Q13444 (ADA15_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disintegrin and metalloproteinase domain-containing protein 15 Short name=ADAM 15 EC=3.4.24.- Alternative name(s): Metalloprotease RGD disintegrin protein Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15 Short name=MDC-15 Metargidin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 863 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-mediated cell adhesion and migration of airway smooth muscle cells. Suppresses cell motility on or towards fibronectin possibly by driving alpha-v/beta-1 integrin (ITAGV-ITGB1) cell surface expression via ERK1/2 inactivation. Cleaves E-cadherin in response to growth factor deprivation. Plays a role in glomerular cell migration. Plays a role in pathological neovascularization. May play a role in cartilage remodeling. May be proteolytically processed, during sperm epididymal maturation and the acrosome reaction. May play a role in sperm-egg binding through its disintegrin domain. Ref.3 Ref.16 Ref.18 Ref.19 Ref.20 Ref.21 Ref.22 |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Enzyme regulation | Inhibited by hydroxamate-type metalloproteinase inhibitors such as marimastat. Inhibited by metalloproteinase inhibitor 2 (TIMP-2) and TIMP-3 at nanomolar concentrations. Not significantly inhibited by TIMP-1 at concentrations of up to 100 nM. Not activated by PMA or ionomycin. Ref.23 |
| Subunit structure | Interacts with ITAGV-ITGB3 (vitronectin receptor), PACSIN3 and SNX9. PACSIN3 and SNX9 preferentially bind the precursor but not the processed form of ADAM15, suggesting that the interaction occurs in a secretory pathway compartment prior to the medial Golgi By similarity. Interacts with ITAG9-ITGB1 By similarity. Interacts specifically with Src family protein-tyrosine kinases (PTKs). Interacts with SH3PXD2A. Interacts with ITAGV-ITGB1. Interacts with GRB2, HCK, ITSN1, ITSN2, LYN, MAPK1, MAPK3, NCF1, NCK1, nephrocystin, PTK6, SNX33, LCK and SRC. Ref.5 Ref.12 Ref.13 Ref.15 Ref.17 Ref.24 |
| Subcellular location | Endomembrane system; Single-pass type I membrane protein. Cell junction › adherens junction. Cell projection › cilium › flagellum By similarity. Cytoplasmic vesicle › secretory vesicle › acrosome By similarity. Note: The majority of the protein is localized in a perinuclear compartment which may correspond to the trans-Golgi network or the late endosome. The pro-protein is the major detectable form on the cell surface, whereas the majority of the protein in the cell is processed By similarity. Ref.14 |
| Tissue specificity | Expressed in colon and small intestine. Expressed in airway smooth muscle and glomerular mesangial cells (at protein level). Ubiquitously expressed. Overexpressed in atherosclerotic lesions. Constitutively expressed in cultured endothelium and smooth muscle. Expressed in chondrocytes. Expressed in airway smooth muscle and glomerular mesangial cells. Ref.3 Ref.11 Ref.16 Ref.19 |
| Domain | The cytoplasmic domain interacts with endophilin I and sorting nexin 9 By similarity. Disintegrin domain binds to integrin alphaV-beta3. The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. |
| Post-translational modification | The precursor is cleaved by a furin endopeptidase By similarity. Phosphorylation increases association with PTKs. |
| Sequence similarities | Contains 1 disintegrin domain. Contains 1 EGF-like domain. Contains 1 peptidase M12B domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PACSIN3 | Q9UKS6 | 2 | EBI-77818,EBI-77926 | |
