Q13402 (MYO7A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 153.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Unconventional myosin-VIIa | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 2215 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which are then moved relative to actin filaments. In the retina, plays an important role in the renewal of the outer photoreceptor disks. Plays an important role in the distribution and migration of retinal pigment epithelial (RPE) melanosomes and phagosomes, and in the regulation of opsin transport in retinal photoreceptors. In the inner ear, plays an important role in differentiation, morphogenesis and organization of cochlear hair cell bundles. Involved in hair-cell vesicle trafficking of aminoglycosides, which are known to induce ototoxicity By similarity. Motor protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing. Ref.11 Ref.12 Ref.13 Ref.14 |
| Enzyme regulation | ATP hydrolysis is inhibited by Mg2+, already at a concentration of 0.4 mM. Ref.12 |
| Subunit structure | Interacts with PLEKHB1 (via PH domain). Interacts with PCDH15. Interacts with RPE65. Interacts with TWF2 By similarity. Might homodimerize in a two headed molecule through the formation of a coiled-coil rod. May interact with CALM. Binds MYRIP and WHRN. Identified in a complex with USH1C and USH1G. Ref.10 Ref.13 Ref.14 Ref.28 |
| Subcellular location | Cytoplasm. Cytoplasm › cell cortex. Cytoplasm › cytoskeleton. Note: In the photoreceptor cells, mainly localized in the inner and base of outer segments as well as in the synaptic ending region. Colocalizes with a subset of melanosomes in retinal pigment epithelium cells. Detected at the tip of cochlear hair cell stereocilia. The complex formed by MYO7A, USH1C and USH1G colocalizes with F-actin. Ref.11 Ref.14 |
| Tissue specificity | Expressed in the pigment epithelium and the photoreceptor cells of the retina. Also found in kidney, liver, testis, cochlea, lymphocytes. Not expressed in brain. Ref.11 Ref.13 Ref.14 |
| Developmental stage | Detected in optic cup in 5.5 weeks-old embryos. Expressed in retinal pigment epithelium, cochlear and vestibular neuroepithelia, and olfactory epithelium at 8 weeks. At 19 weeks, present in both pigment epithelium and photoreceptor cells. At 24-28 weeks, expression in pigment epithelium and photoreceptor cells increases. Present in pigment epithelium and photoreceptor cells in adult. Ref.1 Ref.9 |
| Involvement in disease | Usher syndrome 1B (USH1B) [MIM:276900]: USH is a genetically heterogeneous condition characterized by the association of retinitis pigmentosa with sensorineural deafness. Age at onset and differences in auditory and vestibular function distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2 (USH2) and Usher syndrome type 3 (USH3). USH1 is characterized by profound congenital sensorineural deafness, absent vestibular function and prepubertal onset of progressive retinitis pigmentosa leading to blindness. Deafness, autosomal recessive, 2 (DFNB2) [MIM:600060]: A form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Deafness, autosomal dominant, 11 (DFNA11) [MIM:601317]: A form of non-syndromic sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. DFNA11 is characterized by onset after complete speech acquisition and subsequent gradual progression. Defects in MYO7A may be a cause of Leber congenital amaurosis (LCA), a severe dystrophy of the retina, typically becoming evident in the first years of life. Visual function is usually poor and often accompanied by nystagmus, sluggish or near-absent pupillary responses, photophobia, high hyperopia and keratoconus. Ref.32 |
