Q13404 (UB2V1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ubiquitin-conjugating enzyme E2 variant 1 Short name=UEV-1 Alternative name(s): CROC-1 TRAF6-regulated IKK activator 1 beta Uev1A | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 147 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Ref.1 Ref.2 Ref.3 Ref.9 Ref.10 Ref.13 |
| Subunit structure | Heterodimer with UBE2N. Interacts (UBE2V2-UBE2N heterodimer) with the E3 ligase STUB1 (via the U-box domain); the complex has a specific 'Lys-63'-linked polyubiquitination activity. Interacts with TRAF6. Ref.3 |
| Subcellular location | |
| Tissue specificity | Highly expressed in thyroid, pancreas, spinal cord, lymph node, trachea, adrenal gland, bone marrow and pancreas. Detected at low levels in heart, breast, placenta, brain, liver, kidney, stomach and lung. Ref.2 Ref.10 |
| Induction | Down-regulated during differentiation of cultured colon adenocarcinoma cells. Ref.2 |
| Miscellaneous | In human, TMEM189/KUA and UBE2V1/UEV1 are adjacent genes which can produce independent proteins and can also be fused to form a TMEM189-UBE2V1 hybrid protein. |
| Sequence similarities | Belongs to the ubiquitin-conjugating enzyme family. |
| Sequence caution | The sequence AAH08944.2 differs from that shown. Reason: Erroneous initiation. The sequence CAC16955.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| UBE2N | P61088 | 9 | EBI-1050671,EBI-1052908 | |
| XIAP | P98170 | 2 | EBI-1050671,EBI-517127 | |
| ZNRF1 | Q8ND25 | 2 | EBI-1050671,EBI-2129250 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | |||||||||
| Isoform 3 (identifier: Q13404-4) Also known as: Isoform 2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 1 (identifier: Q13404-1) Also known as: CROC-1B; UEV-1B; Isoform 4; The sequence of this isoform differs from the canonical sequence as follows: 1-7: MAATTGS → MAYKFRTHSP...PHETYFCITT | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 71 – 81 | 11 | SPHETYFCITT → WPTSSAQCYSP in AAC02755. Ref.2 | ||||||
| Isoform 2 (identifier: Q13404-2) Also known as: CROC-1A; UEV-1A; The sequence of this isoform differs from the canonical sequence as follows: 1-14: MAATTGSGVKVPRN → MPGEVQASYLKSQSKLSDEGRLEPRKFHCKGSKSPSQ | |||||||||
| Isoform 4 (identifier: Q13404-6) Also known as: UEV-1As; The sequence of this isoform differs from the canonical sequence as follows: 1-44: Missing. 45-57: LTRWTGMIIGPPR → MKEDLNLENFTAK | |||||||||
| Isoform 5 (identifier: Q13404-7) Also known as: Isoform 3; The sequence of this isoform differs from the canonical sequence as follows: 1-7: MAATTGS → MPGEVQASYLKSQSKLSDEGRLEPRKFHCK | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.7 | ||||||||||||||||||||||||||||||
| Chain | 2 – 147 | 146 | Ubiquitin-conjugating enzyme E2 variant 1 | PRO_0000082600 | |||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.7 | ||||||||||||||||||||||||||||||
| Modified residue | 146 | 1 | Phosphoserine Ref.12 | ||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 44 | 44 | Missing in isoform 4. | VSP_038032 | |||||||||||||||||||||||||||||
| Alternative sequence | 1 – 14 | 14 | MAATT…KVPRN → MPGEVQASYLKSQSKLSDEG RLEPRKFHCKGSKSPSQ in isoform 2. | VSP_038033 | |||||||||||||||||||||||||||||
| Alternative sequence | 1 – 7 | 7 | MAATTGS → MAYKFRTHSPEALEQLYPWE CFVFCLIIFGTFTNQIHKWS HTYFGLPRWVTLLQDWHVIL PRKHHRIHHVSPHETYFCIT T in isoform 1. | VSP_038034 | |||||||||||||||||||||||||||||
| Alternative sequence | 1 – 7 | 7 | MAATTGS → MPGEVQASYLKSQSKLSDEG RLEPRKFHCK in isoform 5. | VSP_038035 | |||||||||||||||||||||||||||||
| Alternative sequence | 45 – 57 | 13 | LTRWT…IGPPR → MKEDLNLENFTAK in isoform 4. | VSP_038036 | |||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||
| Helix | 11 – 25 | 15 | |||||||||||||||||||||||||||||||
| Beta strand | 31 – 39 | 9 | |||||||||||||||||||||||||||||||