| SH3GL2 | Q99962 | 2 | EBI-77818,EBI-77938 |
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q13444-1) Also known as: 6b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13444-2) The sequence of this isoform differs from the canonical sequence as follows: 760-808: Missing. | ||||||
| Isoform 3 (identifier: Q13444-3) Also known as: 6a; The sequence of this isoform differs from the canonical sequence as follows: 760-760: Missing. | ||||||
| Isoform 4 (identifier: Q13444-4) Also known as: 4a; The sequence of this isoform differs from the canonical sequence as follows: 785-808: Missing. | ||||||
| Isoform 5 (identifier: Q13444-5) The sequence of this isoform differs from the canonical sequence as follows: 760-784: Missing. | ||||||
| Isoform 6 (identifier: Q13444-6) Also known as: 7b; The sequence of this isoform differs from the canonical sequence as follows: 809-863: SQGPAKPPPPRKPLPADPQGRCPSGDLPGPGAGIPPLVVPSRPAPPPPTVSSLYL → VTVGGEKGTASPPT | ||||||
| Isoform 7 (identifier: Q13444-7) Also known as: 7a; The sequence of this isoform differs from the canonical sequence as follows: 760-760: Missing. 809-863: SQGPAKPPPPRKPLPADPQGRCPSGDLPGPGAGIPPLVVPSRPAPPPPTVSSLYL → VTVGGEKGTASPPT | ||||||
| Isoform 8 (identifier: Q13444-8) The sequence of this isoform differs from the canonical sequence as follows: 760-784: Missing. 809-863: SQGPAKPPPPRKPLPADPQGRCPSGDLPGPGAGIPPLVVPSRPAPPPPTVSSLYL → VTVGGEKGTASPPT | ||||||
| Isoform 9 (identifier: Q13444-9) Also known as: 3a; The sequence of this isoform differs from the canonical sequence as follows: 737-796: AAQSGPSERP...LADRPNPPTR → LVLSASRPPL...CPAQGLESRP 797-863: Missing. | ||||||
| Isoform 10 (identifier: Q13444-10) Also known as: 1; The sequence of this isoform differs from the canonical sequence as follows: 736-772: RAAQSGPSERPGPPQRALLARGTKQASALSFPAPPSR → SLRGQPSPHPQGSHCLPTPRAGAHRVTCPAQGLESRP 773-863: Missing. | ||||||
| Isoform 11 (identifier: Q13444-11) The sequence of this isoform differs from the canonical sequence as follows: 94-387: Missing. 760-808: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 17 | 17 | Potential | ||||||||
| Propeptide | 18 – 206 | 189 | By similarity | PRO_0000029082 | |||||||
| Chain | 207 – 863 | 657 | Disintegrin and metalloproteinase domain-containing protein 15 | PRO_0000029083 | |||||||
Regions | |||||||||||
| Topological domain | 207 – 696 | 490 | Extracellular Potential | ||||||||
| Transmembrane | 697 – 717 | 21 | Helical; Potential | ||||||||
| Topological domain | 718 – 863 | 146 | Cytoplasmic Potential | ||||||||
| Domain | 213 – 414 | 202 | Peptidase M12B | ||||||||
| Domain | 421 – 508 | 88 | Disintegrin | ||||||||
| Domain | 657 – 685 | 29 | EGF-like | ||||||||
| Motif | 177 – 184 | 8 | Cysteine switch By similarity | ||||||||
| Motif | 484 – 486 | 3 | Cell attachment site Potential | ||||||||
| Motif | 815 – 821 | 7 | SH3-binding Potential | ||||||||
| Motif | 850 – 856 | 7 | SH3-binding Potential | ||||||||
| Compositional bias | 509 – 656 | 148 | Cys-rich | ||||||||
Sites | |||||||||||
| Active site | 349 | 1 | By similarity | ||||||||
| Metal binding | 179 | 1 | Zinc; in inhibited form By similarity | ||||||||
| Metal binding | 348 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 352 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 358 | 1 | Zinc; catalytic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 715 | 1 | Phosphotyrosine; by HCK and LCK Ref.15 | ||||||||