| Sequence similarities | Contains 2 FERM domains. Contains 5 IQ domains. Contains 1 myosin head-like domain. Contains 2 MyTH4 domains. Contains 1 SH3 domain. |
| Caution | Represents a unconventional myosin. This protein should not be confused with the conventional myosin-7 (MYH7). |
Ontologies
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q13402-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q13402-2) The sequence of this isoform differs from the canonical sequence as follows: 1524-1561: Missing. 2117-2118: Missing. | ||||||
| Isoform 3 (identifier: Q13402-3) The sequence of this isoform differs from the canonical sequence as follows: 1169-1200: DEIYCQISKQLTHNPSKSSYARGWILVSLCVG → SVPESLLVAEWCLCQPSKRLSQAWPGFGFAAS 1201-2215: Missing. | ||||||
| Isoform 4 (identifier: Q13402-4) The sequence of this isoform differs from the canonical sequence as follows: 1095-1095: E → EVLQ 1169-1200: DEIYCQISKQLTHNPSKSSYARGWILVSLCVG → SVPESLLVAEWCLCQPSKRLSQAWPGFGFAAS 1201-2215: Missing. | ||||||
| Isoform 5 (identifier: Q13402-5) The sequence of this isoform differs from the canonical sequence as follows: 284-360: Missing. 519-564: Missing. | ||||||
| Isoform 6 (identifier: Q13402-6) The sequence of this isoform differs from the canonical sequence as follows: 1096-1125: Missing. | ||||||
| Isoform 7 (identifier: Q13402-7) The sequence of this isoform differs from the canonical sequence as follows: 1433-1470: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 2215 | 2215 | Unconventional myosin-VIIa | PRO_0000123466 | |||||
Regions | |||||||||
| Domain | 1 – 729 | 729 | Myosin head-like | ||||||
| Domain | 745 – 765 | 21 | IQ 1 | ||||||
| Domain | 768 – 788 | 21 | IQ 2 | ||||||
| Domain | 791 – 811 | 21 | IQ 3 | ||||||
| Domain | 814 – 834 | 21 | IQ 4 | ||||||
| Domain | 837 – 857 | 21 | IQ 5 | ||||||
| Domain | 1017 – 1253 | 237 | MyTH4 1 | ||||||
| Domain | 1258 – 1602 | 345 | FERM 1 | ||||||
| Domain | 1603 – 1672 | 70 | SH3 | ||||||
| Domain | 1747 – 1896 | 150 | MyTH4 2 | ||||||
| Domain | 1902 – 2205 | 304 | FERM 2 | ||||||
| Nucleotide binding | 158 – 165 | 8 | ATP Probable | ||||||
| Region | 632 – 639 | 8 | Actin-binding Probable | ||||||
| Coiled coil | 858 – 935 | 78 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 965 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 284 – 360 | 77 | Missing in isoform 5. | VSP_003353 | |||||
| Alternative sequence | 519 – 564 | 46 | Missing in isoform 5. | VSP_003354 | |||||
| Alternative sequence | 1095 | 1 | E → EVLQ in isoform 4. | VSP_003355 | |||||
| Alternative sequence | 1096 – 1125 | 30 | Missing in isoform 6. | VSP_003358 | |||||
| Alternative sequence | 1169 – 1200 | 32 | DEIYC…SLCVG → SVPESLLVAEWCLCQPSKRL SQAWPGFGFAAS in isoform 3 and isoform 4. | VSP_003356 | |||||
| Alternative sequence | 1201 – 2215 | 1015 | Missing in isoform 3 and isoform 4. | VSP_003357 | |||||
| Alternative sequence | 1433 – 1470 | 38 | Missing in isoform 7. | VSP_003359 | |||||
| Alternative sequence | 1524 – 1561 | 38 | Missing in isoform 2. | VSP_003360 | |||||
| Alternative sequence | 2117 – 2118 | 2 | Missing in isoform 2. | VSP_045848 | |||||
| Natural variant | 16 | 1 | L → S in USH1B; heterozygosity approaching 50%. Ref.30 Corresponds to variant rs1052030 [ dbSNP | Ensembl ]. | VAR_009315 | |||||
| Natural variant | 25 | 1 | G → R in USH1B. Ref.17 Ref.30 | VAR_009316 | |||||