| Beta strand | 47 – 53 | 7 | |||||||||||||||||||||||||||||||
| Turn | 59 – 62 | 4 | |||||||||||||||||||||||||||||||
| Beta strand | 64 – 70 | 7 | |||||||||||||||||||||||||||||||
| Turn | 73 – 77 | 5 | |||||||||||||||||||||||||||||||
| Beta strand | 81 – 86 | 6 | |||||||||||||||||||||||||||||||
| Turn | 95 – 97 | 3 | |||||||||||||||||||||||||||||||
| Helix | 102 – 104 | 3 | |||||||||||||||||||||||||||||||
| Helix | 106 – 109 | 4 | |||||||||||||||||||||||||||||||
| Helix | 117 – 128 | 12 | |||||||||||||||||||||||||||||||
| Turn | 131 – 135 | 5 | |||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "CROC-1 encodes a protein which mediates transcriptional activation of the human FOS promoter." Rothofsky M.L., Lin S.L. Gene 195:141-149(1997) [PubMed: 9305758] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, SUBCELLULAR LOCATION. Tissue: Brain. |
| [2] | "Role of UEV-1, an inactive variant of the E2 ubiquitin-conjugating enzymes, in in vitro differentiation and cell cycle behavior of HT-29-M6 intestinal mucosecretory cells." Sancho E., Vila M.R., Sanchez-Pulido L., Lozano J.J., Paciucci R., Nadal M., Fox M., Harvey C., Bercovich B., Loukili N., Ciechanover A., Lin S.L., Sanz F., Estivill X., Valencia A., Thomson T.M. Mol. Cell. Biol. 18:576-589(1998) [PubMed: 9418904] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 4), FUNCTION, INDUCTION, TISSUE SPECIFICITY. Tissue: Colon adenocarcinoma. |
| [3] | "Activation of the IkappaB kinase complex by TRAF6 requires a dimeric ubiquitin-conjugating enzyme complex and a unique polyubiquitin chain." Deng L., Wang C., Spencer E., Yang L., Braun A., You J., Slaughter C., Pickart C., Chen Z.J. Cell 103:351-361(2000) [PubMed: 11057907] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), FUNCTION, INTERACTION WITH TRAF6 AND UBE2N, MASS SPECTROMETRY. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [5] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Bienvenut W.V., Pchelintsev N., Adams P.D. Submitted (JUL-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-13 (ISOFORM 3), CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: Lung fibroblast. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-147 (ISOFORMS 1 AND 3). Tissue: Muscle. |
| [9] | "Role of UEV-1A, a homologue of the tumor suppressor protein TSG101, in protection from DNA damage." Thomson T.M., Khalid H., Lozano J.J., Sancho E., Arino J. FEBS Lett. 423:49-52(1998) [PubMed: 9580084] [Abstract] Cited for: FUNCTION. |
| [10] | "The products of the yeast MMS2 and two human homologs (hMMS2 and CROC-1) define a structurally and functionally conserved Ubc-like protein family." Xiao W., Lin S.L., Broomfield S., Chow B.L., Wei Y.-F. Nucleic Acids Res. 26:3908-3914(1998) [PubMed: 9705497] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [11] | "Fusion of the human gene for the polyubiquitination coeffector UEV1 with Kua, a newly identified gene." Thomson T.M., Lozano J.J., Loukili N., Carrio R., Serras F., Cormand B., Valeri M., Diaz V.M., Abril J., Burset M., Merino J., Macaya A., Corominas M., Guigo R. Genome Res. 10:1743-1756(2000) [PubMed: 11076860] [Abstract] Cited for: SUBCELLULAR LOCATION, IDENTIFICATION OF TMEM189-UBE2V1 FUSION PROTEIN. Tissue: Colon cancer. |