| Modified residue | 735 | 1 | Phosphotyrosine; by HCK and LCK Ref.15 | ||||||||
| Glycosylation | 237 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 389 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 392 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 606 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 611 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 323 ↔ 409 | By similarity | |||||||||
| Disulfide bond | 365 ↔ 393 | By similarity | |||||||||
| Disulfide bond | 367 ↔ 376 | By similarity | |||||||||
| Disulfide bond | 480 ↔ 500 | By similarity | |||||||||
| Disulfide bond | 657 ↔ 667 | By similarity | |||||||||
| Disulfide bond | 661 ↔ 673 | By similarity | |||||||||
| Disulfide bond | 675 ↔ 684 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 94 – 387 | 294 | Missing in isoform 11. | VSP_039524 | |||||||
| Alternative sequence | 736 – 772 | 37 | RAAQS…APPSR → SLRGQPSPHPQGSHCLPTPR AGAHRVTCPAQGLESRP in isoform 10. | VSP_039525 | |||||||
| Alternative sequence | 737 – 796 | 60 | AAQSG…NPPTR → LVLSASRPPLPGRCRLTLCP RDSSLRGQPSPHPQGSHCLP TPRAGAHRVTCPAQGLESRP in isoform 9. | VSP_039526 | |||||||
| Alternative sequence | 760 – 808 | 49 | Missing in isoform 2 and isoform 11. | VSP_039527 | |||||||
| Alternative sequence | 760 – 784 | 25 | Missing in isoform 5 and isoform 8. | VSP_039528 | |||||||
| Alternative sequence | 760 | 1 | Missing in isoform 3 and isoform 7. | VSP_039529 | |||||||
| Alternative sequence | 773 – 863 | 91 | Missing in isoform 10. | VSP_039530 | |||||||
| Alternative sequence | 785 – 808 | 24 | Missing in isoform 4. | VSP_039531 | |||||||
| Alternative sequence | 797 – 863 | 67 | Missing in isoform 9. | VSP_039532 | |||||||
| Alternative sequence | 809 – 863 | 55 | SQGPA…SSLYL → VTVGGEKGTASPPT in isoform 6, isoform 7 and isoform 8. | VSP_039533 | |||||||
| Natural variant | 191 | 1 | K → T. Ref.1 Ref.2 Ref.4 Ref.6 Ref.7 Ref.10 Corresponds to variant rs6427128 [ dbSNP | Ensembl ]. | VAR_060315 | |||||||
| Natural variant | 294 | 1 | P → H. Corresponds to variant rs2306122 [ dbSNP | Ensembl ]. | VAR_060316 | |||||||
| Natural variant | 502 | 1 | P → Q. Corresponds to variant rs17093828 [ dbSNP | Ensembl ]. | VAR_054339 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 484 – 485 | 2 | RG → SV: Reduces ADAM15-mediated T-cell aggregation. Ref.20 | ||||||||
| Sequence conflict | 81 | 1 | I → V in BAG52157. Ref.8 | ||||||||
| Sequence conflict | 649 | 1 | V → A in BAG52157. Ref.8 | ||||||||
| Sequence conflict | 714 | 1 | S → G in AAC50404. Ref.2 | ||||||||
| Sequence conflict | 840 | 1 | A → P in AAC51112. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Metargidin, a membrane-anchored metalloprotease-disintegrin protein with an RGD integrin binding sequence." Kraetzschmar J., Lum L., Blobel C.P. J. Biol. Chem. 271:4593-4596(1996) [PubMed: 8617717] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT THR-191. Tissue: Mammary carcinoma. |
| [2] | "Expression of a disintegrin-like protein in cultured human vascular cells and in vivo." Herren B., Raines E.W., Ross R. FASEB J. 11:173-180(1997) [PubMed: 9039960] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT THR-191. Tissue: Umbilical vein. |