| Natural variant | 26 | 1 | A → E in USH1B. Ref.25 | VAR_024039 | |||||
| Natural variant | 67 | 1 | V → M in USH1B. Ref.25 | VAR_024040 | |||||
| Natural variant | 90 | 1 | R → P in USH1B. Ref.25 | VAR_024041 | |||||
| Natural variant | 133 | 1 | H → D in USH1B; the deleterious effect remains to be proven. Ref.31 | VAR_027301 | |||||
| Natural variant | 134 | 1 | I → N in USH1B. Ref.25 | VAR_024042 | |||||
| Natural variant | 163 | 1 | G → R in USH1B. Ref.31 | VAR_027302 | |||||
| Natural variant | 164 | 1 | K → R in USH1B. Ref.31 | VAR_027303 | |||||
| Natural variant | 165 | 1 | T → M in USH1B. Ref.30 Ref.31 | VAR_024043 | |||||
| Natural variant | 193 | 1 | T → I in LCA. Ref.32 | VAR_066861 | |||||
| Natural variant | 198 | 1 | A → T in USH1B; is predicted to alter the normal splicing of exon 6. Ref.31 | VAR_027304 | |||||
| Natural variant | 204 | 1 | T → A in USH1B. Ref.31 | VAR_027305 | |||||
| Natural variant | 205 | 1 | I → V. | VAR_009317 | |||||
| Natural variant | 212 | 1 | R → C in USH1B; frequent mutation. Ref.15 | VAR_009318 | |||||
| Natural variant | 212 | 1 | R → H in USH1B; frequent mutation. Ref.15 Corresponds to variant rs28934610 [ dbSNP | Ensembl ]. | VAR_009319 | |||||
| Natural variant | 214 | 1 | G → R in USH1B. Ref.16 | VAR_009320 | |||||
| Natural variant | 218 – 219 | 2 | Missing in USH1B. | VAR_009321 | |||||
| Natural variant | 241 | 1 | R → C in USH1B. Ref.25 | VAR_024044 | |||||
| Natural variant | 241 | 1 | R → S in USH1B. | VAR_009322 | |||||
| Natural variant | 244 | 1 | R → P in DFNB2. Ref.18 | VAR_009323 | |||||
| Natural variant | 269 | 1 | Missing in USH1B. Ref.25 | VAR_024045 | |||||
| Natural variant | 302 | 1 | R → H in USH1B; uncertain pathological significance. Ref.15 Corresponds to variant rs41298135 [ dbSNP | Ensembl ]. | VAR_009324 | |||||
| Natural variant | 397 | 1 | A → D in USH1B. Ref.16 Ref.26 | VAR_009325 | |||||
| Natural variant | 450 | 1 | E → Q in USH1B. Ref.15 | VAR_009326 | |||||
| Natural variant | 457 | 1 | A → V in USH1B. Ref.25 | VAR_024046 | |||||
| Natural variant | 458 | 1 | N → I in DFNA11. Ref.27 Corresponds to variant rs28934903 [ dbSNP | Ensembl ]. | VAR_027306 | |||||
| Natural variant | 468 | 1 | H → HQ in USH1B. Ref.15 | VAR_009327 | |||||
| Natural variant | 503 | 1 | P → L in USH1B. Ref.15 | VAR_009328 | |||||
| Natural variant | 519 | 1 | G → D in USH1B; the deleterious effect remains to be proven. Ref.25 Ref.31 | VAR_024047 | |||||
| Natural variant | 597 | 1 | V → I Rare polymorphism. | VAR_009329 | |||||
| Natural variant | 599 | 1 | M → I in DFNB2. Ref.19 | VAR_009330 | |||||
| Natural variant | 602 | 1 | E → K. Corresponds to variant rs2276282 [ dbSNP | Ensembl ]. | VAR_056187 | |||||
| Natural variant | 651 | 1 | L → P in USH1B; atypical. Ref.21 | VAR_009331 | |||||
| Natural variant | 679 | 1 | V → I. Corresponds to variant rs35641839 [ dbSNP | Ensembl ]. | VAR_056188 | |||||
| Natural variant | 722 | 1 | G → R in DFNA11. Ref.29 | VAR_027307 | |||||
| Natural variant | 756 | 1 | R → W in USH1B. Ref.30 | VAR_024048 | |||||
| Natural variant | 826 | 1 | A → T in USH1B. Ref.16 | VAR_009332 | |||||
| Natural variant | 853 | 1 | R → C in DFNA11; disturb calmodulin/MYO7A binding; may result in impaired adaptation to environmental stimuli and progressive deterioration of hearing transduction in heterozygotes. Ref.28 | VAR_027308 | |||||
| Natural variant | 886 – 888 | 3 | Missing in DFNA11. | VAR_009333 | |||||
| Natural variant | 955 | 1 | G → S in USH1B. Ref.17 | VAR_009334 | |||||