| [12] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [13] | "The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines." David Y., Ziv T., Admon A., Navon A. J. Biol. Chem. 285:8595-8604(2010) [PubMed: 20061386] [Abstract] Cited for: FUNCTION. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "Chaperoned ubiquitylation -- crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex." Zhang M., Windheim M., Roe S.M., Peggie M., Cohen P., Prodromou C., Pearl L.H. Mol. Cell 20:525-538(2005) [PubMed: 16307917] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.90 ANGSTROMS) OF 8-147 IN COMPLEX WITH STUB1 AND UBE2N. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U39360 mRNA. Translation: AAB72015.1. U39361 mRNA. Translation: AAB72016.1. U49278 mRNA. Translation: AAC02757.1. U97279 mRNA. Translation: AAC02780.1. U97280 mRNA. Translation: AAC02755.1. U97281 mRNA. Translation: AAC02756.1. AY008273 mRNA. Translation: AAG24229.1. BT007382 mRNA. Translation: AAP36046.1. AL034423 Genomic DNA. Translation: CAB76864.1. AL034423 Genomic DNA. Translation: CAB76865.1. AL034423 Genomic DNA. Translation: CAC16954.1. AL034423 Genomic DNA. Translation: CAC16955.2. Different initiation. AL034423 Genomic DNA. Translation: CAI19383.1. CH471077 Genomic DNA. Translation: EAW75635.1. CH471077 Genomic DNA. Translation: EAW75634.1. CH471077 Genomic DNA. Translation: EAW75636.1. BC000468 mRNA. Translation: AAH00468.1. BC008944 mRNA. Translation: AAH08944.2. Different initiation. | ||||||||||||||||||||||||
| IPI | IPI00007847. IPI00019599. IPI00030962. IPI00447356. IPI00472498. | ||||||||||||||||||||||||
| RefSeq | NP_001027459.1. NM_001032288.1. NP_068823.2. NM_021988.4. NP_071887.1. NM_022442.4. NP_954595.1. NM_199144.1. NP_954673.1. NM_199203.2. | ||||||||||||||||||||||||
| UniGene | Hs.420529. Hs.727525. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q13404. | ||||||||||||||||||||||||
| SMR | Q13404. Positions 8-146. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q13404. 27 interactions. | ||||||||||||||||||||||||
| MINT | MINT-5002796. | ||||||||||||||||||||||||
| STRING | Q13404. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 259016163. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | Q13404. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000341698; ENSP00000344166; ENSG00000124208. ENST00000420027; ENSP00000395264; ENSG00000124208. | ||||||||||||||||||||||||
| GeneID | 387522. 7335. | ||||||||||||||||||||||||
| KEGG | hsa:387522. hsa:7335. | ||||||||||||||||||||||||
| UCSC | uc002xva.1. human. uc002xvd.1. human. uc002xvf.1. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 387522. 7335. | ||||||||||||||||||||||||
| GeneCards | GC20M048697. GC20M048698. | ||||||||||||||||||||||||
| HGNC | HGNC:12494. UBE2V1. | ||||||||||||||||||||||||
| MIM | 602995. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q13404. | ||||||||||||||||||||||||
| PharmGKB | PA37142. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | prNOG05025. | ||||||||||||||||||||||||
| GeneTree | ENSGT00390000009008. | ||||||||||||||||||||||||
| HOVERGEN | HBG054552. | ||||||||||||||||||||||||
| InParanoid | Q13404. | ||||||||||||||||||||||||
| OMA | NINCINQ. | ||||||||||||||||||||||||
| OrthoDB | EOG4VHK75. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | il1pathway. IL1-mediated signaling events. | ||||||||||||||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q13404. | ||||||||||||||||||||||||
| Genevestigator | Q13404. | ||||||||||||||||||||||||
| GermOnline | ENSG00000124208. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR000608. UBQ-conjugat_E2. IPR016135. UBQ-conjugating_enzyme/RWD. [Graphical view] | ||||||||||||||||||||||||
| Gene3D | G3DSA:3.10.110.10. UBQ-conjugat_E2. 1 hit. | ||||||||||||||||||||||||
| KO | K10704. | ||||||||||||||||||||||||
| Pfam | PF00179. UQ_con. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF54495. UBQ-conjugat/RWD-like. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS00183. UBIQUITIN_CONJUGAT_1. False negative. PS50127. UBIQUITIN_CONJUGAT_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| NextBio | 101372. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | UB2V1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13404 Secondary accession number(s): E1P629 Q9UM50 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with