| [3] | "ADAM-15 inhibits wound healing in human intestinal epithelial cell monolayers." Charrier L., Yan Y., Driss A., Laboisse C.L., Sitaraman S.V., Merlin D. Am. J. Physiol. 288:G346-G353(2005) [PubMed: 15358598] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 10), FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING (ISOFORM 2). |
| [4] | "ADAM15 gene structure and differential alternative exon use in human tissues." Kleino I., Ortiz R.M., Huovila A.P. BMC Mol. Biol. 8:90-90(2007) [PubMed: 17937806] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10), VARIANT THR-191. |
| [5] | "Distinct functions of natural ADAM-15 cytoplasmic domain variants in human mammary carcinoma." Zhong J.L., Poghosyan Z., Pennington C.J., Scott X., Handsley M.M., Warn A., Gavrilovic J., Honert K., Kruger A., Span P.N., Sweep F.C., Edwards D.R. Mol. Cancer Res. 6:383-394(2008) [PubMed: 18296648] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4 AND 10), ALTERNATIVE SPLICING, INTERACTION WITH GRB2; MAPK1; MAPK3; NCK1; PTK6; SH3PXD2A AND SRC. |
| [6] | "Characterization of human ADAM15 gene and promoter, and evidence for alternative exon use." Karkkainen I., Ortiz R.M., Huovila A.-P.J. Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8 AND 9), VARIANT THR-191. |
| [7] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-191. |
| [8] | "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries." Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. Isogai T.DNA Res. 12:117-126(2005) [PubMed: 16303743] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 11). Tissue: Embryo. |
| [9] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-191. Tissue: Kidney. |
| [11] | "Expression of members of a novel membrane linked metalloproteinase family (ADAM) in human articular chondrocytes." McKie N., Edwards T., Dallas D.J., Houghton A., Stringer B., Graham R., Russell G., Croucher P.I. Biochem. Biophys. Res. Commun. 230:335-339(1997) [PubMed: 9016778] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [12] | "Specific interaction of the recombinant disintegrin-like domain of MDC-15 (metargidin, ADAM-15) with integrin alphavbeta3." Zhang X.P., Kamata T., Yokoyama K., Puzon-McLaughlin W., Takada Y. J. Biol. Chem. 273:7345-7350(1998) [PubMed: 9516430] [Abstract] Cited for: INTERACTION WITH INTEGRIN ALPHAV-BETA3. |
| [13] | "Interaction of metargidin (ADAM-15) with alphavbeta3 and alpha5beta1 integrins on different haemopoietic cells." Nath D., Slocombe P.M., Stephens P.E., Warn A., Hutchinson G.R., Yamada K.M., Docherty A.J., Murphy G. J. Cell Sci. 112:579-587(1999) [PubMed: 9914169] [Abstract] Cited for: INTERACTION WITH INTEGRIN ALPHAV-BETA3 AND INTEGRIN ALPHA5-BETA1. |
| [14] | "ADAM15 is an adherens junction molecule whose surface expression can be driven by VE-cadherin." Ham C., Levkau B., Raines E.W., Herren B. Exp. Cell Res. 279:239-247(2002) [PubMed: 12243749] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [15] | "Phosphorylation-dependent interactions between ADAM15 cytoplasmic domain and Src family protein-tyrosine kinases." Poghosyan Z., Robbins S.M., Houslay M.D., Webster A., Murphy G., Edwards D.R. J. Biol. Chem. 277:4999-5007(2002) [PubMed: 11741929] [Abstract] Cited for: PHOSPHORYLATION AT TYR-715 AND TYR-735, INTERACTION WITH GRB2; LCK AND HCK. |