| Natural variant | 968 | 1 | E → D in USH1B. Ref.25 Ref.30 | VAR_024049 | |||||
| Natural variant | 1087 | 1 | L → P in USH1B. Ref.22 | VAR_009335 | |||||
| Natural variant | 1170 | 1 | E → K in USH1B. Ref.24 Ref.26 Ref.31 | VAR_009336 | |||||
| Natural variant | 1240 | 1 | R → Q in USH1B. Ref.25 Ref.31 | VAR_009337 | |||||
| Natural variant | 1288 | 1 | A → P in USH1B. Ref.25 | VAR_009338 | |||||
| Natural variant | 1327 | 1 | E → K in USH1B. Ref.26 | VAR_027309 | |||||
| Natural variant | 1343 | 1 | R → S in USH1B. | VAR_009339 | |||||
| Natural variant | 1346 | 1 | Missing in USH1B. Ref.25 | VAR_024050 | |||||
| Natural variant | 1347 – 1351 | 5 | Missing in USH1B. | VAR_027310 | |||||
| Natural variant | 1566 | 1 | T → M in USH1B; unknown pathological significance. Ref.26 Ref.31 Corresponds to variant rs41298747 [ dbSNP | Ensembl ]. | VAR_027311 | |||||
| Natural variant | 1602 | 1 | R → Q in USH1B; atypical. Ref.21 | VAR_009340 | |||||
| Natural variant | 1628 | 1 | A → S in USH1B. | VAR_009341 | |||||
| Natural variant | 1666 | 1 | S → C. Ref.1 Ref.2 Corresponds to variant rs2276288 [ dbSNP | Ensembl ]. | VAR_009343 | |||||
| Natural variant | 1666 | 1 | S → G. | VAR_027312 | |||||
| Natural variant | 1719 | 1 | Y → C in USH1B; unknown pathological significance. Ref.24 Ref.26 Ref.31 | VAR_009344 | |||||
| Natural variant | 1740 | 1 | G → S. Corresponds to variant rs12275336 [ dbSNP | Ensembl ]. | VAR_027313 | |||||
| Natural variant | 1743 | 1 | R → W in USH1B. Ref.25 | VAR_024051 | |||||
| Natural variant | 1858 | 1 | L → P in USH1B. Ref.25 Ref.31 | VAR_024052 | |||||
| Natural variant | 1873 | 1 | R → W in USH1B. Ref.31 | VAR_027314 | |||||
| Natural variant | 1883 | 1 | R → Q in USH1B. Ref.30 | VAR_024053 | |||||
| Natural variant | 1887 | 1 | P → L in USH1B. Ref.25 | VAR_024054 | |||||
| Natural variant | 1954 | 1 | L → I. Ref.1 Ref.2 Corresponds to variant rs948962 [ dbSNP | Ensembl ]. | VAR_009345 | |||||
| Natural variant | 1962 | 1 | Missing in USH1B. Ref.31 | VAR_027315 | |||||
| Natural variant | 1992 | 1 | F → I. | VAR_009346 | |||||
| Natural variant | 2137 | 1 | G → E in USH1B. Ref.17 | VAR_009347 | |||||
| Natural variant | 2142 | 1 | D → N. Corresponds to variant rs1132036 [ dbSNP | Ensembl ]. | VAR_027316 | |||||
| Natural variant | 2163 | 1 | G → S in USH1B. | VAR_009348 | |||||
| Natural variant | 2187 | 1 | G → D in USH1B. Ref.25 | VAR_024055 | |||||
Experimental info | |||||||||
| Sequence conflict | 172 | 1 | L → P in AAA20909. Ref.4 | ||||||
| Sequence conflict | 470 | 1 | F → L in AAC50927. Ref.2 | ||||||
| Sequence conflict | 470 | 1 | F → L in AAC50722. Ref.2 | ||||||
| Sequence conflict | 576 | 1 | D → N in AAC51150. Ref.8 | ||||||
| Sequence conflict | 794 | 1 | F → S in AAC50927. Ref.2 | ||||||
| Sequence conflict | 794 | 1 | F → S in AAC50722. Ref.2 | ||||||
| Sequence conflict | 794 | 1 | F → S in AAC50218. Ref.6 | ||||||
| Sequence conflict | 873 | 1 | R → Q in AAC50927. Ref.2 | ||||||
| Sequence conflict | 873 | 1 | R → Q in AAC50722. Ref.2 | ||||||
| Sequence conflict | 873 | 1 | R → Q in AAC50218. Ref.6 | ||||||
| Sequence conflict | 1073 – 1075 | 3 | KIY → RNS in AAC50218. Ref.6 | ||||||
| Sequence conflict | 1237 | 1 | N → S in AAC50927. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human myosin VIIA responsible for the Usher 1B syndrome: a predicted membrane-associated motor protein expressed in developing sensory epithelia." Weil D., Levy G., Sahly I., Levi-Acobas F., Blanchard S., El-Amraoui A., Crozet F., Philippe H., Abitbol M., Petit C. Proc. Natl. Acad. Sci. U.S.A. 93:3232-3237(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 5; 6 AND 7), DEVELOPMENTAL STAGE, VARIANTS CYS-1666 AND ILE-1954. Tissue: Retina. |
