HPA
  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • intracellular ribonucleoprotein complex Source: Ensembl
  • nuclear chromatin Source: Ensembl
  • nuclear transcription factor complex Source: Ensembl
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi4773.
OpenTargetsiENSG00000101096.
PharmGKBiPA31583.

Polymorphism and mutation databases

BioMutaiNFATC2.
DMDMi68846905.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002051781 – 925Nuclear factor of activated T-cells, cytoplasmic 2Add BLAST925

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei23PhosphoserineCombined sources1
Modified residuei99PhosphoserineBy similarity1
Modified residuei107PhosphoserineCombined sources1
Modified residuei110PhosphoserineCombined sources1
Modified residuei148PhosphoserineCombined sources1
Modified residuei213PhosphoserineBy similarity1
Modified residuei217PhosphoserineBy similarity1
Modified residuei221PhosphoserineBy similarity1
Modified residuei236PhosphoserineBy similarity1
Modified residuei243PhosphoserineBy similarity1
Modified residuei255PhosphoserineBy similarity1
Modified residuei268PhosphoserineBy similarity1
Modified residuei274PhosphoserineBy similarity1
Modified residuei276PhosphoserineBy similarity1
Modified residuei280PhosphoserineBy similarity1
Modified residuei326PhosphoserineCombined sources1
Modified residuei330PhosphoserineCombined sources1
Modified residuei363PhosphoserineBy similarity1
Modified residuei755PhosphoserineCombined sources1
Modified residuei757PhosphoserineCombined sources1
Modified residuei759PhosphoserineCombined sources1
Modified residuei856PhosphoserineCombined sources1
Modified residuei859PhosphoserineCombined sources1

Post-translational modificationi

In resting cells, phosphorylated by NFATC-kinase on at least 18 sites in the 99-363 region. Upon cell stimulation, all these sites except Ser-243 are dephosphorylated by calcineurin. Dephosphorylation induces a conformational change that simultaneously exposes an NLS and masks an NES, which results in nuclear localization. Simultaneously, Ser-53 or Ser-56 is phosphorylated; which is required for full transcriptional activity.By similarity
Ubiquitinated in endothelial cells by RNF213 downstream of the non-canonical Wnt signaling pathway, leading to its degradation by the proteasome.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ13469.
MaxQBiQ13469.
PaxDbiQ13469.
PeptideAtlasiQ13469.
PRIDEiQ13469.

PTM databases

iPTMnetiQ13469.
PhosphoSitePlusiQ13469.

Expressioni

Tissue specificityi

Expressed in thymus, spleen, heart, testis, brain, placenta, muscle and pancreas. Isoform 1 is highly expressed in the small intestine, heart, testis, prostate, thymus, placenta and thyroid. Isoform 3 is highly expressed in stomach, uterus, placenta, trachea and thyroid.1 Publication

Inductioni

Inducibly expressed in T-lymphocytes upon activation of the T-cell receptor (TCR) complex. Induced after co-addition of phorbol 12-myristate 13-acetate (PMA) and ionomycin.

Gene expression databases

BgeeiENSG00000101096.
CleanExiHS_NFATC2.
GenevisibleiQ13469. HS.

Organism-specific databases

HPAiCAB018567.
HPA008789.
HPA024369.

Interactioni

Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. The phosphorylated form specifically interacts with XPO1; which mediates nuclear export. NFATC proteins bind to DNA as monomers. Interacts with NFATC2IP (By similarity). Interacts with FOXP3.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CREB1P162202EBI-716258,EBI-711855
JUNP054126EBI-10087113,EBI-852823
LRRK2Q5S0073EBI-716258,EBI-5323863
USP22Q9UPT92EBI-716258,EBI-723510
VRK2Q86Y07-13EBI-716258,EBI-1207633
VRK2Q86Y07-24EBI-716258,EBI-1207636

Protein-protein interaction databases

BioGridi110846. 29 interactors.
DIPiDIP-27630N.
IntActiQ13469. 13 interactors.
MINTiMINT-1398456.
STRINGi9606.ENSP00000379330.