| [16] | "The role of ADAM 15 in glomerular mesangial cell migration." Martin J., Eynstone L.V., Davies M., Williams J.D., Steadman R. J. Biol. Chem. 277:33683-33689(2002) [PubMed: 12091380] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [17] | "The adaptor protein fish associates with members of the ADAMs family and localizes to podosomes of Src-transformed cells." Abram C.L., Seals D.F., Pass I., Salinsky D., Maurer L., Roth T.M., Courtneidge S.A. J. Biol. Chem. 278:16844-16851(2003) [PubMed: 12615925] [Abstract] Cited for: INTERACTION WITH SH3PXD2A. |
| [18] | "Homeostatic effects of the metalloproteinase disintegrin ADAM15 in degenerative cartilage remodeling." Bohm B.B., Aigner T., Roy B., Brodie T.A., Blobel C.P., Burkhardt H. Arthritis Rheum. 52:1100-1109(2005) [PubMed: 15818704] [Abstract] Cited for: FUNCTION. |
| [19] | "Inhibition of airway smooth muscle adhesion and migration by the disintegrin domain of ADAM-15." Lu D., Xie S., Sukkar M.B., Lu X., Scully M.F., Chung K.F. Am. J. Respir. Cell Mol. Biol. 37:494-500(2007) [PubMed: 17575078] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [20] | "ADAM-15/metargidin mediates homotypic aggregation of human T lymphocytes and heterotypic interactions of T lymphocytes with intestinal epithelial cells." Charrier L., Yan Y., Nguyen H.T., Dalmasso G., Laboisse C.L., Gewirtz A.T., Sitaraman S.V., Merlin D. J. Biol. Chem. 282:16948-16958(2007) [PubMed: 17416588] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF 484-ARG-GLY-485. |
| [21] | "ADAM15 suppresses cell motility by driving integrin alpha5beta1 cell surface expression via Erk inactivation." Chen Q., Meng L.H., Zhu C.H., Lin L.P., Lu H., Ding J. Int. J. Biochem. Cell Biol. 40:2164-2173(2008) [PubMed: 18387333] [Abstract] Cited for: FUNCTION. |
| [22] | "The ectodomain shedding of E-cadherin by ADAM15 supports ErbB receptor activation." Najy A.J., Day K.C., Day M.L. J. Biol. Chem. 283:18393-18401(2008) [PubMed: 18434311] [Abstract] Cited for: FUNCTION. |
| [23] | "Characterization of the catalytic activity of the membrane-anchored metalloproteinase ADAM15 in cell-based assays." Maretzky T., Yang G., Ouerfelli O., Overall C.M., Worpenberg S., Hassiepen U., Eder J., Blobel C.P. Biochem. J. 420:105-113(2009) [PubMed: 19207106] [Abstract] Cited for: ENZYME REGULATION. |
| [24] | "Alternative splicing of ADAM15 regulates its interactions with cellular SH3 proteins." Kleino I., Ortiz R.M., Yritys M., Huovila A.P., Saksela K. J. Cell. Biochem. 108:877-885(2009) [PubMed: 19718658] [Abstract] Cited for: INTERACTION WITH HCK; ITSN1; ITSN2; LYN; NCF1; NEPHROCYSTIN; SH3PXD2A; SNX33; SNX9 AND SRC. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U41767 mRNA. Translation: AAC50404.1. U46005 mRNA. Translation: AAC51112.1. AY518542 mRNA. Translation: AAR99331.1. AF314227 Genomic DNA. Translation: AAM44189.1. AF314227 Genomic DNA. Translation: AAS48590.1. AF314227 Genomic DNA. Translation: AAS48591.1. AF314227 Genomic DNA. Translation: AAS48592.1. AF314227 Genomic DNA. Translation: AAS48593.1. AF314227 Genomic DNA. Translation: AAS48594.1. AF314227 Genomic DNA. Translation: AAS48595.1. AF314227 Genomic DNA. Translation: AAS48596.1. AF314227 Genomic DNA. Translation: AAS48597.1. AF314227 Genomic DNA. Translation: AAS72298.1. AY560593 mRNA. Translation: AAS72991.1. AY560594 mRNA. Translation: AAS72992.1. AY560595 mRNA. Translation: AAS72993.1. AY560596 mRNA. Translation: AAS72994.1. AY560597 mRNA. Translation: AAS72995.1. AY560598 mRNA. Translation: AAS72996.1. AY560599 mRNA. Translation: AAS72997.1. AY560600 mRNA. Translation: AAS72998.1. AY560601 mRNA. Translation: AAS72999.1. AY576417 mRNA. Translation: AAS73000.1. BT009764 mRNA. Translation: AAP88766.1. AK075498 mRNA. Translation: BAG52157.1. AL451085, AL691442 Genomic DNA. Translation: CAI13273.1. AL451085, AL691442 Genomic DNA. Translation: CAI13274.1. AL691442, AL451085 Genomic DNA. Translation: CAI15327.1. AL691442, AL451085 Genomic DNA. Translation: CAI15328.1. BC014566 mRNA. Translation: AAH14566.1. |