| [2] | "Molecular cloning and domain structure of human myosin-VIIa, the gene product defective in usher syndrome 1B." Chen Z.-Y., Hasson T., Kelley P.M., Schwender B.J., Schwartz M.F., Ramakrishnan M., Kimberling W.J., Mooseker M.S., Corey D.P. Genomics 36:440-448(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), VARIANTS CYS-1666 AND ILE-1954. Tissue: Testis. |
| [3] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Identification and overlapping expression of multiple unconventional myosin genes in vertebrate cell types." Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S. Proc. Natl. Acad. Sci. U.S.A. 91:6549-6553(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 166-196. Tissue: Epithelium, Leukocyte and Liver. |
| [5] | Erratum Bement W.M., Hasson T., Wirth J.A., Cheney R.E., Mooseker M.S. Proc. Natl. Acad. Sci. U.S.A. 91:11767-11767(1994) [PubMed] [Europe PMC] [Abstract] |
| [6] | "Expression in cochlea and retina of myosin VIIa, the gene product defective in Usher syndrome type 1B." Hasson T., Heintzelman M.B., Santos-Sacchi J., Corey D.P., Mooseker M.S. Proc. Natl. Acad. Sci. U.S.A. 92:9815-9819(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1075. Tissue: Testis. |
| [7] | "Defective myosin VIIA gene responsible for Usher syndrome type 1B." Weil D., Blanchard S., Kaplan J., Guilford P., Gibson F., Walsh J., Mburu P., Varela A., Levilliers J., Weston M.D., Kelley P.M., Kimberling W.J., Wagenaar M., Levi-Acobas F., Larget-Piet D., Munnich A., Steel K.P., Brown S.D.M., Petit C. Nature 374:60-61(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 96-564 (ISOFORM 1), VARIANTS USH1B. Tissue: Retina. |
| [8] | "The genomic structure of the gene defective in Usher syndrome type Ib (MYO7A)." Kelley P.M., Weston M.D., Chen Z.-Y., Orten D.J., Hasson T., Overbeck L.D., Pinnt J., Talmadge C.B., Ing P., Mooseker M.S., Corey D.P., Sumegi J., Kimberling W.J. Genomics 40:73-79(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 79-578. |
| [9] | "Human Usher 1B/mouse shaker-1: the retinal phenotype discrepancy explained by the presence/absence of myosin VIIA in the photoreceptor cells." El-Amraoui A., Sahly I., Picaud S., Sahel J., Abitbol M., Petit C. Hum. Mol. Genet. 5:1171-1178(1996) [PubMed] [Europe PMC] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [10] | "MyRIP, a novel Rab effector, enables myosin VIIa recruitment to retinal melanosomes." El-Amraoui A., Schonn J.-S., Kuessel-Andermann P., Blanchard S., Desnos C., Henry J.-P., Wolfrum U., Darchen F., Petit C. EMBO Rep. 3:463-470(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MYRIP. |
| [11] | "Function of MYO7A in the human RPE and the validity of shaker1 mice as a model for Usher syndrome 1B." Gibbs D., Diemer T., Khanobdee K., Hu J., Bok D., Williams D.S. Invest. Ophthalmol. Vis. Sci. 51:1130-1135(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [12] | "Functional characterization of the human myosin-7a motor domain." Heissler S.M., Manstein D.J. Cell. Mol. Life Sci. 69:299-311(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ENZYME REGULATION. |
| [13] | "The Usher 1B protein, MYO7A, is required for normal localization and function of the visual retinoid cycle enzyme, RPE65." Lopes V.S., Gibbs D., Libby R.T., Aleman T.S., Welch D.L., Lillo C., Jacobson S.G., Radu R.A., Steel K.P., Williams D.S. Hum. Mol. Genet. 20:2560-2570(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH RPE65. |