Structurei

Secondary structure

1925
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi397 – 399Combined sources3
Beta strandi402 – 405Combined sources4
Beta strandi408 – 414Combined sources7
Beta strandi436 – 439Combined sources4
Beta strandi442 – 445Combined sources4
Beta strandi450 – 452Combined sources3
Beta strandi454 – 461Combined sources8
Beta strandi464 – 466Combined sources3
Beta strandi474 – 478Combined sources5
Beta strandi481 – 483Combined sources3
Beta strandi490 – 492Combined sources3
Beta strandi494 – 496Combined sources3
Beta strandi498 – 503Combined sources6
Helixi505 – 507Combined sources3
Beta strandi510 – 512Combined sources3
Beta strandi515 – 520Combined sources6
Helixi523 – 526Combined sources4
Beta strandi529 – 531Combined sources3
Beta strandi541 – 552Combined sources12
Turni553 – 555Combined sources3
Beta strandi556 – 563Combined sources8
Helixi571 – 576Combined sources6
Beta strandi579 – 584Combined sources6
Beta strandi586 – 589Combined sources4
Beta strandi595 – 602Combined sources8
Beta strandi608 – 614Combined sources7
Beta strandi616 – 618Combined sources3
Beta strandi620 – 626Combined sources7
Turni630 – 632Combined sources3
Beta strandi637 – 641Combined sources5
Beta strandi646 – 648Combined sources3
Beta strandi654 – 662Combined sources9
Turni663 – 665Combined sources3
Beta strandi671 – 676Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1A02X-ray2.70N392-678[»]
1OWRX-ray3.00M/N/P/Q396-678[»]
1P7HX-ray2.60L/M/N/O393-678[»]
1PZUX-ray3.10B/D/H/I/L/M396-678[»]
1S9KX-ray3.10C399-678[»]
2AS5X-ray2.70M/N392-678[»]
2O93X-ray3.05L/M/O396-678[»]
3QRFX-ray2.80M/N396-678[»]
ProteinModelPortaliQ13469.
SMRiQ13469.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ13469.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati184 – 2001Add BLAST17
Repeati213 – 2292Add BLAST17
Repeati272 – 2863; approximateAdd BLAST15
Domaini392 – 574RHDPROSITE-ProRule annotationAdd BLAST183

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni111 – 116Calcineurin-binding6
Regioni119 – 199Trans-activation domain A (TAD-A)Add BLAST81
Regioni161 – 175Required for cytoplasmic retention of the phosphorylated formBy similarityAdd BLAST15
Regioni184 – 2863 X approximate SP repeatsAdd BLAST103

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi26 – 349aaTAD9
Motifi251 – 253Nuclear localization signal3
Motifi664 – 666Nuclear localization signal3
Motifi904 – 913Nuclear export signal10

Domaini

the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.1 Publication
Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.By similarity

Sequence similaritiesi

Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IHFR. Eukaryota.
ENOG41105U2. LUCA.
GeneTreeiENSGT00550000074562.
HOGENOMiHOG000231780.
HOVERGENiHBG069754.
InParanoidiQ13469.
KOiK17332.
OMAiMWKTSPD.
OrthoDBiEOG091G01QP.
PhylomeDBiQ13469.
TreeFamiTF326480.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR032397. RHD_dimer.
IPR011539. RHD_DNA_bind_dom.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PfamiPF16179. RHD_dimer. 1 hit.
PF00554. RHD_DNA_bind. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q13469-1) [UniParc]FASTAAdd to basket
Also known as: C, NFATc2_IB_IIL

