Q13432 (U119A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein unc-119 homolog A Alternative name(s): Retinal protein 4 Short name=hRG4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 240 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated GNAT1 and is required for G-protein localization and trafficking in sensory neurons. Binds myristoylated NPHP3; however, in contrast to UNC119B, does not seem to play a major role in ciliary membrane localization of NPHP3. Does not bind all myristoylated proteins. Probably plays a role in trafficking proteins in photoreceptor cells. Ref.12 Ref.13 |
| Subunit structure | Interacts with CABP4; in the absence of calcium. May interact with ARL1, ARL2 and ARL3 GTP-bound forms. Found in a complex with ARL3, RP2 and UNC119; RP2 induces hydrolysis of GTP ARL3 in the complex, leading to the release of UNC119. Interacts with NPHP3 (when myristoylated). Interacts with CYS1 (when myristoylated). Interacts with C5orf30; interaction only takes place when UNC119 is not liganded with myristoylated proteins. Ref.10 Ref.11 Ref.12 Ref.13 |
| Subcellular location | |
| Tissue specificity | Retinal-specific. Localized in photoreceptor synapses in the outer plexiform layer of the retina. |
| Domain | Adopts an immunoglobulin-like beta-sandwich fold forming a hydrophobic cavity that capture N-terminally myristoylated target peptides (Ref.13). Phe residues within the hydrophobic beta sandwich are required for myristate binding (Ref.12). |
| Involvement in disease | Defects in UNC119 may be a cause of cone-rod dystrophy. A mutation was found in a 57-year-old woman with late-onset cone-rod dystrophy: from 40 year old, the patient suffered from poor night vision, defective color vision and light-sensitivity. At 57 year old, she displayed reduced visual acuity, myopa, macular atrophy and pericentral ring scotomas. The disease was caused by a heterozygous mutation causing premature termination and truncated UNC119 protein with dominant-negative effect. |
| Sequence similarities | Belongs to the PDE6D/unc-119 family. |
| Caution | According to some authors, acts by extracting target proteins from membranes (Ref.13). According to a another report, rather acts by targeting proteins to membranes (Ref.12). |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Sensory transduction Transport Vision |
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Disease | Cone-rod dystrophy |
| Ligand | Lipid-binding |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | lipoprotein transport Inferred from direct assay Ref.13Ref.12. Source: UniProtKB phototransductionTraceable author statement PubMed 9538874. Source: ProtInc synaptic transmissionTraceable author statement PubMed 9538874. Source: ProtInc visual perceptionTraceable author statement Ref.3. Source: ProtInc |
| Cellular_component | centrosome Inferred from direct assay Ref.12. Source: UniProtKB cytosolTraceable author statement PubMed 9538874. Source: ProtInc |
| Molecular_function | lipid binding Inferred from direct assay Ref.13Ref.12. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q13432-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q13432-2) The sequence of this isoform differs from the canonical sequence as follows: 204-240: ISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP → SARAGSSGSGEVGASRD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 240 | 240 | Protein unc-119 homolog A | PRO_0000221212 | |||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||
| Binding site | 131 | 1 | Lipid | ||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||
| Modified residue | 37 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 204 – 240 | 37 | ISEMI…YSGTP → SARAGSSGSGEVGASRD in isoform B. | VSP_004545 | |||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||
| Helix | 62 – 64 | 3 | |||||||||||||||||||||||||||||||||||
| Turn | 65 – 67 | 3 | |||||||||||||||||||||||||||||||||||
| Helix | 79 – 81 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 87 – 95 | 9 | |||||||||||||||||||||||||||||||||||
| Turn | 96 – 98 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 101 – 106 | 6 | |||||||||||||||||||||||||||||||||||
| Beta strand | 128 – 132 | 5 | |||||||||||||||||||||||||||||||||||
| Helix | 135 – 139 | 5 | |||||||||||||||||||||||||||||||||||
| Beta strand | 141 – 150 | 10 | |||||||||||||||||||||||||||||||||||
| Beta strand | 158 – 167 | 10 | |||||||||||||||||||||||||||||||||||
| Beta strand | 170 – 178 | 9 | |||||||||||||||||||||||||||||||||||
| Beta strand | 186 – 195 | 10 | |||||||||||||||||||||||||||||||||||
| Helix | 201 – 209 | 9 | |||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 222 | 9 | |||||||||||||||||||||||||||||||||||
| Beta strand | 225 – 235 | 11 | |||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of the cDNA for a novel photoreceptor protein." Higashide T., Murakami A., McLaren M.J., Inana G. J. Biol. Chem. 271:1797-1804(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). Tissue: Retina. |
| [2] | "Mammalian orthologs of C. elegans unc-119 highly expressed in photoreceptors." Swanson D.A., Chang J.T., Campochiaro P.A., Zack D.J., Valle D. Invest. Ophthalmol. Vis. Sci. 39:2085-2094(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B). Tissue: Retina. |
| [3] | "Characterization of the gene for HRG4 (UNC119), a novel photoreceptor synaptic protein homologous to unc-119." Higashide T., Inana G. Genomics 57:446-450(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM A). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). Tissue: Testis. |