| [14] | "Myosin VIIa and sans localization at stereocilia upper tip-link density implicates these Usher syndrome proteins in mechanotransduction." Grati M., Kachar B. Proc. Natl. Acad. Sci. U.S.A. 108:11476-11481(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, IDENTIFICATION IN A COMPLEX WITH USH1C AND USH1G, TISSUE SPECIFICITY. |
| [15] | "Myosin VIIA mutation screening in 189 Usher syndrome type 1 patients." Weston M.D., Kelley P.M., Overbeck L.D., Wagenaar M., Orten D.J., Hasson T., Chen Z.-Y., Corey D.P., Mooseker M.S., Sumegi J., Cremers C., Moeller C., Jacobson S.G., Gorin M.B., Kimberling W.J. Am. J. Hum. Genet. 59:1074-1083(1996) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B CYS-212; HIS-212; HIS-302; GLN-450; GLN-468 INS AND LEU-503. |
| [16] | "Mutation profile of all 49 exons of the human myosin VIIA gene, and haplotype analysis, in Usher 1B families from diverse origins." Adato A., Weil D., Kalinski H., Pel-Or Y., Ayadi H., Petit C., Korostishevsky M., Bonne-Tamir B. Am. J. Hum. Genet. 61:813-821(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B ARG-214; ASP-397 AND THR-826, POLYMORPHISM. |
| [17] | "Myosin VIIA gene: heterogeneity of the mutations responsible for Usher syndrome type IB." Levy G., Levi-Acobas F., Blanchard S., Gerber S., Larget-Piet D., Chenal V., Liu X.-Z., Newton V., Steel K.P., Brown S.D.M., Munnich A., Kaplan J., Petit C., Weil D. Hum. Mol. Genet. 6:111-116(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B ARG-25; SER-955 AND GLU-2137, POLYMORPHISM. |
| [18] | "Mutations in the myosin VIIA gene cause non-syndromic recessive deafness." Liu X.-Z., Walsh J., Mburu P., Kendrick-Jones J., Cope M.J., Steel K.P., Brown S.D.M. Nat. Genet. 16:188-190(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DFNB2 PRO-244. |
| [19] | "The autosomal recessive isolated deafness, DFNB2, and the Usher 1B syndrome are allelic defects of the myosin-VIIA gene." Weil D., Kuessel P., Blanchard S., Levy G., Levi-Acobas F., Drira M., Ayadi H., Petit C. Nat. Genet. 16:191-193(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DFNB2 ILE-599. |
| [20] | "Autosomal dominant non-syndromic deafness caused by a mutation in the myosin VIIA gene." Liu X.-Z., Walsh J., Tamagawa Y., Kitamura K., Nishizawa M., Steel K.P., Brown S.D.M. Nat. Genet. 17:268-269(1997) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DFNA11 886-ALA--LYS-888 DEL. |
| [21] | "Mutations in the myosin VIIA gene cause a wide phenotypic spectrum, including atypical Usher syndrome." Liu X.-Z., Hope C., Walsh J., Newton V., Ke X.M., Liang C.Y., Xu L.R., Zhou J.M., Trump D., Steel K.P., Bundey S., Brown S.D.M. Am. J. Hum. Genet. 63:909-912(1998) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B PRO-651 AND GLN-1602. |
| [22] | "Possible interaction between USH1B and USH3 gene products as implied by apparent digenic deafness inheritance." Adato A., Kalinski H., Weil D., Chaib H., Korostishevsky M., Bonne-Tamir B. Am. J. Hum. Genet. 65:261-265(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT USH1B PRO-1087. |
| [23] | "Twelve novel myosin VIIA mutations in 34 patients with Usher syndrome type I: confirmation of genetic heterogeneity." Janecke A.R., Meins M., Sadeghi M., Grundmann K., Apfelstedt-Sylla E., Zrenner E., Rosenberg T., Gal A. Hum. Mutat. 13:133-140(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B, POLYMORPHISM. |