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNAPERQPQP DGGDAPGHEP GGSPQDELDF SILFDYEYLN PNEEEPNAHK
60 70 80 90 100
VASPPSGPAY PDDVLDYGLK PYSPLASLSG EPPGRFGEPD RVGPQKFLSA
110 120 130 140 150
AKPAGASGLS PRIEITPSHE LIQAVGPLRM RDAGLLVEQP PLAGVAASPR
160 170 180 190 200
FTLPVPGFEG YREPLCLSPA SSGSSASFIS DTFSPYTSPC VSPNNGGPDD
210 220 230 240 250
LCPQFQNIPA HYSPRTSPIM SPRTSLAEDS CLGRHSPVPR PASRSSSPGA
260 270 280 290 300
KRRHSCAEAL VALPPGASPQ RSRSPSPQPS SHVAPQDHGS PAGYPPVAGS
310 320 330 340 350
AVIMDALNSL ATDSPCGIPP KMWKTSPDPS PVSAAPSKAG LPRHIYPAVE
360 370 380 390 400
FLGPCEQGER RNSAPESILL VPPTWPKPLV PAIPICSIPV TASLPPLEWP
410 420 430 440 450
LSSQSGSYEL RIEVQPKPHH RAHYETEGSR GAVKAPTGGH PVVQLHGYME
460 470 480 490 500
NKPLGLQIFI GTADERILKP HAFYQVHRIT GKTVTTTSYE KIVGNTKVLE
510 520 530 540 550
IPLEPKNNMR ATIDCAGILK LRNADIELRK GETDIGRKNT RVRLVFRVHI
560 570 580 590 600
PESSGRIVSL QTASNPIECS QRSAHELPMV ERQDTDSCLV YGGQQMILTG
610 620 630 640 650
QNFTSESKVV FTEKTTDGQQ IWEMEATVDK DKSQPNMLFV EIPEYRNKHI
660 670 680 690 700
RTPVKVNFYV INGKRKRSQP QHFTYHPVPA IKTEPTDEYD PTLICSPTHG
710 720 730 740 750
GLGSQPYYPQ HPMVAESPSC LVATMAPCQQ FRTGLSSPDA RYQQQNPAAV
760 770 780 790 800
LYQRSKSLSP SLLGYQQPAL MAAPLSLADA HRSVLVHAGS QGQSSALLHP
810 820 830 840 850
SPTNQQASPV IHYSPTNQQL RCGSHQEFQH IMYCENFAPG TTRPGPPPVS
860 870 880 890 900
QGQRLSPGSY PTVIQQQNAT SQRAAKNGPP VSDQKEVLPA GVTIKQEQNL
910 920
DQTYLDDVNE IIRKEFSGPP ARNQT
Length:925
Mass (Da):100,146
Last modified:July 5, 2005 - v2
Checksum:i8DAE86855CCB58D3
GO
Isoform 2 (identifier: Q13469-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     908-925: VNEIIRKEFSGPPARNQT → ELIDTHLSWIQNIL

Show »
Length:921
Mass (Da):99,784
Checksum:i71C45C9B348AE9C8
GO
Isoform 3 (identifier: Q13469-3) [UniParc]FASTAAdd to basket
Also known as: NFATc2_IA_IIL

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNE → MQREAAFRLGHCHPLRIMGSVDQ
     908-925: VNEIIRKEFSGPPARNQT → ELIDTHLSWIQNIL

Show »
Length:901
Mass (Da):97,693
Checksum:i158B2F7F9966CCBA
GO
Isoform 4 (identifier: Q13469-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNE → MQREAAFRLGHCHPLRIMGSVDQ

Show »
Length:905
Mass (Da):98,054
Checksum:i69D7F7B758842B37
GO
Isoform 5 (identifier: Q13469-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     908-925: VNEIIRKEFSGPPARNQT → ELIDTHLSWIQNIL

Note: No experimental confirmation available.
Show »
Length:702
Mass (Da):76,700
Checksum:iD3CA427C994A5605
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti65L → M in AAC50886 (PubMed:8668213).Curated1
Sequence conflicti65L → M in AAC50887 (PubMed:8668213).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051783446H → R.Corresponds to variant rs12479626dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0559261 – 219Missing in isoform 5. 1 PublicationAdd BLAST219
Alternative sequenceiVSP_0427571 – 43MNAPE…LNPNE → MQREAAFRLGHCHPLRIMGS VDQ in isoform 3 and isoform 4. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_005595908 – 925VNEII…ARNQT → ELIDTHLSWIQNIL in isoform 2, isoform 3 and isoform 5. 3 PublicationsAdd BLAST18