| [5] | "Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method." Oshikawa M., Tsutsui C., Ikegami T., Fuchida Y., Matsubara M., Toyama S., Usami R., Ohtoko K., Kato S. Invest. Ophthalmol. Vis. Sci. 52:6662-6670(2011) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B). Tissue: Retinoblastoma. |
| [6] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Lymph. |
| [9] | "HRG4 (UNC119) mutation found in cone-rod dystrophy causes retinal degeneration in a transgenic model." Kobayashi A., Higashide T., Hamasaki D., Kubota S., Sakuma H., An W., Fujimaki T., McLaren M.J., Weleber R.G., Inana G. Invest. Ophthalmol. Vis. Sci. 41:3268-3277(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN CONE-ROD DYSTROPHY. |
| [10] | "ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins." Van Valkenburgh H., Shern J.F., Sharer J.D., Zhu X., Kahn R.A. J. Biol. Chem. 276:22826-22837(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ARL1; ARL2 AND ARL3. |
| [11] | "Specificity of Arl2/Arl3 signaling is mediated by a ternary Arl3-effector-GAP complex." Veltel S., Kravchenko A., Ismail S., Wittinghofer A. FEBS Lett. 582:2501-2507(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH ARL3 AND RP2. |
| [12] | "An ARL3-UNC119-RP2 GTPase cycle targets myristoylated NPHP3 to the primary cilium." Wright K.J., Baye L.M., Olivier-Mason A., Mukhopadhyay S., Sang L., Kwong M., Wang W., Pretorius P.R., Sheffield V.C., Sengupta P., Slusarski D.C., Jackson P.K. Genes Dev. 25:2347-2360(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, LIPID-BINDING, SUBCELLULAR LOCATION, INTERACTION WITH NPHP3; CYS1 AND C5ORF30. |
| [13] | "UNC119 is required for G protein trafficking in sensory neurons." Zhang H., Constantine R., Vorobiev S., Chen Y., Seetharaman J., Huang Y.J., Xiao R., Montelione G.T., Gerstner C.D., Davis M.W., Inana G., Whitby F.G., Jorgensen E.M., Hill C.P., Tong L., Baehr W. Nat. Neurosci. 14:874-880(2011) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.94 ANGSTROMS) OF 56-240 IN COMPLEX WITH LAURYLATED GNAT1, FUNCTION, INTERACTION WITH GNAT1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U40998 mRNA. Translation: AAC50360.1. AF028788 mRNA. Translation: AAD01875.1. AF028789 mRNA. Translation: AAD01876.1. AF125998, AF125997 Genomic DNA. Translation: AAD31422.1. AK292329 mRNA. Translation: BAF85018.1. AB593014 mRNA. Translation: BAJ83969.1. AC005726 Genomic DNA. No translation available. CH471159 Genomic DNA. Translation: EAW51095.1. BC027176 mRNA. Translation: AAH27176.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00013262. IPI00220005. | ||||||||||||||||||||||||||||||
| RefSeq | NP_005139.1. NM_005148.3. NP_473376.1. NM_054035.2. | ||||||||||||||||||||||||||||||
| UniGene | Hs.410455. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q13432. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| IntAct | Q13432. 73 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-1372196. | ||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000337040. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q13432. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 2498854. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q13432. | ||||||||||||||||||||||||||||||
| PRIDE | Q13432. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| DNASU | 9094. | ||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000301032; ENSP00000301032; ENSG00000109103. ENST00000335765; ENSP00000337040; ENSG00000109103. | ||||||||||||||||||||||||||||||
| GeneID | 9094. | ||||||||||||||||||||||||||||||
| KEGG | hsa:9094. | ||||||||||||||||||||||||||||||
| UCSC | uc002hbk.2. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 9094. | ||||||||||||||||||||||||||||||
| GeneCards | GC17M026873. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:12565. UNC119. | ||||||||||||||||||||||||||||||
| HPA | HPA041912. | ||||||||||||||||||||||||||||||
| MIM | 604011. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q13432. | ||||||||||||||||||||||||||||||
| Orphanet | 1872. Cone rod dystrophy. 228000. Idiopathic CD4 lymphocytopenia. | ||||||||||||||||||||||||||||||
| PharmGKB | PA37202. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG305476. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000258286. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG108625. | ||||||||||||||||||||||||||||||
| InParanoid | Q13432. | ||||||||||||||||||||||||||||||
| OMA | YKIDFIR. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG441QCD. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q13432. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q13432. | ||||||||||||||||||||||||||||||
| Bgee | Q13432. | ||||||||||||||||||||||||||||||
| CleanEx | HS_UNC119. | ||||||||||||||||||||||||||||||
| Genevestigator | Q13432. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000109103. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| Gene3D | 2.70.50.40. 1 hit. | ||||||||||||||||||||||||||||||
| InterPro | IPR008015. GMP_PDE_delta. IPR014756. Ig_E-set. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF05351. GMP_PDE_delta. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SUPFAM | SSF81296. Ig_E-set. 1 hit. | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| ChiTaRS | UNC119. human. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q13432. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 9094. | ||||||||||||||||||||||||||||||
| NextBio | 34075. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | U119A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13432 Secondary accession number(s): A8K8G4, F1T095, O95126 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