| [24] | "Identification of three novel mutations in the MYO7A gene." Cuevas J.M., Espinos C., Millan J.M., Sanchez F., Trujillo M.J., Ayuso C., Beneyto M., Najera C. Hum. Mutat. 14:181-181(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B LYS-1170 AND CYS-1719. |
| [25] | "Evaluation of the myosin VIIA gene and visual function in patients with Usher syndrome type I." Bharadwaj A.K., Kasztejna J.P., Huq S., Berson E.L., Dryja T.P. Exp. Eye Res. 71:173-181(2000) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B GLU-26; MET-67; PRO-90; ASN-134; CYS-241; LYS-269 DEL; VAL-457; ASP-519; ASP-968; GLN-1240; PRO-1288; PHE-1346 DEL; TRP-1743; PRO-1858; LEU-1887 AND ASP-2187. |
| [26] | "Mutations in myosin VIIA (MYO7A) and usherin (USH2A) in Spanish patients with Usher syndrome types I and II, respectively." Najera C., Beneyto M., Blanca J., Aller E., Fontcuberta A., Millan J.M., Ayuso C. Hum. Mutat. 20:76-77(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B ASP-397; LYS-1170; LYS-1327; 1347-ARG--PHE-1351 DEL; MET-1566 AND CYS-1719. |
| [27] | "Identification and molecular modelling of a mutation in the motor head domain of myosin VIIA in a family with autosomal dominant hearing impairment (DFNA11)." Luijendijk M.W.J., Van Wijk E., Bischoff A.M.L.C., Krieger E., Huygen P.L.M., Pennings R.J.E., Brunner H.G., Cremers C.W.R.J., Cremers F.P.M., Kremer H. Hum. Genet. 115:149-156(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DFNA11 ILE-458. |
| [28] | "Impaired calmodulin binding of myosin-7A causes autosomal dominant hearing loss (DFNA11)." Bolz H., Bolz S.-S., Schade G., Kothe C., Mohrmann G., Hess M., Gal A. Hum. Mutat. 24:274-275(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DFNA11 CYS-853, INTERACTION WITH CALM, CHARACTERIZATION OF VARIANT DFNA11 CYS-853. |
| [29] | "Modifier controls severity of a novel dominant low-frequency MyosinVIIA (MYO7A) auditory mutation." Street V.A., Kallman J.C., Kiemele K.L. J. Med. Genet. 41:E62-E62(2004) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT DFNA11 ARG-722. |
| [30] | "Characterization of Usher syndrome type I gene mutations in an Usher syndrome patient population." Ouyang X.M., Yan D., Du L.L., Hejtmancik J.F., Jacobson S.G., Nance W.E., Li A.R., Angeli S., Kaiser M., Newton V., Brown S.D.M., Balkany T., Liu X.Z. Hum. Genet. 116:292-299(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B SER-16; ARG-25; MET-165; TRP-756; ASP-968 AND GLN-1883. |
| [31] | "Survey of the frequency of USH1 gene mutations in a cohort of Usher patients shows the importance of cadherin 23 and protocadherin 15 genes and establishes a detection rate of above 90%." Roux A.-F., Faugere V., Le Guedard S., Pallares-Ruiz N., Vielle A., Chambert S., Marlin S., Hamel C., Gilbert B., Malcolm S., Claustres M. J. Med. Genet. 43:763-768(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS USH1B ASP-133; ARG-163; ARG-164; MET-165; THR-198; ALA-204; ASP-519; LYS-1170; GLN-1240; PRO-1858; TRP-1873 AND PHE-1962 DEL, VARIANTS MET-1566 AND CYS-1719. |
| [32] | "Whole-exome sequencing identifies ALMS1, IQCB1, CNGA3, and MYO7A mutations in patients with Leber congenital amaurosis." Wang X., Wang H., Cao M., Li Z., Chen X., Patenia C., Gore A., Abboud E.B., Al-Rajhi A.A., Lewis A.R., Lupski J.R., Mardon G., Zhang K., Muzny D., Gibbs R.A., Chen R. Hum. Mutat. 32:1450-1459(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LCA ILE-193. |
| + | Additional computationally mapped references. |
Web resources
| Hereditary hearing loss homepage Gene page |