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U43341 mRNA. Translation: AAC50886.1.
U43342 mRNA. Translation: AAC50887.1.
EU887573 mRNA. Translation: ACG55593.1.
EU887574 mRNA. Translation: ACG55594.1.
EU887575 mRNA. Translation: ACG55595.1.
EU887576 mRNA. Translation: ACG55596.1.
EU887577 mRNA. Translation: ACG55597.1.
EU887578 mRNA. Translation: ACG55598.1.
AL132866 Genomic DNA. Translation: CAC00528.2.
AL035682, AL035684, AL132866 Genomic DNA. Translation: CAI18852.1.
AL035682, AL035684, AL132866 Genomic DNA. Translation: CAI18853.1.
AL035684, AL035682, AL132866 Genomic DNA. Translation: CAI19205.1.
AL035684, AL035682, AL132866 Genomic DNA. Translation: CAI19206.1.
AL132866, AL035682, AL035684 Genomic DNA. Translation: CAI23549.1.
CH471077 Genomic DNA. Translation: EAW75602.1.
CH471077 Genomic DNA. Translation: EAW75603.1.
BC136418 mRNA. Translation: AAI36419.1.
BC144074 mRNA. Translation: AAI44075.1.
CCDSiCCDS13437.1. [Q13469-1]
CCDS33488.1. [Q13469-2]
CCDS46614.1. [Q13469-3]
CCDS68156.1. [Q13469-5]
CCDS68157.1. [Q13469-4]
PIRiG02326.
RefSeqiNP_001129493.1. NM_001136021.2. [Q13469-3]
NP_001245221.1. NM_001258292.1. [Q13469-4]
NP_001245223.1. NM_001258294.1. [Q13469-5]
NP_001245225.1. NM_001258296.1. [Q13469-5]
NP_036472.2. NM_012340.4. [Q13469-2]
NP_775114.1. NM_173091.3. [Q13469-1]
UniGeneiHs.744148.

Genome annotation databases

EnsembliENST00000371564; ENSP00000360619; ENSG00000101096. [Q13469-2]
ENST00000396009; ENSP00000379330; ENSG00000101096. [Q13469-1]
ENST00000414705; ENSP00000396471; ENSG00000101096. [Q13469-3]
ENST00000609507; ENSP00000477342; ENSG00000101096. [Q13469-5]
ENST00000609943; ENSP00000477370; ENSG00000101096. [Q13469-4]
ENST00000610033; ENSP00000477142; ENSG00000101096. [Q13469-5]
GeneIDi4773.
KEGGihsa:4773.
UCSCiuc002xwc.4. human. [Q13469-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U43341 mRNA. Translation: AAC50886.1.
U43342 mRNA. Translation: AAC50887.1.
EU887573 mRNA. Translation: ACG55593.1.
EU887574 mRNA. Translation: ACG55594.1.
EU887575 mRNA. Translation: ACG55595.1.
EU887576 mRNA. Translation: ACG55596.1.
EU887577 mRNA. Translation: ACG55597.1.
EU887578 mRNA. Translation: ACG55598.1.
AL132866 Genomic DNA. Translation: CAC00528.2.
AL035682, AL035684, AL132866 Genomic DNA. Translation: CAI18852.1.
AL035682, AL035684, AL132866 Genomic DNA. Translation: CAI18853.1.
AL035684, AL035682, AL132866 Genomic DNA. Translation: CAI19205.1.
AL035684, AL035682, AL132866 Genomic DNA. Translation: CAI19206.1.
AL132866, AL035682, AL035684 Genomic DNA. Translation: CAI23549.1.
CH471077 Genomic DNA. Translation: EAW75602.1.
CH471077 Genomic DNA. Translation: EAW75603.1.
BC136418 mRNA. Translation: AAI36419.1.
BC144074 mRNA. Translation: AAI44075.1.
CCDSiCCDS13437.1. [Q13469-1]
CCDS33488.1. [Q13469-2]
CCDS46614.1. [Q13469-3]
CCDS68156.1. [Q13469-5]
CCDS68157.1. [Q13469-4]
PIRiG02326.
RefSeqiNP_001129493.1. NM_001136021.2. [Q13469-3]
NP_001245221.1. NM_001258292.1. [Q13469-4]
NP_001245223.1. NM_001258294.1. [Q13469-5]
NP_001245225.1. NM_001258296.1. [Q13469-5]
NP_036472.2. NM_012340.4. [Q13469-2]
NP_775114.1. NM_173091.3. [Q13469-1]
UniGeneiHs.744148.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1A02X-ray2.70N392-678[»]
1OWRX-ray3.00M/N/P/Q396-678[»]
1P7HX-ray2.60L/M/N/O393-678[»]
1PZUX-ray3.10B/D/H/I/L/M396-678[»]
1S9KX-ray3.10C399-678[»]
2AS5X-ray2.70M/N392-678[»]
2O93X-ray3.05L/M/O396-678[»]
3QRFX-ray2.80M/N396-678[»]
ProteinModelPortaliQ13469.
SMRiQ13469.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110846. 29 interactors.
DIPiDIP-27630N.
IntActiQ13469. 13 interactors.
MINTiMINT-1398456.
STRINGi9606.ENSP00000379330.