| IPI | IPI00013302. IPI00420067. IPI00420068. IPI00420069. IPI00420070. IPI00513871. IPI00742904. IPI00843806. IPI00969092. IPI00969132. IPI00969145. |
| PIR | G02390. |
| RefSeq | NP_003806.3. NM_003815.3. NP_997074.1. NM_207191.1. NP_997077.1. NM_207194.1. NP_997078.1. NM_207195.1. NP_997079.1. NM_207196.1. NP_997080.1. NM_207197.1. |
| UniGene | Hs.312098. |
3D structure databases | |
| ProteinModelPortal | Q13444. |
| SMR | Q13444. Positions 207-691. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q13444. 8 interactions. |
| MINT | MINT-1445912. |
| STRING | Q13444. |
Protein family/group databases | |
| MEROPS | M12.215. |
PTM databases | |
| PhosphoSite | Q13444. |
Polymorphism databases | |
| DMDM | 300669614. |
Proteomic databases | |
| PRIDE | Q13444. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000271836; ENSP00000271836; ENSG00000143537. ENST00000355956; ENSP00000348227; ENSG00000143537. ENST00000356955; ENSP00000349436; ENSG00000143537. ENST00000359280; ENSP00000352226; ENSG00000143537. ENST00000360674; ENSP00000353892; ENSG00000143537. ENST00000368412; ENSP00000357397; ENSG00000143537. ENST00000368413; ENSP00000357398; ENSG00000143537. ENST00000449910; ENSP00000403843; ENSG00000143537. |
| GeneID | 8751. |
| KEGG | hsa:8751. |
Organism-specific databases | |
| CTD | 8751. |
| GeneCards | GC01P155023. |
| H-InvDB | HIX0001025. |
| HGNC | HGNC:193. ADAM15. |
| HPA | HPA011633. |
| MIM | 605548. gene. |
| neXtProt | NX_Q13444. |
| PharmGKB | PA24510. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04319. |
| GeneTree | ENSGT00590000082827. |
| HOVERGEN | HBG006978. |
| OMA | IMEASTD. |
| OrthoDB | EOG479F6Q. |
| PhylomeDB | Q13444. |
Gene expression databases | |
| ArrayExpress | Q13444. |
| Bgee | Q13444. |
| CleanEx | HS_ADAM15. |
| Genevestigator | Q13444. |
| GermOnline | ENSG00000143537. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006586. ADAM_Cys-rich. IPR001762. Blood-coag_inhib_Disintegrin. IPR006210. EGF-like. IPR013032. EGF-like_reg_CS. IPR000742. EGF_3. IPR024079. MetalloPept_cat_dom. IPR001590. Peptidase_M12B. IPR002870. Peptidase_M12B_N. [Graphical view] |
| Gene3D | G3DSA:4.10.70.10. Blood-coag_inhib_Disintegrin. 1 hit. G3DSA:3.40.390.10. G3DSA:3.40.390.10. 1 hit. |
| KO | K06836. |
| Pfam | PF08516. ADAM_CR. 1 hit. PF00200. Disintegrin. 1 hit. PF01562. Pep_M12B_propep. 1 hit. PF01421. Reprolysin. 1 hit. [Graphical view] |
| SMART | SM00608. ACR. 1 hit. SM00050. DISIN. 1 hit. SM00181. EGF. 1 hit. [Graphical view] |
| SUPFAM | SSF57552. Disintegrin. 1 hit. |
| PROSITE | PS50215. ADAM_MEPRO. 1 hit. PS00546. CYSTEINE_SWITCH. False negative. PS00427. DISINTEGRIN_1. False negative. PS50214. DISINTEGRIN_2. 1 hit. PS00022. EGF_1. False negative. PS01186. EGF_2. 1 hit. PS50026. EGF_3. 1 hit. PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 32829. |
| SOURCE | Search... |
Entry information
| Entry name | ADA15_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13444 Secondary accession number(s): B3KQU5 Q96C78 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with