| Mutations of the MYO7A gene Retina International's Scientific Newsletter |
| GeneReviews |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U39226 mRNA. Translation: AAB03679.1. U55208 mRNA. Translation: AAC50927.1. U55209 mRNA. Translation: AAC50722.1. AP000752 Genomic DNA. No translation available. AP001855 Genomic DNA. No translation available. L29146 mRNA. Translation: AAA20909.1. U34227 mRNA. Translation: AAC50218.1. AH006665 Genomic DNA. Translation: AAC51150.1. |
| IPI | IPI00013193. IPI00215753. IPI00215754. IPI00215756. IPI00215758. IPI00215759. IPI00936807. |
| PIR | A59255. A59257. I61697. |
| RefSeq | NP_000251.3. NM_000260.3. NP_001120651.2. NM_001127179.2. NP_001120652.1. NM_001127180.1. |
| UniGene | Hs.370421. |
3D structure databases | |
| ProteinModelPortal | Q13402. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1895479. |
| STRING | 9606.ENSP00000386331. |
PTM databases | |
| PhosphoSite | Q13402. |
Polymorphism databases | |
| DMDM | 9297020. |
Proteomic databases | |
| PaxDb | Q13402. |
| PRIDE | Q13402. |
Protocols and materials databases | |
| DNASU | 4647. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000409709; ENSP00000386331; ENSG00000137474. ENST00000458637; ENSP00000392185; ENSG00000137474. ENST00000571155; ENSP00000459665; ENSG00000261910. ENST00000575980; ENSP00000459105; ENSG00000261910. |
| GeneID | 4647. |
| KEGG | hsa:4647. |
| UCSC | uc001oyb.2. human. |
Organism-specific databases | |
| CTD | 4647. |
| GeneCards | GC11P076839. |
| H-InvDB | HIX0035966. |
| HGNC | HGNC:7606. MYO7A. |
| HPA | CAB034059. HPA028918. |
| MIM | 276900. phenotype. 276903. gene. 600060. phenotype. 601317. phenotype. |
| neXtProt | NX_Q13402. |
| Orphanet | 90635. Autosomal dominant nonsyndromic sensorineural deafness type DFNA. 90636. Autosomal recessive nonsyndromic sensorineural deafness type DFNB. 65. Leber congenital amaurosis. 231169. Usher syndrome type 1. |
| PharmGKB | PA31411. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5022. |
| HOGENOM | HOG000007836. |
| HOVERGEN | HBG052557. |
| InParanoid | Q13402. |
| KO | K10359. |
| OrthoDB | EOG4S1T67. |
Gene expression databases | |
| ArrayExpress | Q13402. |
| Bgee | Q13402. |
| CleanEx | HS_MYO7A. |
| Genevestigator | Q13402. |
| GermOnline | ENSG00000137474. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.80.10. 2 hits. 2.30.29.30. 1 hit. |
| InterPro | IPR019749. Band_41_domain. IPR014352. FERM/acyl-CoA-bd_prot_3-hlx. IPR019748. FERM_central. IPR000299. FERM_domain. IPR018979. FERM_N. IPR000048. IQ_motif_EF-hand-BS. IPR001609. Myosin_head_motor_dom. IPR000857. MyTH4_dom. IPR011993. PH_like_dom. IPR001452. SH3_domain. [Graphical view] |
| Pfam | PF00373. FERM_M. 1 hit. PF09379. FERM_N. 1 hit. PF00612. IQ. 3 hits. PF00063. Myosin_head. 1 hit. PF00784. MyTH4. 2 hits. [Graphical view] |
| PRINTS | PR00193. MYOSINHEAVY. |
| SMART | SM00295. B41. 2 hits. SM00015. IQ. 4 hits. SM00242. MYSc. 1 hit. SM00139. MyTH4. 2 hits. SM00326. SH3. 1 hit. [Graphical view] |
| SUPFAM | SSF47031. FERM_3-hlx. 2 hits. SSF50044. SH3. 1 hit. |
| PROSITE | PS00660. FERM_1. False negative. PS00661. FERM_2. False negative. PS50057. FERM_3. 2 hits. PS50096. IQ. 3 hits. PS51016. MYTH4. 2 hits. PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 4647. |
| NextBio | 17912. |
| SOURCE | Search... |
Entry information
| Entry name | MYO7A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q13402 Secondary accession number(s): F8VUN5 Q92822 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