PTM databases

iPTMnetiQ13469.
PhosphoSitePlusiQ13469.

Polymorphism and mutation databases

BioMutaiNFATC2.
DMDMi68846905.

Proteomic databases

EPDiQ13469.
MaxQBiQ13469.
PaxDbiQ13469.
PeptideAtlasiQ13469.
PRIDEiQ13469.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371564; ENSP00000360619; ENSG00000101096. [Q13469-2]
ENST00000396009; ENSP00000379330; ENSG00000101096. [Q13469-1]
ENST00000414705; ENSP00000396471; ENSG00000101096. [Q13469-3]
ENST00000609507; ENSP00000477342; ENSG00000101096. [Q13469-5]
ENST00000609943; ENSP00000477370; ENSG00000101096. [Q13469-4]
ENST00000610033; ENSP00000477142; ENSG00000101096. [Q13469-5]
GeneIDi4773.
KEGGihsa:4773.
UCSCiuc002xwc.4. human. [Q13469-1]

Organism-specific databases

CTDi4773.
DisGeNETi4773.
GeneCardsiNFATC2.
HGNCiHGNC:7776. NFATC2.
HPAiCAB018567.
HPA008789.
HPA024369.
MIMi600490. gene.
neXtProtiNX_Q13469.
OpenTargetsiENSG00000101096.
PharmGKBiPA31583.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHFR. Eukaryota.
ENOG41105U2. LUCA.
GeneTreeiENSGT00550000074562.
HOGENOMiHOG000231780.
HOVERGENiHBG069754.
InParanoidiQ13469.
KOiK17332.
OMAiMWKTSPD.
OrthoDBiEOG091G01QP.
PhylomeDBiQ13469.
TreeFamiTF326480.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000101096-MONOMER.
ReactomeiR-HSA-2871809. FCERI mediated Ca+2 mobilization.
R-HSA-5607763. CLEC7A (Dectin-1) induces NFAT activation.
SIGNORiQ13469.

Miscellaneous databases

ChiTaRSiNFATC2. human.
EvolutionaryTraceiQ13469.
GeneWikiiNFATC2.
GenomeRNAii4773.
PROiQ13469.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000101096.
CleanExiHS_NFATC2.
GenevisibleiQ13469. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR032397. RHD_dimer.
IPR011539. RHD_DNA_bind_dom.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PfamiPF16179. RHD_dimer. 1 hit.
PF00554. RHD_DNA_bind. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNFAC2_HUMAN
AccessioniPrimary (citable) accession number: Q13469
Secondary accession number(s): B5B2N8
, B5B2N9, B5B2P0, B5B2P2, B5B2P3, Q13468, Q5TFW7, Q5TFW8, Q9NPX6, Q9NQH3, Q9UJR2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 5, 2005
Last modified: November 30, 2016
This is version 192 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.